HHsearch results for GI: 254780628 and protein with PDBid: 2yx0_A

>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii}
Probab=98.67  E-value=1.1e-06  Score=62.90  Aligned_cols=194  Identities=11%  Similarity=0.075  Sum_probs=109.9

Q ss_pred             HHHHHCCCCC-CCEEEEEECCCCCCCCCCCCCE--EEECC----CCCCHHHHHHHHHHHHHHHHHHHCCC----------
Q ss_conf             9988428898-8549999406511837657730--24578----86628899999999999998761895----------
Q gi|254780628|r    7 YENNMTGQGS-NSLGVYVHWPFCVKKCPYCDFN--SHVRR----YKVGQENFIQSFLTEMQWMRQLTGPR----------   69 (395)
Q Consensus         7 ~~~~~~~~~~-~~l~lYihiPFC~~~C~yC~f~--~~~~~----~~~~~~~y~~~l~~Ei~~~~~~~~~~----------   69 (395)
                      |+..+=|..| +-+..---+.+|..+|.||-..  .....    .-...+.-++.+.++.+.....+.+.          
T Consensus        59 yk~~fygi~sh~c~q~tPsl~~CNlrCvfC~r~~~~~~~~~~~~~~d~pe~Ivee~i~~~~~~i~~~~g~~~~~~e~~~E  138 (342)
T 2yx0_A           59 YKQKFYGIHSHRCLQMTPVLAWCTHNCIFCWRPMENFLGTELPQPWDDPAFIVEESIKAQRKLLIGYKGNPKVDKKKFEE  138 (342)
T ss_dssp             HHHHHHCCCGGGEEEEESCSSCCSBCCTTCCCSSSSCSCSSCCSSCCCHHHHHHHHHHHHHHHHTTCC--CCSCHHHHHH
T ss_pred             CCEEEECCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             31433063320458743041520258988899877777766544447989999999999999887642676302566665


Q ss_pred             --EE-EEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHH
Q ss_conf             --05-899962888887899999999976640476444332113321041002347766303454114323433201345
Q gi|254780628|r   70 --SI-SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLR  146 (395)
Q Consensus        70 --~~-~~iy~GGGTPs~l~~~~l~~ll~~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~  146 (395)
                        .+ ...+.|||=|++.+  ++.++++.+++. ++    .+.+-+|....+..........+++.|++-+.+.+++..+
T Consensus       139 a~~~~hvais~~GEPll~p--~l~eli~~~~~~-gi----~~~l~TNGtl~~~~~~l~~~~~~~~~l~vSLDa~~~e~~~  211 (342)
T 2yx0_A          139 AWNPTHAAISLSGEPMLYP--YMGDLVEEFHKR-GF----TTFIVTNGTIPERLEEMIKEDKLPTQLYVSITAPDIETYN  211 (342)
T ss_dssp             HTSCCEEEECSSSCGGGST--THHHHHHHHHHT-TC----EEEEEECSCCHHHHHHHHHTTCCCSEEEEEECCSSHHHHH
T ss_pred             HCCCCEEEEECCCCCCCCH--HHHHHHHHHHHC-CC----EEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCCCHHHHH
T ss_conf             2487679995787753455--599999999863-96----4999658866117999998747886799835789989999


Q ss_pred             HHHCCC---CCHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEE
Q ss_conf             542244---3134789999863024443--332100025854322111278875318001234646882
Q gi|254780628|r  147 FLGRNH---NASEAIAAIHLARNIFPRM--SFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIE  210 (395)
Q Consensus       147 ~~~R~~---~~~~~~~~~~~~~~~~~~v--~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~  210 (395)
                      .+.|+.   ..+.+.+.++.+++.+..+  ++-+   .+|...++..+=.+.+-..+|+.|.+-+++..
T Consensus       212 ki~r~~~~~~~ervl~~L~~L~~~g~~~vir~tl---v~g~N~~ei~~~a~li~~~~pdfie~k~y~~~  277 (342)
T 2yx0_A          212 SVNIPMIPDGWERILRFLELMRDLPTRTVVRLTL---VKGENMHSPEKYAKLILKARPMFVEAKAYMFV  277 (342)
T ss_dssp             HHHCBSSSCHHHHHHHHHHHHTTCSSEEEEEEEE---CTTTTCCCHHHHHHHHHHHCCSEEEEEECC--
T ss_pred             HHHCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEE---ECCCCHHHHHHHHHHHHHCCCCEEEEEEEEEE
T ss_conf             8737667677999999999999669988999999---68987666999999998659998999603870