BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase
[Candidatus Liberibacter asiaticus str. psy62]
         (395 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040305|gb|ACT57101.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 395

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/395 (100%), Positives = 395/395 (100%)

Query: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ
Sbjct: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN
Sbjct: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
           NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP
Sbjct: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
           KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ
Sbjct: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
           SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH
Sbjct: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER
Sbjct: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
Sbjct: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395


>gi|315121829|ref|YP_004062318.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495231|gb|ADR51830.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 395

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/394 (76%), Positives = 351/394 (89%)

Query: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           MKY  +Y +++    SN+LG+YVHWPFC KKCPYCDFNSHVRR  + Q +FI+S L EM+
Sbjct: 1   MKYSQSYGDDVVHPDSNTLGIYVHWPFCTKKCPYCDFNSHVRRRAIDQGHFIRSLLVEME 60

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           WMRQL+GPR ISS+FFGGGTPSLI+PQNI+++LD IAKNWT+ SNVEITIEANPSS E  
Sbjct: 61  WMRQLSGPRLISSVFFGGGTPSLIDPQNISILLDNIAKNWTLPSNVEITIEANPSSTEAG 120

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
           +F GYRKAGVNR+SLGVQSLEE++LRFLGRNHN SEA+ AIHLAR+IFPRMSFDLIYALP
Sbjct: 121 HFLGYRKAGVNRVSLGVQSLEERALRFLGRNHNVSEAVTAIHLARDIFPRMSFDLIYALP 180

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            Q++ QWEMELQ+ALSYAVDHLSLYQLTIEKGTLFYK+HKDGDLVLP E+++ DLYNLTQ
Sbjct: 181 GQSIKQWEMELQKALSYAVDHLSLYQLTIEKGTLFYKLHKDGDLVLPDESLSADLYNLTQ 240

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            IT  +GL++YEISNH+ LG+ESLHNL YWRYGDY+GIGPGAHSRVKV S R+A+SIEKH
Sbjct: 241 IITREYGLYSYEISNHARLGSESLHNLTYWRYGDYVGIGPGAHSRVKVDSQRIAMSIEKH 300

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PE+W+KMV KNGHA+VEKEFLSSEQQADEFLMMG+RLREGI VKDWE LAGR+LDIECER
Sbjct: 301 PENWVKMVEKNGHAIVEKEFLSSEQQADEFLMMGMRLREGIEVKDWERLAGRSLDIECER 360

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
            LQ QGFIER+  SRLRCTQ GM MLD+++A+L+
Sbjct: 361 RLQEQGFIERINSSRLRCTQLGMVMLDAIVADLS 394


>gi|209547615|ref|YP_002279532.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533371|gb|ACI53306.1| oxygen-independent coproporphyrinogen III oxidase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 401

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 292/385 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL EM  +R L+GP++
Sbjct: 17  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFASAFLKEMAAVRALSGPKT 76

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V + +EIT+EANPSSVE   F+GYR AGV
Sbjct: 77  VTSIFLGGGTPSLMKPETVSAILDGIARHWHVPAGIEITMEANPSSVEAERFRGYRAAGV 136

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L+++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P QT+ QWE E
Sbjct: 137 NRVSLGVQALDDRDLKFLGRLHDVADALKAIRLARDIFPRMSFDLIYARPDQTVEQWERE 196

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 197 LKQAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITAREGMPA 256

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PESWL MV +
Sbjct: 257 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGPEKIATATERKPESWLDMVER 316

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR+LD + E  L    FIER
Sbjct: 317 DGHGILDEERLGYEEQSDELLLMGLRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIER 376

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  SRLRCT  GM +LDSV+A+LA 
Sbjct: 377 IGNSRLRCTPSGMLILDSVVADLAC 401


>gi|116250146|ref|YP_765984.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254794|emb|CAK05868.1| putative oxygen-independent coprophorphyrinogen III oxidase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 400

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/385 (57%), Positives = 291/385 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FLTEM  +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFTSAFLTEMAAVRSMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPETVSAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P+QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLARDIFPRMSFDLIYARPEQTVEEWEKE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKEAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSALLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGPEKLATATERKPETWLDMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR+LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGFEEQSDELLLMGLRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  SRLRCT  GM +LDSV+A+LA 
Sbjct: 376 IGNSRLRCTPSGMLILDSVVADLAC 400


>gi|241202758|ref|YP_002973854.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856648|gb|ACS54315.1| oxygen-independent coproporphyrinogen III oxidase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 400

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/385 (57%), Positives = 290/385 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FLTEM  +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFTSAFLTEMAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPEAVSAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLARDIFPRMSFDLIYARPDQTVEEWEKE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKEAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGPEKLATATERKPETWLDMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR+LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGFEEQSDELLLMGLRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  SRLRCT  GM +LDSV+A+LA 
Sbjct: 376 IGNSRLRCTPSGMLILDSVVADLAC 400


>gi|150395235|ref|YP_001325702.1| coproporphyrinogen III oxidase [Sinorhizobium medicae WSM419]
 gi|150026750|gb|ABR58867.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Sinorhizobium medicae WSM419]
          Length = 381

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 228/376 (60%), Positives = 286/376 (76%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC  KCPYCDFNSHVR   V Q  F+ +FL EM  +R L+GPR+++SIF GG
Sbjct: 5   FGVYVHWPFCAAKCPYCDFNSHVRHTPVEQPRFVAAFLKEMAAVRDLSGPRTVTSIFMGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++PQ +  ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGVNR+SLGVQ
Sbjct: 65  GTPSLMDPQTVEAILDGIARHWHVPDGIEITMEANPSSVEATRFRGYRAAGVNRVSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L ++ L+FLGR HN  +A+ AI LAR IFPRMSFDLIYA P QT+ +WE EL+ A+SYA
Sbjct: 125 ALNDRDLKFLGRLHNVEDALKAIRLAREIFPRMSFDLIYARPNQTVEEWERELKEAVSYA 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           VDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ AYE+SNH+ 
Sbjct: 185 VDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITADIGMPAYEVSNHAR 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYGDY GIGPGAH R++VGS ++A + E++PE+WL+ V ++G  +VE+
Sbjct: 245 PGAESRHNLTYWRYGDYAGIGPGAHGRLQVGSGKIATATERNPEAWLQNVEEHGDGMVER 304

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           EFL  E QADE L+MGLRLREG+ +  W+ L+GRN D   E  L   GFIER+  SRLRC
Sbjct: 305 EFLDFEAQADELLLMGLRLREGVDLARWQSLSGRNPDPAREEFLIEHGFIERIGNSRLRC 364

Query: 379 TQRGMTMLDSVIANLA 394
           T  GM +LD+V+A+LA
Sbjct: 365 TPSGMLILDAVVADLA 380


>gi|222147319|ref|YP_002548276.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4]
 gi|221734309|gb|ACM35272.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           vitis S4]
          Length = 393

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 284/381 (74%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G    G+Y+HWPFC  KCPYCDFNSHVR  K+ Q  F Q+FL EM+ MR ++GP++++SI
Sbjct: 13  GEPGFGIYIHWPFCAAKCPYCDFNSHVRHQKIDQPRFTQAFLKEMETMRAMSGPKTVTSI 72

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++P  +  IL+GIA+ WTV   +EIT+EANP+SVE   F+GYR AGVNR+S
Sbjct: 73  FLGGGTPSLMDPATVGAILEGIARYWTVPRGIEITMEANPTSVEAERFRGYRSAGVNRVS 132

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LGVQ+L +  L+FLGR H+  +A+ A+ LAR IFPRMSFDLIYA P QT+  W+ EL+ A
Sbjct: 133 LGVQALNDADLKFLGRMHSVEDALKAVRLAREIFPRMSFDLIYARPNQTIADWDAELKLA 192

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +SYAVDHLSLYQLTIE+GT F+ +HK G ++ P E  A  LY  TQ IT   GL AYE+S
Sbjct: 193 ISYAVDHLSLYQLTIEEGTPFFGLHKAGKIITPDEEHAAQLYEATQEITEREGLPAYEVS 252

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + EKHPE+WL  V +NGH 
Sbjct: 253 NHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGHEKLATATEKHPETWLSAVEQNGHG 312

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           +V ++ L SE+QADE L+MGLRLREG+ +  W+ L+GR+ D   E+ L   GFIER+  S
Sbjct: 313 MVIQDALGSEEQADELLLMGLRLREGVDLARWQQLSGRDPDPVREQFLLEHGFIERLGNS 372

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           RLRCT +GM +LD+V+A+LA 
Sbjct: 373 RLRCTPKGMLVLDAVVADLAC 393


>gi|159184259|ref|NP_353357.2| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58]
 gi|159139586|gb|AAK86142.2| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           tumefaciens str. C58]
          Length = 399

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 223/381 (58%), Positives = 287/381 (75%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G    G+Y+HWPFC  KCPYCDFNSHVR   V QE F  +FL EM+ MR L+GPR ++SI
Sbjct: 19  GDPGFGIYLHWPFCAAKCPYCDFNSHVRHRPVDQERFTAAFLREMEHMRTLSGPRVVTSI 78

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++PQ +  +LDGI++ W V   +EIT+EANPSSVE   F+GYR AGVNR+S
Sbjct: 79  FMGGGTPSLMDPQTVGALLDGISRFWHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVS 138

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +W+ EL+ A
Sbjct: 139 LGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPNQTVAEWDAELKEA 198

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT  +G+ AYE+S
Sbjct: 199 VSYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEHSAVLYEATQEITERYGMPAYEVS 258

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY GIGPGAH R+  G+ ++A + E+HPE+WL+ V + GH 
Sbjct: 259 NHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGASKLATATERHPETWLETVEREGHG 318

