HHsearch results for GI: 254780628 and protein with PDBid: 3can_A

>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482}
Probab=97.77  E-value=0.00042  Score=45.87  Aligned_cols=162  Identities=12%  Similarity=0.115  Sum_probs=100.4

Q ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCC
Q ss_conf             99628888878999999999766404764443321133210410023477663034541143234332013455422443
Q gi|254780628|r   74 IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHN  153 (395)
Q Consensus        74 iy~GGGTPs~l~~~~l~~ll~~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~  153 (395)
                      |=|-||=|++- ++.|.++++.+++. ++    .+++.+|= ++..+.+..+.+. ++++.+.+.+.|++.-+.+.+ .+
T Consensus         7 Vt~sGGEP~l~-~~~l~ei~~~~k~~-g~----~~~l~TNG-~l~~e~~~~~~~~-~d~~~~sl~~~~~e~~~~i~g-~~   77 (182)
T 3can_A            7 VTFCGGEPLLH-PEFLIDILKRCGQQ-GI----HRAVDTTL-LARKETVDEVMRN-CELLLIDLKSMDSTVHQTFCD-VP   77 (182)
T ss_dssp             EEECSSTGGGS-HHHHHHHHHHHHHT-TC----CEEEECTT-CCCHHHHHHHHHT-CSEEEEECCCSCHHHHHHHHS-SC
T ss_pred             EEEEECCHHCC-HHHHHHHHHHHHHC-CC----CEEEECCC-CCCHHHHHHHHHH-HHHEECCCCCCCHHHHHHHHC-CC
T ss_conf             89983035098-87999999999887-99----19998177-5248999985432-232541423368999998849-98


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCC--CCCCCCCCHHHHHHCCC--CCEEEEEEEEECC---CEEHHHHH--CCCC
Q ss_conf             13478999986302444333210002585--43221112788753180--0123464688259---60001454--4980
Q gi|254780628|r  154 ASEAIAAIHLARNIFPRMSFDLIYALPKQ--TMTQWEMELQRALSYAV--DHLSLYQLTIEKG---TLFYKMHK--DGDL  224 (395)
Q Consensus       154 ~~~~~~~~~~~~~~~~~v~iDli~GlPgq--t~e~~~~~l~~~~~l~p--~~is~Y~l~i~~~---t~l~~~~~--~~~~  224 (395)
                      .+.+.+.++.+++.+..+.+-.+. +|+.  +.+++.+-.+.+.+++.  ..|.+.++.....   ..+.+.+.  ....
T Consensus        78 ~~~v~~~i~~l~~~~~~v~~~~~v-i~~~~~~~~~i~~l~~~i~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~~~~~~~~  156 (182)
T 3can_A           78 NELILKNIRRVAEADFPYYIRIPL-IEGVNADEKNIKLSAEFLASLPRHPEIINLLPYHDIGKGKHAKLGSIYNPKGYKM  156 (182)
T ss_dssp             SHHHHHHHHHHHHTTCCEEEEEEE-CBTTTCSHHHHHHHHHHHHHSSSCCSEEEEEECCC------------------CC
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEE-ECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCCC
T ss_conf             899998899999719850578988-7886599999999999998569981389987676455236887086355557878


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             2110356788999865578870962
Q gi|254780628|r  225 VLPSENVAVDLYNLTQSITSAHGLH  249 (395)
Q Consensus       225 ~~p~~~~~~~~~~~a~e~L~~~GY~  249 (395)
                      ..|++++    ...+.+.+++.|+.
T Consensus       157 ~~p~~e~----~~~~~~~~~~~G~~  177 (182)
T 3can_A          157 QTPSEEV----QQQCIQILTDYGLK  177 (182)
T ss_dssp             BCCCHHH----HHHHHHHHHHTTCC
T ss_pred             CCCCHHH----HHHHHHHHHHCCCE
T ss_conf             9999999----99999999975990