HHSEARCH alignment of GI: 254780628 and SCOP domain: d1olta_

Alignment
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=667.93  Aligned_cols=382  Identities=23%  Similarity=0.375  Sum_probs=351.2

Q ss_pred             HHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCC
Q ss_conf             89988428898854999940651183765773024578866288999999999999987618950589996288888789
Q gi|254780628|r    6 AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIE   85 (395)
Q Consensus         6 ~~~~~~~~~~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~   85 (395)
                      ++.+.+...+.+|||||||||||+++|+||+|++.+.+.....++|+++|++||+..++..++.++.+|||||||||+|+
T Consensus        37 ~~~~~l~~~~~~plsLYiHiPFC~~~C~yC~~~~~~~~~~~~~~~Y~~~L~~Ei~~~~~~~~~~~v~~i~~GGGTPt~L~  116 (441)
T d1olta_          37 AFLQAVARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLN  116 (441)
T ss_dssp             HHHHHHTTCTTSCEEEEEEECEESSCCTTCCSSCEECSCTHHHHHHHHHHHHHHHHHGGGGTTCCEEEEEEEESCGGGSC
T ss_pred             HHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCC
T ss_conf             99999961899962899972897888998958365488855099999999999999667617985030386188847789


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99999999766404764443321133210410023477663034541143234332013455422443134789999863
Q gi|254780628|r   86 PQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR  165 (395)
Q Consensus        86 ~~~l~~ll~~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~  165 (395)
                      +++|.+|++.++++|++.+++|+|+|++|++++.++|+.|++.||||||||||||||++|+++||.|+.+++.++++.+|
T Consensus       117 ~~~l~~ll~~l~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~G~nRiSlGvQs~~~~vl~~i~R~~~~~~~~~~~~~~r  196 (441)
T d1olta_         117 KAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAR  196 (441)
T ss_dssp             HHHHHHHHHHHHHHSCEEEEEEEEEEECSSSCCTHHHHHHHHTTCCEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCHHHHHHHHHHCCCEEEECCHHCCHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             99999999987652234500002210234542057899999719855995120013045544305787899999999877


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             02-44433321000258543221112788753180012346468825960001454498021103567889998655788
Q gi|254780628|r  166 NI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS  244 (395)
Q Consensus       166 ~~-~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~  244 (395)
                      ++ |.+||+|||||+||||.++|.+||+.+++++||||++|+|.++|++. .++...++..+|++++..+||+.+.+.|.
T Consensus       197 ~~g~~~vn~DLI~GlPgqT~~~~~~tl~~~~~l~pd~is~y~~~~~p~~~-~~q~~~~~~~lp~~~~~~~~~~~~~~~L~  275 (441)
T d1olta_         197 EIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVFNYAHLPTIF-AAQRKIKDADLPSPQQKLDILQETIAFLT  275 (441)
T ss_dssp             HTTCCSCEEEEEESCTTCCHHHHHHHHHHHHHHCCSEEEEEECCCCTTTS-GGGGGSCGGGSCCHHHHHHHHHHHHHHHH
T ss_pred             HCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEECCCHH-HHHHHCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             41442362354432377603778899989985088742232211246126-76630223200245788899999999998


Q ss_pred             HCCCCCCCCCCHHHHHHH------------HCCCCCCCCCCCEEECCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHCCC
Q ss_conf             709624236743431011------------01332112444123204320011578861578654247025778775389
Q gi|254780628|r  245 AHGLHAYEISNHSFLGAE------------SLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG  312 (395)
Q Consensus       245 ~~GY~~Yeis~fak~~~~------------s~hn~~Yw~~~d~iG~G~GA~S~l~~~~~~~~~~~~~~~~~Y~~~i~~~~  312 (395)
                      ++||.+|++++|+||+..            +.||..+|...++||||+||+|++++    ..++|.+++++|.+++++++
T Consensus       276 ~~GY~~~~~~~far~~~~~~~a~~~g~~~r~~~gy~~~~~~~~iGlG~sA~S~~~~----~~~~N~~~l~~Y~~~i~~g~  351 (441)
T d1olta_         276 QSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGD----CYAQNQKELKQYYQQVDEQG  351 (441)
T ss_dssp             HTTCEEEETTEEECTTSHHHHHHHHTCCEECSSCEESCCSCEEEEESTTCEEEETT----EEEEECSSHHHHHHHHHHHS
T ss_pred             HCCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCEEEEEC----CEEEEEHHHHHHHHHHHHCC
T ss_conf             73831014887641140366665554521554353437985252003674465302----00333000211113454068


Q ss_pred             CCCCCEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHH------HHHHHHHCCCEEEEECCEEEECHHHHHHH
Q ss_conf             633322454999989999999656237998889998838996499------99999987994985598999956758989
Q gi|254780628|r  313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE------CERNLQRQGFIERVQFSRLRCTQRGMTML  386 (395)
Q Consensus       313 ~p~~~~~~Ls~~e~~~e~l~~~LR~~~Gid~~~~~~~fg~~~~~~------~~~~L~~~Gli~~~~~~~l~lT~~G~~~~  386 (395)
                      +|+.++..+|++|++++++|++||+..|||.+.++++||.++...      .+++|+++||++ .+++++++|++|++|+
T Consensus       352 lp~~~g~~Ls~~d~~~~~vi~~L~~~~~ld~~~~~~~fg~~~~~~f~~~~~~L~~l~~~GLv~-~~~~~l~lT~~Gr~l~  430 (441)
T d1olta_         352 NALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWDLLFADYFAEDLKLLAPLAKDGLVD-VDEKGIQVTAKGRLLI  430 (441)
T ss_dssp             CCEEEEEECCHHHHHHHHHHHHHHHHSEEEHHHHHHHTTCCHHHHTHHHHHHHHHHHHTTSEE-ECSSEEEECTTTGGGH
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEE-EECCEEEECHHHHHHH
T ss_conf             850010148888999999999899868928799999979888898799999999999789899-9899999998389999


Q ss_pred             HHHHHHH
Q ss_conf             9999986
Q gi|254780628|r  387 DSVIANL  393 (395)
Q Consensus       387 d~I~~~l  393 (395)
                      |+|+..|
T Consensus       431 ~~I~~~F  437 (441)
T d1olta_         431 RNICMCF  437 (441)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHHH
T ss_conf             9999987


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Oxygen-independent coproporphyrinogen III oxidase HemN
domain: Oxygen-independent coproporphyrinogen III oxidase HemN
species: Escherichia coli [TaxId: 562]