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           +V++E L  ++QADE L+MGLRLREGI +  W  L+GR+LD E E  L + GF+ER+  S
Sbjct: 319 MVDQELLGVDEQADELLLMGLRLREGIDLARWSDLSGRDLDPEKEEFLLQHGFVERLGNS 378

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           RLRCT  GM +LD+V+A+LA 
Sbjct: 379 RLRCTPSGMLILDAVVADLAC 399


>gi|222084654|ref|YP_002543183.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
 gi|221722102|gb|ACM25258.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
          Length = 392

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 285/380 (75%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL EM  MR + GP++++SI
Sbjct: 12  GEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFTAAFLKEMASMRAIGGPKTVTSI 71

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++P+ +  +LDGIAK+W V   +EIT+EANPSSVE   F+GYR AGVNR+S
Sbjct: 72  FLGGGTPSLMKPETVGAVLDGIAKHWHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVS 131

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQ+L ++ L+FLGR HN ++A+ AI LAR+IFPRMSFDLIYA P QT+ +WE EL+ A
Sbjct: 132 MGVQALNDRDLKFLGRLHNVADALKAIKLARDIFPRMSFDLIYARPNQTVEEWERELKEA 191

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +SYAVDHLSLYQLTIE+GT FY +HK G L++P  + +  LY  TQ IT   G+ AYE+S
Sbjct: 192 ISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGDQSALLYEATQEITEREGMPAYEVS 251

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY GIGPGAH R+ +G  ++A + E+ PE+WL++V ++GH 
Sbjct: 252 NHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTLGPKKLATATERKPEAWLELVERDGHG 311

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           + ++E L  ++QADE L+MGLRL+EGI +  W+ L+GR  D   E  L   GFIER+  S
Sbjct: 312 IADQEMLGDDEQADELLLMGLRLKEGIDLVRWQQLSGREPDQAREEFLLEHGFIERLGNS 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RLRCT  GM +LDSV+A+LA
Sbjct: 372 RLRCTPAGMLILDSVVADLA 391


>gi|325291759|ref|YP_004277623.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           sp. H13-3]
 gi|325059612|gb|ADY63303.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           sp. H13-3]
          Length = 399

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 285/380 (75%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G    G+Y+HWPFC  KCPYCDFNSHVR   V QE F  +FL+EM  MR L+GPR ++SI
Sbjct: 19  GDPGFGIYLHWPFCAAKCPYCDFNSHVRHRPVDQERFTAAFLSEMAKMRALSGPRVVTSI 78

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++PQ +  +LDG+++ W V   +EIT+EANPSSVE   F+GYR AGVNR+S
Sbjct: 79  FMGGGTPSLMDPQTVGALLDGVSRFWHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVS 138

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +W+ EL+ A
Sbjct: 139 LGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPNQTVAEWDAELKEA 198

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT  +G+ AYE+S
Sbjct: 199 VSYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEHSAVLYEATQEITERYGMPAYEVS 258

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY GIGPGAH R+  G+ ++A   E+HPE+WL+ V + GH 
Sbjct: 259 NHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTNGASKLATVTERHPETWLETVEREGHG 318

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           +V++E L  ++QADE L+MGLRLREGI +  W  L+GR LD E E  L + GF+ER+  S
Sbjct: 319 MVDQELLGVDEQADELLLMGLRLREGIDLARWSDLSGRELDPEKEEFLLQHGFVERIGNS 378

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RLRCT  GM +LD+V+A+LA
Sbjct: 379 RLRCTPSGMLILDAVVADLA 398


>gi|190890029|ref|YP_001976571.1| oxygen-independent coprophorphyrinogen III oxidase [Rhizobium etli
           CIAT 652]
 gi|190695308|gb|ACE89393.1| oxygen-independent coprophorphyrinogen III oxidase protein
           [Rhizobium etli CIAT 652]
          Length = 400

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/385 (57%), Positives = 287/385 (74%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL E   +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFLKETAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +A ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPETVAAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPDQTVEEWESE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKQAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGREKIATATERKPEAWLDMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGHEEQSDELLLMGLRLREGVDLARWQQLSGRELDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  SRLRCT  GM +LDSV+A+LA 
Sbjct: 376 IGNSRLRCTPSGMLILDSVVADLAC 400


>gi|86356017|ref|YP_467909.1| coproporphyrinogen III oxidase [Rhizobium etli CFN 42]
 gi|86280119|gb|ABC89182.1| coproporphyrinogen III oxidase protein [Rhizobium etli CFN 42]
          Length = 400

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 289/385 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL EM  +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFLKEMAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V + +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPETVSAILDGIARHWHVPAGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPDQTVDEWEKE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT F+ +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKEAISYAVDHLSLYQLTIEEGTPFFGLHKSGKLIVPDGEQSALLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL+MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGHEKLATATERKPEAWLEMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGFEEQSDELLLMGLRLREGVDLARWQQLSGRELDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  SRLRCT  GM +LDSV+A+LA 
Sbjct: 376 IGNSRLRCTSAGMLILDSVVADLAC 400


>gi|227820594|ref|YP_002824564.1| coproporphyrinogen III oxidase [Sinorhizobium fredii NGR234]
 gi|227339593|gb|ACP23811.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Sinorhizobium fredii NGR234]
          Length = 382

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/376 (59%), Positives = 284/376 (75%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC  KCPYCDFNSHVR   V Q  F+ +FL EM  +  L+GPR+++SIF GG
Sbjct: 5   FGVYVHWPFCAAKCPYCDFNSHVRHQPVDQPRFVAAFLQEMASVGALSGPRTVTSIFMGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP  +A ILDGIA++W V   +EIT+EANPSSVE   F GYR AGVNR+SLGVQ
Sbjct: 65  GTPSLMEPATVAAILDGIARHWHVPDGIEITMEANPSSVEATRFHGYRAAGVNRVSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L ++ L+FLGR HN  +A+ A+ LAR IFPRMSFDLIYA PKQT+ +WE EL+ A+SYA
Sbjct: 125 ALNDRDLKFLGRLHNVEDALKAVRLAREIFPRMSFDLIYARPKQTVEEWERELKEAVSYA 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           VDHLSLYQLTIE+GT F+ +HK G L++P    +  LY  TQ IT+A G+ AYE+SNH+ 
Sbjct: 185 VDHLSLYQLTIEEGTPFFGLHKAGKLIVPDGEQSAVLYEATQEITAAIGMPAYEVSNHAR 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYGDY GIGPGAH R+  GS ++A + E++PE+WL++V + G  + E+
Sbjct: 245 RGAESRHNLTYWRYGDYAGIGPGAHGRLTAGSGKIATATERNPEAWLRLVEERGDGITEQ 304

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L  E QADE L+MGLRLREG+ +  W+ L+GR+ D E E+ L   GF+ER+  SRLRC
Sbjct: 305 EPLDREAQADELLLMGLRLREGVDLARWQGLSGRDPDPEREQFLIEHGFVERLGNSRLRC 364

Query: 379 TQRGMTMLDSVIANLA 394
           T  GM +LD+V+A+LA
Sbjct: 365 TPAGMLILDAVVADLA 380


>gi|15964126|ref|NP_384479.1| coproporphyrinogen III oxidase [Sinorhizobium meliloti 1021]
 gi|307301271|ref|ZP_07581033.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti BL225C]
 gi|307317942|ref|ZP_07597379.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti AK83]
 gi|15073302|emb|CAC41810.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sinorhizobium meliloti 1021]
 gi|306896344|gb|EFN27093.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti AK83]
 gi|306903727|gb|EFN34314.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti BL225C]
          Length = 393

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 286/391 (73%), Gaps = 4/391 (1%)

Query: 4   LSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMR 63
           LSA  + M        GVYVHWPFC  KCPYCDFNSHVR   V Q  F+ +FL EM  +R
Sbjct: 6   LSAIGDGM----DPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQPRFVAAFLKEMAAVR 61

Query: 64  QLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQ 123
            L+GPR+++SIF GGGTPSL++P+ +  ILDGIA+ W V   +EIT+EANPSSVE   F+
Sbjct: 62  ALSGPRTVTSIFMGGGTPSLMDPRTVEAILDGIARQWHVPDGIEITMEANPSSVEATRFR 121

Query: 124 GYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQT 183
           GYR AGVNR+SLGVQ+L ++ L+FLGR H+   A+ AI LAR IFPRMSFDLIYA P QT
Sbjct: 122 GYRAAGVNRVSLGVQALNDRDLKFLGRLHDVENALKAIRLAREIFPRMSFDLIYARPNQT 181

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
           + +WE EL+ A+SYAVDHLSLYQLTIE+GT FY +HK G LV+P    +  LY  TQ IT
Sbjct: 182 VEEWERELKEAVSYAVDHLSLYQLTIEEGTPFYGLHKAGKLVVPDGEQSAVLYEATQEIT 241

Query: 244 SAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPES 303
           +  G+ AYE+SNH+  GAES HNL YWRYGDY GIGPGAH R+ +GS ++A + E++PE+
Sbjct: 242 ADIGMPAYEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLAIGSGKIATATERNPEA 301

Query: 304 WLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ 363
           WL+ V + G  +VE+E L  E QADE L+MGLRLREG+ +  W+ L+GR+ D   E  L 
Sbjct: 302 WLQRVEECGEGLVERELLDFEAQADELLLMGLRLREGVDLARWQTLSGRDPDPAREEFLI 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
             GFIER+  SRLRCT  GM +LD+V+A+LA
Sbjct: 362 EHGFIERIGNSRLRCTPAGMLILDAVVADLA 392


>gi|163757814|ref|ZP_02164903.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
 gi|162285316|gb|EDQ35598.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
          Length = 414

