HHsearch results for GI: 254780628 and protein with PDBid: 1olt_A

>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2
Probab=100.00  E-value=0  Score=655.22  Aligned_cols=382  Identities=23%  Similarity=0.368  Sum_probs=352.6

Q ss_pred             HHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCC
Q ss_conf             89988428898854999940651183765773024578866288999999999999987618950589996288888789
Q gi|254780628|r    6 AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIE   85 (395)
Q Consensus         6 ~~~~~~~~~~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~   85 (395)
                      ++.+.+...+.+|||||||||||+++|+||+|++.+.+.....++|+++|.+||+..+...++.++++|||||||||+|+
T Consensus        40 ~~~~~l~~~~~~plsLYiHIPFC~~~C~yC~~~~~~~~~~~~~~~Yl~~L~~Ei~~~a~~~~~~~v~~i~~GGGTpt~L~  119 (457)
T 1olt_A           40 AFLQAVARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLN  119 (457)
T ss_dssp             HHHHHHTTCTTSCEEEEEEECEESSCCTTCCSSCEECSCTHHHHHHHHHHHHHHHHHGGGGTTCCEEEEEEEESCGGGSC
T ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC
T ss_conf             99999850999964999970898988999998245588866199999999999999655638997459998287504489


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99999999766404764443321133210410023477663034541143234332013455422443134789999863
Q gi|254780628|r   86 PQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR  165 (395)
Q Consensus        86 ~~~l~~ll~~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~  165 (395)
                      ++++++|++.+++.|++.+++|+|+|++|.+++.++++.|+++||||+||||||||+++|+++||.|+.+++.++++.++
T Consensus       120 ~~~l~~l~~~l~~~f~~~~~~e~tiE~~P~~~~~~~l~~l~~~G~nRiSlGvQsfd~~vlk~i~R~~~~e~~~~~i~~~r  199 (457)
T 1olt_A          120 KAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAR  199 (457)
T ss_dssp             HHHHHHHHHHHHHHSCEEEEEEEEEEECSSSCCTHHHHHHHHTTCCEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             99999999999986477877079998259987176799997379987996078697798856214673888999999999


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             02-44433321000258543221112788753180012346468825960001454498021103567889998655788
Q gi|254780628|r  166 NI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS  244 (395)
Q Consensus       166 ~~-~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~  244 (395)
                      ++ +.+||+||||||||||.++|.+||+.+++++||||++|+|.+.|+|. ..+...++..+|++++..+||+.+.+.|.
T Consensus       200 ~~g~~~i~~DLI~GlPgqt~e~~~~tl~~~~~l~pd~i~~y~~~~~p~~~-~~q~~~~~~~lp~~~~~~~~~~~a~~~L~  278 (457)
T 1olt_A          200 EIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVFNYAHLPTIF-AAQRKIKDADLPSPQQKLDILQETIAFLT  278 (457)
T ss_dssp             HTTCCSCEEEEEESCTTCCHHHHHHHHHHHHHHCCSEEEEEECCCCTTTS-GGGGGSCGGGSCCHHHHHHHHHHHHHHHH
T ss_pred             HHHCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECEECCCHH-HHHHCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             84054372331577998337788889988884089811343110078427-76632222354202799999999999999


Q ss_pred             HCCCCCCCCCCHHHHHH----------HHCCCCCCCCC--CCEEECCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHCCC
Q ss_conf             70962423674343101----------10133211244--4123204320011578861578654247025778775389
Q gi|254780628|r  245 AHGLHAYEISNHSFLGA----------ESLHNLNYWRY--GDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG  312 (395)
Q Consensus       245 ~~GY~~Yeis~fak~~~----------~s~hn~~Yw~~--~d~iG~G~GA~S~l~~~~~~~~~~~~~~~~~Y~~~i~~~~  312 (395)
                      ++||.+|++++|+||+.          .++|+++||..  .++||||+||+|++++.    .++|.+++++|.+++++++
T Consensus       279 ~~GY~~~~~~~fak~~d~l~~a~~~g~l~r~~~~y~~~~~~~~iGlG~sA~S~~~~~----~~~N~~~l~~Y~~~i~~g~  354 (457)
T 1olt_A          279 QSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDC----YAQNQKELKQYYQQVDEQG  354 (457)
T ss_dssp             HTTCEEEETTEEECTTSHHHHHHHHTCCEECSSCEESCCSCEEEEESTTCEEEETTE----EEEECSSHHHHHHHHHHHS
T ss_pred             HCCHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCEEECCCE----EEEECCCHHHHHHHHHHCC
T ss_conf             778354212331278725567876374432313411268830750477662103880----0474056799999998479


Q ss_pred             CCCCCEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHH------HHHHHHHCCCEEEEECCEEEECHHHHHHH
Q ss_conf             633322454999989999999656237998889998838996499------99999987994985598999956758989
Q gi|254780628|r  313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE------CERNLQRQGFIERVQFSRLRCTQRGMTML  386 (395)
Q Consensus       313 ~p~~~~~~Ls~~e~~~e~l~~~LR~~~Gid~~~~~~~fg~~~~~~------~~~~L~~~Gli~~~~~~~l~lT~~G~~~~  386 (395)
                      +|+.++..+|.+|++++++|++||+..|||.+.|+++||.++...      .+++|+++||++ .+++++++|++|++|+
T Consensus       355 ~~~~~g~~ls~~d~~r~~ii~~L~~~~~ld~~~~~~~fg~~~~~~f~~~~~~L~~l~~~GLv~-~~~~~i~lT~~Gr~l~  433 (457)
T 1olt_A          355 NALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWDLLFADYFAEDLKLLAPLAKDGLVD-VDEKGIQVTAKGRLLI  433 (457)
T ss_dssp             CCEEEEEECCHHHHHHHHHHHHHHHHSEEEHHHHHHHTTCCHHHHTHHHHHHHHHHHHTTSEE-ECSSEEEECTTTGGGH
T ss_pred             CCHHCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEE-EECCEEEECHHHHHHH
T ss_conf             952403468988999999999899838928799999979788898799999999999789899-9899999998489999


Q ss_pred             HHHHHHH
Q ss_conf             9999986
Q gi|254780628|r  387 DSVIANL  393 (395)
Q Consensus       387 d~I~~~l  393 (395)
                      |+|+..|
T Consensus       434 ~~I~~~F  440 (457)
T 1olt_A          434 RNICMCF  440 (457)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHHH
T ss_conf             9999999