HHsearch results for GI: 254780628 and protein with PDBid: 2v7f_A

>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84
Probab=93.79  E-value=0.34  Score=26.64  Aligned_cols=39  Identities=26%  Similarity=0.408  Sum_probs=31.6

Q ss_pred             HHHHHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHHHC
Q ss_conf             999999998799498559899995675898999999861
Q gi|254780628|r  356 IECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA  394 (395)
Q Consensus       356 ~~~~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~l~  394 (395)
                      ...+++|++.|+++...++.=++|++|+-++|.|+.+++
T Consensus        99 R~~LQqLE~~g~v~k~~~~GR~lT~~Gq~~LD~iA~~v~  137 (150)
T 2v7f_A           99 RKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELK  137 (150)
T ss_dssp             HHHHHHHHHTTSEEEETTTEEEECHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCEEECCCCCCEECHHHHHHHHHHHHHHH
T ss_conf             999999986888777799983789888999999999999