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 275/381 (72%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G     VY+HWPFC  KCPYCDFNSHVR   + Q+ +I +F  E+  MR+L+GP+ ++SI
Sbjct: 34  GKPGFAVYLHWPFCAAKCPYCDFNSHVRHEGIDQQAYIDAFRAEIAAMRKLSGPQVVTSI 93

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL+ P+ +A ILD + + W V   +EIT+EANPSSVE   F+GYR AGVNR+S
Sbjct: 94  FFGGGTPSLMHPETVAAILDAVHETWVVPEGIEITLEANPSSVEAGRFRGYRAAGVNRVS 153

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQ+L ++ L+ LGR H+ +EA+ AI LAR+IFPRMSFDLIYA P QT   WE EL+ A
Sbjct: 154 MGVQALNDRDLKRLGRLHDRAEALRAIGLARDIFPRMSFDLIYARPDQTPHAWEAELKEA 213

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S A DHLSLYQLTIE+GT FY +HK G L++P  +++ +LY LTQS+  AHGL AYE+S
Sbjct: 214 ISLAADHLSLYQLTIEEGTPFYGLHKAGKLIVPDGDLSAELYELTQSVCEAHGLPAYEVS 273

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY GIGPGAH R+   + ++A + E+ PE+WL  V   GH 
Sbjct: 274 NHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTTSAGKIATATERTPETWLTSVADRGHG 333

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           + E E L + +QADE L+MGLRLREG+ +  W+ L+G  LD E    L   G IE +   
Sbjct: 334 MSESEVLGTSEQADELLLMGLRLREGVDLGRWQALSGHRLDAERVEFLIDHGMIETMGKD 393

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           R+RCT +GM +LD+V+A+LA 
Sbjct: 394 RIRCTPQGMLVLDAVVADLAT 414


>gi|239831022|ref|ZP_04679351.1| oxygen-independent coproporphyrinogen III oxidase [Ochrobactrum
           intermedium LMG 3301]
 gi|239823289|gb|EEQ94857.1| oxygen-independent coproporphyrinogen III oxidase [Ochrobactrum
           intermedium LMG 3301]
          Length = 409

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 273/381 (71%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G ++ GVY+HWPFC+ KCPYCDFNSHVR   V Q  F ++FL EM+ +R+ TGPR+I+SI
Sbjct: 29  GEDAFGVYLHWPFCLAKCPYCDFNSHVRHKPVDQARFSEAFLREMECLRERTGPRTITSI 88

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++P+ +  +LDGIA +W+V+ ++E+T+EANP+SVE + F+GYR AGVNR+S
Sbjct: 89  FLGGGTPSLMQPETVGALLDGIASHWSVAPDIEVTLEANPTSVEADRFRGYRAAGVNRVS 148

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LG+Q+L +  LR LGR H+  EA AAI LAR IFPR+SFDLIYA P QT+  W  EL+ A
Sbjct: 149 LGIQALNDPDLRRLGRMHSVEEAKAAIRLAREIFPRLSFDLIYARPNQTIEAWREELKEA 208

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +  A DHLSLYQLTIE+GT FY + K G L  P  + A  LY  TQ +T+ HGL AYEIS
Sbjct: 209 IGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPDPDHAAALYEETQRVTAEHGLPAYEIS 268

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  G ES HNL YWRYG Y+GIGPGAH R      R     EKHPE+WL  V +NGH 
Sbjct: 269 NHAVPGRESQHNLVYWRYGQYVGIGPGAHGRFVENDVRTVTMTEKHPETWLDKVERNGHG 328

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           ++E+E+L  EQ+ DEFLMMGLRLREGI +  +E L+G  +D +    L  +G IE +  S
Sbjct: 329 IIEEEYLDGEQEGDEFLMMGLRLREGIDLARYERLSGHAVDEKRLAKLIAEGMIEPMDGS 388

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            +R T  G  +LD+++A+LA 
Sbjct: 389 FIRATPDGALVLDALVADLAA 409


>gi|110636337|ref|YP_676545.1| coproporphyrinogen III oxidase [Mesorhizobium sp. BNC1]
 gi|110287321|gb|ABG65380.1| coproporphyrinogen III oxidase, anaerobic [Chelativorans sp. BNC1]
          Length = 387

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 213/376 (56%), Positives = 267/376 (71%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MR  TGPRS+SSIF GG
Sbjct: 11  FGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFKRELAAMRARTGPRSVSSIFLGG 70

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P+ +  I+D +A +W V   VEIT+EANPSSVE + F+GYR AGVNR+S+G+Q
Sbjct: 71  GTPSLMDPKTVGAIIDAVAASWHVPMGVEITLEANPSSVEADRFRGYRSAGVNRVSMGIQ 130

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L ++ LRFLGR HN  EA+ AI LAR++FPRMSFDLIYA P QT+  W  EL+ A+ YA
Sbjct: 131 ALNDRDLRFLGRLHNVEEALGAIRLARDLFPRMSFDLIYARPGQTVDAWRAELEEAVGYA 190

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT FY +   G L +P  ++A DLY +TQ IT+A GL AYEISNH+ 
Sbjct: 191 ADHLSLYQLTIEEGTPFYALRAAGKLTVPDMDLAADLYQVTQEITAARGLPAYEISNHAK 250

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYG+Y+G+GPGAH R      RV    E++PE+W  +V   G  V   
Sbjct: 251 PGAESRHNLIYWRYGEYVGVGPGAHGRFIEDGRRVVTMTERNPETWAALVEARGSGVTGG 310

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L+  ++ADEFL+MGLRL EGI +  +E LAG  L  +    L+ +G IE V  SRLR 
Sbjct: 311 EMLTRSEEADEFLLMGLRLVEGIDLDRYEKLAGFPLSPQRVAILREEGLIEPVGNSRLRA 370

Query: 379 TQRGMTMLDSVIANLA 394
           T  GM +LD+++A+LA
Sbjct: 371 TPAGMVVLDALVADLA 386


>gi|153007530|ref|YP_001368745.1| coproporphyrinogen III oxidase [Ochrobactrum anthropi ATCC 49188]
 gi|151559418|gb|ABS12916.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 409

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/381 (55%), Positives = 272/381 (71%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G N+ GVY+HWPFC+ KCPYCDFNSHVR   V Q  F ++FL EM+ +R+ TGPR+I+SI
Sbjct: 29  GENAFGVYLHWPFCLAKCPYCDFNSHVRHKPVDQARFSEAFLREMETLRERTGPRTITSI 88

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++P+ +  +L+GIA +W+V+ ++E+T+EANP+SVE + F+GYR AGVNR+S
Sbjct: 89  FLGGGTPSLMQPETVGALLNGIASHWSVAPDIEVTLEANPTSVEADRFRGYRAAGVNRVS 148

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LG+Q+L +  LR LGR H+  EA AAI LAR IFPR+SFDLIYA P QT+  W  EL+ A
Sbjct: 149 LGIQALNDPDLRRLGRMHSVEEAKAAIRLAREIFPRLSFDLIYARPNQTIEAWREELKEA 208

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +  A DHLSLYQLTIE+GT FY + K G L  P  + A  LY  TQ +T+ HGL AYEIS
Sbjct: 209 IGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDHAAALYEETQRVTAEHGLPAYEIS 268

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  G ES HNL YWRYG Y+GIGPGAH R      R     EKHPE+WL  V +NGH 
Sbjct: 269 NHAVPGRESQHNLVYWRYGQYVGIGPGAHGRFVENDIRTVTMTEKHPETWLDKVERNGHG 328

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           ++E+E+L   Q+ DEFLMMGLRLREGI +  +E L+G  +D +    L  +G IE +  S
Sbjct: 329 IIEEEYLDGGQEGDEFLMMGLRLREGIDLARYERLSGHAVDEKRLAKLIAEGMIEPMSGS 388

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            +R T  G  +LD+++A+LA 
Sbjct: 389 IIRATPDGALVLDALVADLAA 409


>gi|114705080|ref|ZP_01437988.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
 gi|114539865|gb|EAU42985.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
          Length = 400

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 269/376 (71%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC  KCPYCDFNSHVR   V Q  +  +F  E+  M + +    ++SIF GG
Sbjct: 25  FGVYVHWPFCAAKCPYCDFNSHVRMKPVDQARYAAAFERELAEMGRRSKGERVTSIFLGG 84

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP  + +IL+ I+  WTV+ + EIT+EANPSSVE N F+GYR AGVNR+SLGVQ
Sbjct: 85  GTPSLMEPATVGIILNAISNIWTVAPDAEITLEANPSSVEANRFRGYRSAGVNRVSLGVQ 144

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L ++ LR LGR H+  EA+ AI LAR IFPR+SFDLIYA P QT+  WE EL RA+  A
Sbjct: 145 ALNDRDLRRLGRLHDVEEALRAIGLAREIFPRLSFDLIYARPDQTVAGWEAELARAIDLA 204

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT F+ +HK G L++P  +++ DLY  TQ++T+A GL AYEISNH+ 
Sbjct: 205 ADHLSLYQLTIEEGTAFHALHKAGKLIVPDGDLSADLYEATQALTAAKGLPAYEISNHAV 264

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYG Y G+GPGAH R+    +R A + E  PE+WL+MV    H +V +
Sbjct: 265 PGAESRHNLTYWRYGHYAGVGPGAHGRLSWDGYRYATANEALPETWLQMVEDWDHGMVVE 324

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS  +QADE L+MGLRL EG+ +K W  L+GR +D   ER+L   G +ER+   RLRC
Sbjct: 325 EALSIAEQADELLLMGLRLAEGVDLKRWRELSGRVIDPRSERDLVENGMVERLGPERLRC 384

