HHsearch results for GI: 254780628 and protein with PDBid: 2h09_A

>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli}
Probab=95.07  E-value=0.19  Score=28.28  Aligned_cols=55  Identities=15%  Similarity=0.132  Sum_probs=45.4

Q ss_pred             CCCCCHHHHHHHHCCCHHH--HHHHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHH
Q ss_conf             3799888999883899649--999999987994985598999956758989999998
Q gi|254780628|r  338 REGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIAN  392 (395)
Q Consensus       338 ~~Gid~~~~~~~fg~~~~~--~~~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~  392 (395)
                      ...+...++.+..|.+...  ..++.|.++|+|.....+.+.||++|+..+..|+.+
T Consensus        52 ~~~vr~~dIA~~L~vs~~sVs~~l~~L~~~GlI~~~~~~~i~LT~~G~~~A~~i~rr  108 (155)
T 2h09_A           52 VGEARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRGVFLTAEGEKLAQESRER  108 (155)
T ss_dssp             HSCCCHHHHHHHHTSCHHHHHHHHHHHHHTTCEEEETTTEEEECHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCEEECHHHHHHHHHHHHH
T ss_conf             897709999999698978999999999778898754998755898599999999999