HHSEARCH alignment of GI: 254780628 and SCOP domain: d2a61a1

Alignment
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]}
Probab=90.14  E-value=0.56  Score=23.62  Aligned_cols=69  Identities=16%  Similarity=0.240  Sum_probs=51.2

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHH--HHHHHHHHHCCCEEEEEC------CEEEECHHHHHHHHHHHHH
Q ss_conf             49999899999996562379988899988389964--999999998799498559------8999956758989999998
Q gi|254780628|r  321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF------SRLRCTQRGMTMLDSVIAN  392 (395)
Q Consensus       321 Ls~~e~~~e~l~~~LR~~~Gid~~~~~~~fg~~~~--~~~~~~L~~~Gli~~~~~------~~l~lT~~G~~~~d~I~~~  392 (395)
                      +|..+.   .++..|.-..|++.+++.+..|.+-.  ...++.|++.|||.+..+      -.+.||++|+.+.+.+...
T Consensus        28 lt~~q~---~iL~~i~~~~~~t~~~la~~l~i~~~tvs~~l~~L~~~gli~r~~~~~D~R~~~i~LT~~G~~~~~~~~~~  104 (139)
T d2a61a1          28 ITPAQF---DILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIER  104 (139)
T ss_dssp             CCHHHH---HHHHHHHHHCCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEETTEEEEEEEEECHHHHHHHHHHHHH
T ss_pred             CCHHHH---HHHHHHHHCCCCCHHHHHHHHCCCCCCCHHHHHHHHHCCEEEEEECCCCCCEEEEEECHHHHHHHHHHHHH
T ss_conf             799999---99999997699899999998398814426999999845725663216888867889898999999999999


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Transcriptional regulator TM0710
species: Thermotoga maritima [TaxId: 2336]