Query: 379 TQRGMTMLDSVIANLA 394
           T  GM +LD+V+A+LA
Sbjct: 385 TPAGMMVLDAVVADLA 400


>gi|13473883|ref|NP_105451.1| coproporphyrinogen III oxidase [Mesorhizobium loti MAFF303099]
 gi|14024634|dbj|BAB51237.1| oxygen-independent coproporphyrinogen III oxidase; HemN
           [Mesorhizobium loti MAFF303099]
          Length = 392

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/391 (54%), Positives = 269/391 (68%), Gaps = 7/391 (1%)

Query: 11  MTGQG-------SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMR 63
           MTG G       S   GVY+HWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MR
Sbjct: 1   MTGPGMTMPLDRSPGFGVYIHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFEAELATMR 60

Query: 64  QLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQ 123
           + TGPR ++SIF GGGTPSL++P+ +A +LD +AKNWTV   +E+T+EANPSSVE   F+
Sbjct: 61  ERTGPREVTSIFLGGGTPSLMKPETVARVLDAVAKNWTVPDGIEVTLEANPSSVEAERFR 120

Query: 124 GYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQT 183
           GYR AGVNR+SLGVQ+L ++ LRFLGR HN  EA+ AI LAR IFPR+SFDLIYA P QT
Sbjct: 121 GYRAAGVNRVSLGVQALNDKDLRFLGRLHNVEEALHAIGLAREIFPRLSFDLIYARPGQT 180

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
              W  EL++A+ +A DHLSLYQLTIE+GT F+ +H     ++P  + A DLY LTQ  T
Sbjct: 181 PEAWAAELEQAIGHAADHLSLYQLTIEEGTPFHALHAAKKFIIPDNDHAADLYALTQETT 240

Query: 244 SAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPES 303
           SAHGL AYEISNH+  GAES HNL YWRYG+Y+G+GPGAH R      R     E+ PE+
Sbjct: 241 SAHGLPAYEISNHARPGAESRHNLTYWRYGEYVGVGPGAHGRFVEHGRRTVTIAERMPET 300

Query: 304 WLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ 363
           W  +V   GH V   E L+  ++ADEFL+MGLRL EGI +  +E  +GR L       LQ
Sbjct: 301 WANLVEAKGHGVTGGEILTRSEEADEFLLMGLRLAEGIDLARYEAFSGRGLSSARLSVLQ 360

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
            +G +  +  +RLR T  GM +LD+V+A+LA
Sbjct: 361 GEGLVAPIGNARLRATPAGMIVLDAVVADLA 391


>gi|260463465|ref|ZP_05811665.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           opportunistum WSM2075]
 gi|259030790|gb|EEW32066.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           opportunistum WSM2075]
          Length = 385

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 267/379 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   GVY+HWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MRQ TGPR ++SIF
Sbjct: 6   APGFGVYIHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFEAELATMRQRTGPREVTSIF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P+ +A +LD +A+NWTV   +E+T+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 66  FGGGTPSLMKPETVARVLDAVARNWTVPDGIEVTLEANPSSVEAERFRGYRTAGVNRVSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LRFLGR HN  EA+ AI LAR IFPR+SFDLIYA P QT   W  EL++A+
Sbjct: 126 GVQALNDKDLRFLGRLHNVEEALHAIGLAREIFPRLSFDLIYARPGQTPEAWASELEQAI 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +A DHLSLYQLTIE+GT F+ +H     ++P  + A DLY LTQ IT+AHGL AYEISN
Sbjct: 186 GHAADHLSLYQLTIEEGTPFHALHAAKKFIIPDNDHAADLYALTQEITTAHGLPAYEISN 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG+Y+G+GPGAH R      R     E+ PE+W  +V   GH +
Sbjct: 246 HARPGAESRHNLTYWRYGEYVGVGPGAHGRFVEHGRRTVTIAERMPETWANLVEAKGHGI 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
              E L+  ++ADEFL+MGLRL EGI +  +E  +GR L       LQ +G +  +  +R
Sbjct: 306 TGGEILTRSEEADEFLLMGLRLAEGIDLSRYEAFSGRGLSSARLSVLQGEGLVAPIGNTR 365

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  GM +LD+V+A+LA
Sbjct: 366 LRATPAGMIVLDAVVADLA 384


>gi|90420652|ref|ZP_01228558.1| oxygen-independent coproporphyrinogen III oxidase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334943|gb|EAS48704.1| oxygen-independent coproporphyrinogen III oxidase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 398

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/379 (55%), Positives = 264/379 (69%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   GVYVHWPFC  KCPYCDFNSHVR   V QE +  +F  E+  M + +   +++SIF
Sbjct: 20  APGFGVYVHWPFCAAKCPYCDFNSHVRHKPVDQERYAAAFERELAEMARRSAGETVTSIF 79

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EP  +  ILD +A NWT++   EIT+EANPSSVE   F+GYR+AGVNR+SL
Sbjct: 80  LGGGTPSLMEPATVRRILDAVAANWTIADGAEITLEANPSSVEAERFRGYREAGVNRVSL 139

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LR LGR H+  +A+ AI LAR IFPR+SFDLIYA P QT+  WE EL +A+
Sbjct: 140 GVQALNDRDLRLLGRLHSVDQALHAIGLAREIFPRLSFDLIYARPDQTVAAWESELNQAI 199

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT FY +HK G L++P  +++ DLY  TQ IT+  GL AYEISN
Sbjct: 200 DLAADHLSLYQLTIEEGTPFYALHKAGKLIVPDGDLSADLYESTQRITAERGLPAYEISN 259

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG Y G+GPGAH R+     R AIS E  PE+WLKMV       
Sbjct: 260 HAVPGAESRHNLTYWRYGLYAGVGPGAHGRLMGPGGRHAISNEPLPETWLKMVESWDSGA 319

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           V  + LS  +QADE L+MGLRL EGI +K W  L GR+LD   E +L   G +ER+   R
Sbjct: 320 VVDDLLSPTEQADELLLMGLRLTEGIDLKRWRKLTGRDLDPVSEADLMAHGMVERLGPDR 379

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  GM +LD+V+A+LA
Sbjct: 380 LRATPAGMLVLDAVVADLA 398


>gi|319780508|ref|YP_004139984.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166396|gb|ADV09934.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 387

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 267/379 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   GVYVHWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MR+ TGPR ++S+F
Sbjct: 8   TPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFEAELATMRERTGPREVTSVF 67

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++P+ +A +LD +AKNWTV + +E+T+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 68  LGGGTPSLMKPETVARVLDAVAKNWTVPAGIEVTLEANPSSVEAERFRGYRAAGVNRVSL 127

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LRFLGR HN  EA+ AI LAR IFPR+SFDLIYA P QT   W  EL++A+
Sbjct: 128 GVQALNDKDLRFLGRLHNVEEALHAIGLAREIFPRLSFDLIYARPGQTPEAWASELEQAI 187

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +A DHLSLYQLTIE+GT F+ +H     ++P  + A DLY LTQ IT+AHGL AYEISN
Sbjct: 188 GHAADHLSLYQLTIEEGTPFHALHAAKKFIIPDNDHAADLYALTQEITTAHGLPAYEISN 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG+Y+G+GPGAH R      R     E+ PE+W  +V   GH V
Sbjct: 248 HARPGAESRHNLTYWRYGEYVGVGPGAHGRFVENGRRTVTIAERMPETWANLVEAKGHGV 307

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
              E L+  ++ADEFL+MGLRL EGI +  +E  +GR L       LQ +G +  +  +R
Sbjct: 308 TGGEILTRSEEADEFLLMGLRLAEGIDLARYEAFSGRGLSSARLSMLQGEGLVAPIGNAR 367

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  GM +LD+V+A+LA
Sbjct: 368 LRATAAGMIVLDAVVADLA 386


>gi|148560210|ref|YP_001258208.1| coproporphyrinogen III oxidase [Brucella ovis ATCC 25840]
 gi|161618164|ref|YP_001592051.1| coproporphyrinogen III oxidase [Brucella canis ATCC 23365]
 gi|163842445|ref|YP_001626849.1| coproporphyrinogen III oxidase [Brucella suis ATCC 23445]
 gi|254700981|ref|ZP_05162809.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|254707135|ref|ZP_05168963.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|254709322|ref|ZP_05171133.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|260567187|ref|ZP_05837657.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|261314611|ref|ZP_05953808.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|261316833|ref|ZP_05956030.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|261751502|ref|ZP_05995211.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|261756066|ref|ZP_05999775.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|265987903|ref|ZP_06100460.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
 gi|294851575|ref|ZP_06792248.1| oxygen-independent coproporphyrinogen III oxidase [Brucella sp.
           NVSL 07-0026]
 gi|306844443|ref|ZP_07477033.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO1]
 gi|148371467|gb|ABQ61446.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella ovis ATCC 25840]
 gi|161334975|gb|ABX61280.1| oxygen-independent coproporphyrinogen III oxidase [Brucella canis
           ATCC 23365]
 gi|163673168|gb|ABY37279.1| Coproporphyrinogen III oxidase [Brucella suis ATCC 23445]
 gi|260156705|gb|EEW91785.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|261296056|gb|EEX99552.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|261303637|gb|EEY07134.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|261741255|gb|EEY29181.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|261745819|gb|EEY33745.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|264660100|gb|EEZ30361.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
 gi|294820164|gb|EFG37163.1| oxygen-independent coproporphyrinogen III oxidase [Brucella sp.
           NVSL 07-0026]
 gi|306275256|gb|EFM57006.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO1]
          Length = 404

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 268/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|254705352|ref|ZP_05167180.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|256030845|ref|ZP_05444459.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
          Length = 397

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 268/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 13  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 73  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 132

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 133 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 192

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 193 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 253 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 312

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 313 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 372

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 373 MGGSLIRATPDGALVLDALVADLAA 397


>gi|23501087|ref|NP_697214.1| coproporphyrinogen III oxidase [Brucella suis 1330]
 gi|256368640|ref|YP_003106146.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
 gi|23346956|gb|AAN29129.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Brucella suis 1330]
 gi|255998798|gb|ACU47197.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
          Length = 385

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 268/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 1   MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 121 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 181 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 241 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 301 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 361 MGGSLIRATPDGALVLDALVADLAA 385


>gi|17988054|ref|NP_540688.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|225851708|ref|YP_002731941.1| coproporphyrinogen III oxidase [Brucella melitensis ATCC 23457]
 gi|256045966|ref|ZP_05448838.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112679|ref|ZP_05453600.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264780|ref|ZP_05467312.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563249|ref|ZP_05833735.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|265992378|ref|ZP_06104935.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994121|ref|ZP_06106678.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983802|gb|AAL52952.1| oxygen-independent coproporphyrinogen iii oxidase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225640073|gb|ACN99986.1| oxygen-independent coproporphyrinogen III oxidase [Brucella
           melitensis ATCC 23457]
 gi|260153265|gb|EEW88357.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|262765102|gb|EEZ11023.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003444|gb|EEZ15737.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095189|gb|EEZ18858.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408199|gb|ADZ65264.1| coproporphyrinogen III oxidase [Brucella melitensis M28]
 gi|326537914|gb|ADZ86129.1| oxygen-independent coproporphyrinogen III oxidase [Brucella
           melitensis M5-90]
          Length = 404

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 268/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEMTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|256060315|ref|ZP_05450488.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
 gi|261324290|ref|ZP_05963487.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
 gi|261300270|gb|EEY03767.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
          Length = 404

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 268/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKLVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|254501285|ref|ZP_05113436.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Labrenzia alexandrii DFL-11]
 gi|222437356|gb|EEE44035.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Labrenzia alexandrii DFL-11]
          Length = 394

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 272/385 (70%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +T       G+YVHWPFC  KCPYCDFNSHVR  +V Q  F  +F  E+    ++T  + 
Sbjct: 10  LTQASDAGFGIYVHWPFCAAKCPYCDFNSHVRHQQVDQARFAAAFERELNHFAEMTQGKV 69

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+F GGGTPSL+EP  +  +L  I+  W++ SNVEI++EANP+SVE   F+GYR AGV
Sbjct: 70  VQSVFLGGGTPSLMEPATVERVLTAISDRWSMDSNVEISLEANPTSVEAERFKGYRAAGV 129

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQSL +  L+ LGR H+A+ A  AI  AR  FPR+SFDLIYA P QT+ QWE E
Sbjct: 130 NRVSLGVQSLHDADLKLLGRLHDAATARRAIETARATFPRLSFDLIYARPNQTLAQWEAE 189

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A++ A DHLSLYQLTIE+GT FY ++  G L +P +++  + Y LTQ +T A GL A
Sbjct: 190 LKDAIALAADHLSLYQLTIEEGTPFYTLYHGGKLTMPDQDLGAEFYELTQKVTEAEGLPA 249

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAE  HNL YWRYGDY+G+GPGAH R+ VG +R+A S+E+HPE+WL+ V +
Sbjct: 250 YEVSNHAKPGAECRHNLVYWRYGDYVGVGPGAHGRLSVGVNRMATSVERHPETWLEAVEQ 309

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           NGH ++E   L+ E+Q DEFL+MGLRL EGI +K +E  A R++D +   +L   G +E 
Sbjct: 310 NGHGMIEFSGLNEEEQGDEFLLMGLRLTEGIDLKRYEAFAHRSVDPKRLNDLLEHGMVEE 369

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  +R+R T+ G  +LD+V+A+LA 
Sbjct: 370 LGENRVRATREGFFVLDAVVADLAA 394


>gi|225626714|ref|ZP_03784753.1| oxygen-independent coproporphyrinogen III oxidase [Brucella ceti
           str. Cudo]
 gi|256158874|ref|ZP_05456728.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
 gi|256254251|ref|ZP_05459787.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|260169749|ref|ZP_05756560.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|261221402|ref|ZP_05935683.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|261759290|ref|ZP_06002999.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|265997364|ref|ZP_06109921.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
 gi|225618371|gb|EEH15414.1| oxygen-independent coproporphyrinogen III oxidase [Brucella ceti
           str. Cudo]
 gi|260919986|gb|EEX86639.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|261739274|gb|EEY27270.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|262551832|gb|EEZ07822.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
          Length = 404

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL  
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPV 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|62289151|ref|YP_220944.1| coproporphyrinogen III oxidase [Brucella abortus bv. 1 str. 9-941]
 gi|189023427|ref|YP_001934195.1| coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|237814644|ref|ZP_04593642.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           str. 2308 A]
 gi|254690478|ref|ZP_05153732.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|254696598|ref|ZP_05158426.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731511|ref|ZP_05190089.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260546450|ref|ZP_05822190.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260756032|ref|ZP_05868380.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260759256|ref|ZP_05871604.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260760979|ref|ZP_05873322.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260885052|ref|ZP_05896666.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
 gi|297247567|ref|ZP_06931285.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           bv. 5 str. B3196]
 gi|62195283|gb|AAX73583.1| oxygen-independent coproporphyrinogen III oxidase, hypothetical
           [Brucella abortus bv. 1 str. 9-941]
 gi|189018999|gb|ACD71721.1| coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|237789481|gb|EEP63691.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           str. 2308 A]
 gi|260096557|gb|EEW80433.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260669574|gb|EEX56514.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260671411|gb|EEX58232.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676140|gb|EEX62961.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260874580|gb|EEX81649.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
 gi|297174736|gb|EFH34083.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           bv. 5 str. B3196]
          Length = 404

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIY  P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYVRPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|256258734|ref|ZP_05464270.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
          Length = 397

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 13  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 73  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 132

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIY  P QT+  W  E
Sbjct: 133 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYVRPDQTIEAWREE 192

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 193 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 253 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 312

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 313 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 372

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 373 MGGSLIRATPDGALVLDALVADLAA 397


>gi|121602251|ref|YP_989584.1| coproporphyrinogen III oxidase [Bartonella bacilliformis KC583]
 gi|120614428|gb|ABM45029.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Bartonella bacilliformis KC583]
          Length = 392

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/389 (54%), Positives = 270/389 (69%), Gaps = 15/389 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR   V Q++F+++F  EM       GPR I+SIF GG
Sbjct: 5   FGIYIHWPFCTAKCPYCDFNSHVRVKGVNQQHFVKAFEREMTTQYHEIGPRHITSIFIGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +  +L  +AKNWT+   +EIT+EANPSSVE   F GYR AGVNR+SLGVQ
Sbjct: 65  GTPSLMTPHTVDALLQSVAKNWTIDDKIEITLEANPSSVEAERFHGYRTAGVNRLSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +++L+ LGR H+  +A+ AI+LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+  A
Sbjct: 125 ALNDKALQQLGRLHDVKQALHAINLARKIFPRLSFDLIYARPEQTLKQWKDELLQAIDLA 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIEKGT F ++H +G L+LP   +A DLYNLTQ IT+ HGL AYEISNH+ 
Sbjct: 185 ADHLSLYQLTIEKGTAFKRLHAEGKLILPEPELAADLYNLTQEITALHGLPAYEISNHAI 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISI-------------EKHPESWL 305
            GAES HNL YWRY +Y G GPGAH R     H +A+S              EKHPE WL
Sbjct: 245 SGAESRHNLLYWRYHEYAGFGPGAHGRFT--KHSLALSERPSSQQTRHVTINEKHPERWL 302

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQ 365
           K+V   GH  +E E L+ EQQADE L+MGLRL EG  +  +E L+ +++  E   NLQ+Q
Sbjct: 303 KLVDTKGHGCIETEELTGEQQADEMLLMGLRLSEGFDLTRYETLSTKSVSSEKLTNLQQQ 362

Query: 366 GFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           G +E +   RL+ T+ G  +LD +I+ LA
Sbjct: 363 GLVEMIDNQRLKVTKTGRILLDHIISQLA 391


>gi|82699090|ref|YP_413664.1| coproporphyrinogen III oxidase [Brucella melitensis biovar Abortus
           2308]
 gi|82615191|emb|CAJ10132.1| Putative oxygen-independent coproporphyrinogen III
           oxidase:Elongator protein 3/MiaB/NifB:Radical SAM
           [Brucella melitensis biovar Abortus 2308]
          Length = 385

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 1   MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIY  P QT+  W  E
Sbjct: 121 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYVRPDQTIEAWREE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 181 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 241 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 301 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 361 MGGSLIRATPDGALVLDALVADLAA 385


>gi|254718390|ref|ZP_05180201.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|265983354|ref|ZP_06096089.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|306839623|ref|ZP_07472427.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. NF 2653]
 gi|264661946|gb|EEZ32207.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|306405321|gb|EFM61596.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. NF 2653]
          Length = 404

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+ YR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRSYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQCVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|307943383|ref|ZP_07658727.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseibium sp. TrichSKD4]
 gi|307773013|gb|EFO32230.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseibium sp. TrichSKD4]
          Length = 388

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 203/387 (52%), Positives = 270/387 (69%), Gaps = 1/387 (0%)

Query: 10  NMTGQGSNS-LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
           N  G   +   G+Y+HWPFC  KCPYCDFNSHVR   V Q+ F  +F  E+     LT  
Sbjct: 2   NTKGTAPDGGFGIYIHWPFCAAKCPYCDFNSHVRHQAVDQDRFAAAFERELTHFADLTKG 61

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           +++ SIFFGGGTPSL++PQ +  IL  ++  W++   VEI++EANPSSVE   F+GYR A
Sbjct: 62  KTVQSIFFGGGTPSLMKPQTVERILSKVSGLWSIDDEVEISLEANPSSVESERFRGYRAA 121

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNR+SLGVQSL ++ L+ LGR H+   A+ AI  AR+ FPR+SFDLIYA P Q++  W 
Sbjct: 122 GVNRVSLGVQSLHDRDLKLLGRLHDVKTALKAIETARSTFPRLSFDLIYARPDQSLEDWR 181

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            ELQ+AL  A DHLSLYQLTIE GT FY ++  G LV+P  +V  + Y LTQ IT+AHGL
Sbjct: 182 AELQQALDLAADHLSLYQLTIEPGTPFYTLYHAGKLVVPEPDVGAEFYALTQDITTAHGL 241

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
            AYE+SNH+  GAE  HN  YWRYGDY+G+GPGAH R+ VG+ ++A +IE+HPE+WL+ V
Sbjct: 242 PAYEVSNHARPGAECRHNQVYWRYGDYVGVGPGAHGRITVGASKLATAIERHPETWLENV 301

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
             +GH  VE + LS E+Q DEFL+MGLRL EGI ++ +E +A R +D      L   G +
Sbjct: 302 ETHGHGKVEDQGLSEEEQGDEFLLMGLRLTEGIDLQRYEKIACRAIDPRRLSALIEHGMV 361

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E++  +R+R T+ G  +LD+V+A+LA 
Sbjct: 362 EKIDETRVRATRDGFMVLDAVVADLAA 388


>gi|254713257|ref|ZP_05175068.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
 gi|254716390|ref|ZP_05178201.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
          Length = 397

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TG R+
Sbjct: 13  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGLRT 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 73  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 132

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 133 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 192

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 193 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 253 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 312

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 313 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 372

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 373 MGGSLIRATPDGALVLDALVADLAA 397


>gi|261218176|ref|ZP_05932457.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
 gi|261320976|ref|ZP_05960173.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
 gi|260923265|gb|EEX89833.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
 gi|261293666|gb|EEX97162.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
          Length = 404

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TG R+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGLRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 380 MGGSLIRATPDGALVLDALVADLAA 404


>gi|306842540|ref|ZP_07475191.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO2]
 gi|306287396|gb|EFM58876.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO2]
          Length = 385

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TG R+
Sbjct: 1   MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGLRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 121 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 181 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 241 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 301 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +  S +R T  G  +LD+++A+LA 
Sbjct: 361 MGGSLIRATPDGALVLDALVADLAA 385


>gi|240849728|ref|YP_002971116.1| coproporphyrinogen III oxidase [Bartonella grahamii as4aup]
 gi|240266851|gb|ACS50439.1| coproporphyrinogen III oxidase [Bartonella grahamii as4aup]
          Length = 399

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/397 (53%), Positives = 269/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+ +F  E++      GPR I+SIF
Sbjct: 2   NEPFGIYIHWPFCAAKCPYCDFNSHVRIHGVDQPRFVTAFKREIETQYHKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EPQ +  +L  +AK W V+ NVEIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMEPQTVDALLQALAKKWVVNDNVEITLEANPSSVEAERFRGYRAAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +++LR LGR HN  +A+ AI LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GIQALNDKALRKLGRLHNVEQALCAIDLARQIFPRLSFDLIYARPEQTLEQWKSELVQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F ++H  G L+LP   +A DLYNLTQ IT+ HGL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTAFKRLHDAGRLILPPSELAADLYNLTQEITALHGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV-------------KVGSH-----RVAISI 297
           H+  GAES HNL YWRY  Y G GPGAH R               + SH     R     
Sbjct: 242 HAIPGAESAHNLLYWRYHQYAGFGPGAHGRFIEHAPNHSSACSKTLSSHLENRERYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE WL +V K GH  +E E L++EQQA+E L+MGLRL EG+ +  +E L+ + + +E
Sbjct: 302 EKHPEQWLNLVEKTGHGCIETEHLTTEQQANEMLLMGLRLSEGLELIRYETLSPKRIPME 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ Q  IE V   RL+ T +G  +LD +I+ LA
Sbjct: 362 KLIDLQHQELIEMVDNQRLKATTKGRIVLDHIISQLA 398


>gi|328541649|ref|YP_004301758.1| Coproporphyrinogen III oxidase, anaerobic [polymorphum gilvum
           SL003B-26A1]
 gi|326411401|gb|ADZ68464.1| Coproporphyrinogen III oxidase, anaerobic [Polymorphum gilvum
           SL003B-26A1]
          Length = 385

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 199/385 (51%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           MT        +YVHWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+    + T  R 
Sbjct: 1   MTLSTDAGFAIYVHWPFCTAKCPYCDFNSHVRHAGVDQARFVAAFERELAHFAEWTRGRR 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + SIFFGGGTPSL+ P  +  IL+ IA +W + ++VEI++EANPSSVE   F+GYR AGV
Sbjct: 61  VQSIFFGGGTPSLMAPCTVERILEAIAGHWALDADVEISLEANPSSVEAERFRGYRTAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L +  L+ LGR H+   A+AAI  AR  FPR+SFDLIYA P QT+  W+ E
Sbjct: 121 NRVSLGVQALNDPDLKMLGRLHDVQTALAAIDTARATFPRLSFDLIYARPGQTVAGWQAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+RA+  A DHLSLYQLTIE+GT F+ + + G L +P  ++  + Y LTQ++T AHGL A
Sbjct: 181 LERAIGLAADHLSLYQLTIEEGTPFFALRQAGKLTVPDPDLGAEFYELTQAVTEAHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAE  HNL YWRYGDY+G+GPGAH R+ +G+ + A +IE+HPE+WL  V  
Sbjct: 241 YEVSNHARPGAECRHNLVYWRYGDYVGVGPGAHGRLSLGASKRATAIERHPETWLANVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH +VE   L+ E+Q DE+L+MGLRL EG+ +  +E LAGR +D      L + G +E+
Sbjct: 301 HGHGMVENLPLTEEEQGDEYLLMGLRLVEGVDLSRYEALAGRQIDPRRLDALLQHGMVEK 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           +   +LR T+ G  +LD+V+A+LA 
Sbjct: 361 IGNHKLRATRDGFFVLDAVVADLAA 385


>gi|319407922|emb|CBI81576.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           schoenbuchensis R1]
          Length = 399

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/397 (52%), Positives = 269/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFCV KCPYCDFNSHVR+  V Q+ F+ +F  EM    +  GPR I+SIF
Sbjct: 2   AEPFGIYIHWPFCVAKCPYCDFNSHVRKNGVDQQRFVAAFKREMTTQYRTIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AKNWT+    EIT+EANPSSVE   F+GYR AG+NR+SL
Sbjct: 62  IGGGTPSLMTPQTVDALLQTVAKNWTIDDKTEITLEANPSSVEAERFRGYRAAGINRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++LR LGR H+  +A+ AI LAR IF R+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GVQALNDKALRQLGRLHDVKQALHAITLAREIFTRLSFDLIYARPEQTLKQWKYELSQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT+F K++  G L+LP   +A DLYNLTQ IT+ HGL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTVFKKLYAAGKLILPVSQLAADLYNLTQEITTMHGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAH--------------SRVKVGS----HRVAISI 297
           H+  GAES HNL YWRY +Y G GPGAH              S++ +       R     
Sbjct: 242 HAMPGAESRHNLLYWRYNEYAGFGPGAHGRFIQRPMKNFSTFSKIPLSKTEKLERYVTMN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE WL++V   GH  +E E L+ +QQA+E L+MGLRL EG+ +  +E L+ ++L   
Sbjct: 302 EKHPERWLELVETTGHGCIETEQLTRKQQANEMLLMGLRLSEGLDLTRYETLSLKSLSPV 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              NLQ+QG IE V   RL+ T +G  +LD +I  LA
Sbjct: 362 KLANLQQQGLIEMVDNQRLKATTKGFIVLDYIINQLA 398


>gi|118593719|ref|ZP_01551094.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
 gi|118433729|gb|EAV40391.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
          Length = 384

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 261/383 (68%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
           G      G+Y+HWPFC  KCPYCDFNSHVR   V Q  F  +F  E+     LT  + + 
Sbjct: 2   GAAEGGFGIYIHWPFCAAKCPYCDFNSHVRHQPVDQARFAAAFERELSHFADLTKNKKVQ 61

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           S+F GGGTPSL+EP  +  IL  ++  W++  NVEI++EANPSSVE   F+GYR AGVNR
Sbjct: 62  SVFLGGGTPSLMEPATVDRILKAVSDRWSMDENVEISLEANPSSVEAERFRGYRSAGVNR 121

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLGVQSL +  LR LGR H+A  A  AI  AR  FPR+SFDLIYA P QT+  WE EL 
Sbjct: 122 VSLGVQSLIDTDLRLLGRLHDARTARTAIETARATFPRLSFDLIYARPGQTLAGWEQELN 181

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            A++ A DHLSLYQLTIE+GT F+ +   G L +P  ++  + Y LTQ++T+A GL AYE
Sbjct: 182 EAIALAADHLSLYQLTIEEGTPFHTLFHAGKLKVPDPDLGAEFYELTQNVTAAAGLPAYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           +SNH+  GAE  HNL YWRYGDY+G+GPGAH R+ VG+ R+A S E+HPE+WL+ V  +G
Sbjct: 242 VSNHARPGAECRHNLVYWRYGDYVGVGPGAHGRITVGASRLATSTERHPETWLENVESHG 301

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQ 372
            A+VE   LS E+Q DEFL+MGLRL EGI +K +E  A R++D      L   G +E + 
Sbjct: 302 QALVENAGLSEEEQGDEFLLMGLRLTEGIDLKRYERYASRSVDPARLAALIEHGMVEEIG 361

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+R T+ G  +LD+V+A+LA 
Sbjct: 362 ENRIRATREGFFVLDAVVADLAA 384


>gi|254472504|ref|ZP_05085904.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudovibrio sp. JE062]
 gi|211958787|gb|EEA93987.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudovibrio sp. JE062]
          Length = 387

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 196/385 (50%), Positives = 270/385 (70%), Gaps = 1/385 (0%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           MT   +   G+YVHWPFC+ KCPYCDFNSHVR   V QE++ ++  TE+    Q+   R+
Sbjct: 1   MTVSPAGGFGIYVHWPFCLAKCPYCDFNSHVRHQPVSQEHYAKALATELARYAQMVPGRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + SIFFGGGTPSL+EP+ +  IL+ IA+ W +  + EI++EANP+SVE   F GYR AGV
Sbjct: 61  VDSIFFGGGTPSLMEPKTVETILNEIARLWHLPDSAEISMEANPTSVEATRFAGYRSAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+G+Q+L+++ L+ LGR H+ SEAI A+ +AR  FPR+SFDLIYA P QT+  WE E
Sbjct: 121 NRLSVGIQALDDKELKILGRQHSVSEAIQAVEIARKTFPRISFDLIYARPNQTLKAWEQE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA+  A DHLS+YQLTIE GT+F +++  G L +   ++A D+++LTQ +T+A G  A
Sbjct: 181 LNRAIDLAADHLSMYQLTIESGTMFQRLYAAGKLEMLDPDLAADMFDLTQEVTAARGFPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV-GSHRVAISIEKHPESWLKMVR 309
           YE+SNH+   A+ LHNL YWRYGDY+G+GPGAH R+ +    ++A S EKHPE+WL +V 
Sbjct: 241 YEVSNHAAPDAQCLHNLIYWRYGDYVGVGPGAHGRLTLEDGAKLATSTEKHPETWLGLVE 300

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
             GH  + ++ L  ++Q DE L+MG+RL EGI V  +E L+GR    +   NLQ  G +E
Sbjct: 301 TKGHGAISEDRLVRDEQGDELLLMGMRLHEGIDVPRYEQLSGRQFSPQRLLNLQENGMVE 360

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
            V  +RLR TQ G  +L++VIA LA
Sbjct: 361 WVSNTRLRATQTGFPLLNAVIAELA 385


>gi|75674390|ref|YP_316811.1| coproporphyrinogen III oxidase [Nitrobacter winogradskyi Nb-255]
 gi|74419260|gb|ABA03459.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Nitrobacter winogradskyi Nb-255]
          Length = 386

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/380 (53%), Positives = 268/380 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           + + GVY+HWPFC+ KCPYCDFNSHVR   + +E F ++F  E++     +  R++SSIF
Sbjct: 7   AAAFGVYIHWPFCLSKCPYCDFNSHVRHAPIDEERFTRAFAREIETTAARSRGRTVSSIF 66

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  ILD I K+W+V+ +VE+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 67  LGGGTPSLMRPQTVGAILDAIGKHWSVADDVEVTLEANPTSVEATRFRGYRAAGVNRVSL 126

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++ SL+ LGR H A EA  A+ +AR++F R SFDLIYA P QT   W  ELQRA+
Sbjct: 127 GVQALDDSSLKALGRLHTAREAQDAVAIARSVFDRYSFDLIYARPDQTPAMWAGELQRAI 186

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S A +HLSLYQLTIE GT F+ +H  G L  P E +A DLY++TQ + + HGL AYEISN
Sbjct: 187 SEAAEHLSLYQLTIEAGTPFFDLHAAGKLKTPDEAMARDLYDVTQDVCARHGLPAYEISN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V  NG+ +
Sbjct: 247 HARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGVRHAIATEKRPEAWLMRVEANGNGI 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           V  + L+SE++ADEFL+MGLRLREGI  + +  L+GR+LD      L+ +G I      R
Sbjct: 307 VADDPLNSEERADEFLLMGLRLREGIDPRRYAALSGRSLDPRRIAILRDEGAIMISTDGR 366

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR TQ G  +LD+V+A+LA 
Sbjct: 367 LRVTQDGFPVLDAVVADLAA 386


>gi|86747549|ref|YP_484045.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris HaA2]
 gi|86570577|gb|ABD05134.1| coproporphyrinogen III oxidase, anaerobic [Rhodopseudomonas
           palustris HaA2]
          Length = 390

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/381 (53%), Positives = 266/381 (69%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G  + GVYVHWPFC+ KCPYCDFNSHVR   + ++ F ++F  E++   Q  GPR ++SI
Sbjct: 10  GVQAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEDRFARAFAREIEATAQRIGPRDVTSI 69

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL++PQ +  ILD I K W V+ +VE+++EANP+SVE   F+GYR AGVNR+S
Sbjct: 70  FLGGGTPSLMQPQTVGAILDAIGKYWRVAPDVEVSLEANPTSVEATRFRGYRAAGVNRVS 129

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LGVQ+L++ SL+ LGR H A EA+ A+ +AR  F R SFDLIYA P QT   WE EL+RA
Sbjct: 130 LGVQALDDASLKTLGRLHTAQEAMEAVAIARAAFDRYSFDLIYARPGQTPAMWEAELRRA 189

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +  A +HLSLYQLTIE  T F+ +H+ G L  P E+ +  LY++TQS+ +  GL AYEIS
Sbjct: 190 IGEAAEHLSLYQLTIEAETPFFALHRAGKLQTPDESASRALYDVTQSVCAELGLPAYEIS 249

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R AI+ EK PESWL  V  +G  
Sbjct: 250 NHARPGAECKHNLVYWRGQEYAGIGPGAHGRLDIGGTRYAIATEKRPESWLMRVEASGTG 309

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           VV  + L+SE++ADEFL+MGLRL EGI  + ++ LAGR+LD      L+ +G I      
Sbjct: 310 VVTDDRLNSEERADEFLLMGLRLAEGIDPRRYQALAGRSLDPSRIAILREEGAIAVDADG 369

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           RLR TQ G  +LD+V+A+LA 
Sbjct: 370 RLRVTQAGFPVLDAVVADLAA 390


>gi|299133259|ref|ZP_07026454.1| oxygen-independent coproporphyrinogen III oxidase [Afipia sp.
           1NLS2]
 gi|298593396|gb|EFI53596.1| oxygen-independent coproporphyrinogen III oxidase [Afipia sp.
           1NLS2]
          Length = 385

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 265/385 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M     N+ GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E+      T  R+
Sbjct: 1   MPADAQNAFGVYVHWPFCLSKCPYCDFNSHVRHTAIDEERFARAFAREIATTAARTPGRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++PQ +  +LD I ++W V   VE+T+EANP+SVE   F GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMKPQTVGAVLDAIGQHWNVDKGVEVTLEANPTSVEATRFAGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EA+ A+ +AR  F R SFDLIYA P Q+   W  E
Sbjct: 121 NRVSLGVQALDDASLKALGRMHSAREALDAVAIARRSFDRYSFDLIYARPDQSADAWTRE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+S A +HLSLYQLTIE+GT F+ +H+ G L  P E++A  LY++TQ + +AHGL +
Sbjct: 181 LKVAISEAAEHLSLYQLTIEEGTPFFGLHRAGKLKTPDEDLARQLYDVTQEVCAAHGLPS 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R A + +K PE+WL  V +
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIGGIRHATATDKRPEAWLTRVEE 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH +  ++ L SEQ+ADEFL+MGLRL EGI  K +  LAGR LD      L+  G I  
Sbjct: 301 DGHGIATEDLLDSEQRADEFLLMGLRLAEGIDPKRYAALAGRPLDPHRIAALKEDGAIVM 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
            +  RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DESGRLRVTQDGFPLLDAVVADLAA 385


>gi|85714063|ref|ZP_01045052.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
 gi|85699189|gb|EAQ37057.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
          Length = 386

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/380 (53%), Positives = 268/380 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           + + GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E++     +  R++SSIF
Sbjct: 7   ATAFGVYVHWPFCLSKCPYCDFNSHVRHAPIDEERFARAFAREIETTAARSRGRTVSSIF 66

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++PQ +  ILD I K+W V  +VE+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 67  LGGGTPSLMQPQTVGAILDAIGKHWGVGGDVEVTLEANPTSVEATRFRGYRAAGVNRVSL 126

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++ SL+ LGR H A EA+ A+ +AR++F R SFDLIYA P QT   W  ELQRA+
Sbjct: 127 GVQALDDPSLKALGRLHTAREALDAVAIARSVFGRYSFDLIYARPDQTPVMWAEELQRAI 186

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S AV+HLSLYQLTIE+GT F+ +H  G L  P+E +A  LY++TQ I + HGL AYE+SN
Sbjct: 187 SEAVEHLSLYQLTIEEGTPFFGLHTAGKLKTPNEAIARALYDVTQEICTRHGLPAYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V   G  V
Sbjct: 247 HARPGAECRHNLVYWRGEEYAGIGPGAHGRLDIDGIRHAIATEKRPEAWLMRVEATGDGV 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           V  + L+SE++ADEFL+MGLRLREGI  + +  L+GR+LD      L+ +G I      R
Sbjct: 307 VADDLLNSEERADEFLLMGLRLREGIDPQRYAALSGRSLDPRRIAILRDEGAITISTDGR 366

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR TQ G  +LD+V+A+LA 
Sbjct: 367 LRVTQDGFPVLDAVVADLAA 386


>gi|92115781|ref|YP_575510.1| coproporphyrinogen III oxidase [Nitrobacter hamburgensis X14]
 gi|91798675|gb|ABE61050.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Nitrobacter hamburgensis X14]
          Length = 386

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/380 (53%), Positives = 266/380 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           + + GVYVHWPFC+ KCPYCDFNSHVR   + +E F+++F  E++     +  R +SSIF
Sbjct: 7   TTAFGVYVHWPFCLSKCPYCDFNSHVRHAPIDEERFVRAFTREIETTAARSPGREVSSIF 66

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++PQ +  IL+ I KNW V+ N EIT+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 67  LGGGTPSLMQPQTVGAILEAIGKNWRVADNAEITLEANPTSVEATRFRGYRAAGVNRVSL 126

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++ SL+ LGR H A EA+ A+ +AR++F R SFDLIYA P QT   W  ELQRA+
Sbjct: 127 GVQALDDASLKALGRLHTAREALDAVAIARSVFDRYSFDLIYARPDQTPAMWSEELQRAI 186

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S A +HLSLYQLTIE+GT F+ +H  G L  P E ++  LY++TQ I + HGL AYEISN
Sbjct: 187 SEAAEHLSLYQLTIEQGTPFFGLHAAGKLKTPDEAISRALYDVTQEICARHGLPAYEISN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V   G+ +
Sbjct: 247 HARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGDRHAIATEKRPEAWLMRVEAIGNGI 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           V  + L+SE++ADEFL+MGLRLREGI  + +  L+GR LD      L+ +G I      R
Sbjct: 307 VADDLLNSEERADEFLLMGLRLREGIDPQRYAALSGRLLDPRRIAILREEGAIAISPDGR 366

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR TQ G  +LD+V+A+LA 
Sbjct: 367 LRVTQDGFPVLDAVVADLAA 386


>gi|192288761|ref|YP_001989366.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris TIE-1]
 gi|192282510|gb|ACE98890.1| oxygen-independent coproporphyrinogen III oxidase [Rhodopseudomonas
           palustris TIE-1]
          Length = 385

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/385 (52%), Positives = 264/385 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E+    +  GPR 
Sbjct: 1   MQASSDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAFAREIATTAERIGPRQ 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +A ILD IA++W V    E+T+EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVAAILDAIARHWHVEPGAEVTLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EA+ A+ +A++ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKALGRMHSAEEALNAVAIAKSAFDRYSFDLIYARPGQTAAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A +HLSLYQLTIE  T FY +HK G L  P E  A  LY++TQS+ +  GL A
Sbjct: 181 LRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEARALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G+ R A + EK PESWL  V  
Sbjct: 241 YEISNHARPGAECRHNLIYWRGHEYAGIGPGAHGRLDIGNARYATATEKRPESWLMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  E L+SE++ADEFL+MGLRL EGI  + +++L+GR LD      L+ +G I  
Sbjct: 301 TGHGLIADEHLTSEERADEFLLMGLRLAEGIDPQRYQLLSGRPLDPSRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DADGRLRVTQEGFPVLDAVVADLAA 385


>gi|39933404|ref|NP_945680.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris CGA009]
 gi|39647250|emb|CAE25771.1| possible oxygen-independent coproporphyrinogen III oxidase (hemN)
           [Rhodopseudomonas palustris CGA009]
          Length = 385

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/385 (52%), Positives = 264/385 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E+    +  GPR 
Sbjct: 1   MQASSDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAFAREIATTAERIGPRQ 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +A ILD IA++W V    E+T+EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVAAILDAIARHWQVEPGAEVTLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EA+ A+ +A++ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKALGRLHSAEEALNAVAIAKSAFDRYSFDLIYARPGQTAAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A +HLSLYQLTIE  T FY +HK G L  P E  A  LY++TQS+ +  GL A
Sbjct: 181 LRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEARALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G+ R A + EK PESWL  V  
Sbjct: 241 YEISNHARPGAECRHNLIYWRGHEYAGIGPGAHGRLDIGNARYATATEKRPESWLMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  E L+SE++ADEFL+MGLRL EGI  + +++L+GR LD      L+ +G I  
Sbjct: 301 TGHGLIADEHLTSEERADEFLLMGLRLAEGIDPQRYQLLSGRPLDPSRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DADGRLRVTQEGFPVLDAVVADLAA 385


>gi|209883565|ref|YP_002287422.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Oligotropha carboxidovorans OM5]
 gi|209871761|gb|ACI91557.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Oligotropha carboxidovorans OM5]
          Length = 385

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 267/385 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M     N+ GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F+ E+         R+
Sbjct: 1   MRADAHNAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAFVREIATTAARAPDRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++PQ +A ILD IA++W+V  +VE+T+EANP+SVE   F GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMKPQTVATILDAIAQHWSVDKSVEVTLEANPTSVEATRFAGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++QSL+ LGR H A EA+ A+ +AR  F R SFDLIYA P Q +  W  E
Sbjct: 121 NRVSLGVQALDDQSLKALGRLHTAREALDAVAIARRAFKRYSFDLIYARPDQGVQAWAGE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA++ A +HLSLYQLTIE+GT F+ +H+ G L  P+E++A  LY++TQ I +A+ L A
Sbjct: 181 LHRAIAEAAEHLSLYQLTIEEGTPFFGLHRAGKLKTPNEDLARALYDVTQEICAANNLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE WL  V +
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGIRHAIATEKRPEVWLSRVEE 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  + L SEQ+ADEFL+MGLRL EGI  + +E LAGR LD      L+  G I  
Sbjct: 301 EGHGLITDDLLDSEQRADEFLLMGLRLAEGIDPQRYETLAGRPLDPHRIAALKNDGAIVM 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DINGRLRVTQAGFPLLDAVVADLAA 385


>gi|49473731|ref|YP_031773.1| coproporphyrinogen III oxidase [Bartonella quintana str. Toulouse]
 gi|49239234|emb|CAF25554.1| Oxygen-independent coproporphyrinogen III oxidase [Bartonella
           quintana str. Toulouse]
          Length = 399

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/394 (52%), Positives = 271/394 (68%), Gaps = 18/394 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+++F  E++      GPR I+SIF GG
Sbjct: 5   FGIYIHWPFCAAKCPYCDFNSHVRVHGVDQPRFVKAFKREIETQYHKIGPRHITSIFIGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ PQ +  +L  +AK WTV    EIT+EANPSSVE N F GYR AGVNR+SLGVQ
Sbjct: 65  GTPSLMTPQTVDALLQALAKTWTVDDKAEITLEANPSSVEANRFYGYRAAGVNRLSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +++LR LGR H+  +A+ AI LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+  A
Sbjct: 125 ALNDKALRQLGRLHDVKQALHAIVLAREIFPRLSFDLIYARPEQTLEQWKCELFQAIDLA 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT F ++H  G L+LP   +A +LY+LTQ +T+ HGL AYEISNH+ 
Sbjct: 185 ADHLSLYQLTIEEGTAFKRLHAAGRLILPESELAANLYHLTQEMTALHGLPAYEISNHAI 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSR------------VKVGSHRV-----AISI-EKH 300
            GAES HNL YWRY +Y G GPGAH R            +K  S ++     +++I EKH
Sbjct: 245 PGAESAHNLLYWRYHEYAGFGPGAHGRFIERSTNHFSPFLKSSSSQIKNRERSVTINEKH 304

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PE WL++V   GH  VE E L+  QQA+E L+MGLRL EG+ +  +E L  ++L IE   
Sbjct: 305 PEYWLELVETKGHGCVETEQLTPLQQANEMLLMGLRLCEGLDLTRYETLTSKSLPIEKLI 364

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           NL+ QG +E +   RL+ T +G  +LD +I+ LA
Sbjct: 365 NLKHQGLVETIGHQRLKATAKGRILLDHIISQLA 398


>gi|304392748|ref|ZP_07374688.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ahrensia sp. R2A130]
 gi|303295378|gb|EFL89738.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ahrensia sp. R2A130]
          Length = 394

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 260/386 (67%), Gaps = 4/386 (1%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            G+   G+YVHWPFC  KCPYCDFNSHVR   V QE F   F  E+  M  L   R ++S
Sbjct: 9   DGTPGFGIYVHWPFCAAKCPYCDFNSHVRHRTVDQEAFAAGFEREIAHMAALQPNRPVTS 68

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +FFGGGTPSL+EP  +  IL+ I  +W V   +EIT+EANP+SVE + F GYR AGVNR+
Sbjct: 69  VFFGGGTPSLMEPATVGTILEAIHSHWRVEDGIEITLEANPTSVEADRFSGYRAAGVNRV 128

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLGVQSL ++ L+FLGR H+A EAIAAI +AR++FPR+SFD+IYA P Q +  W++EL++
Sbjct: 129 SLGVQSLRDEQLKFLGRMHSADEAIAAIGIARDLFPRLSFDMIYARPDQKLDDWKVELEQ 188

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A+S A DHLSLYQLTIE  T FY +HK G   +P    A  LY LTQ IT A GL AYEI
Sbjct: 189 AISLAADHLSLYQLTIEPDTPFYDLHKKGRFAIPDHEQAAQLYELTQDITEAAGLPAYEI 248

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SNH+  G ES HNL YWR G + GIGPGAH R+ +   R A++ ++HPESWL  V+ NGH
Sbjct: 249 SNHAIPGHESRHNLTYWRSGTWAGIGPGAHGRLDMNDGRHALATKRHPESWLDDVQDNGH 308

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE---- 369
           A+VE E LS    ADE L+MG+RLREG+ +  +    G  +D    ++L+  G +E    
Sbjct: 309 ALVEDETLSDADLADEMLLMGMRLREGVDLNRYTQTTGIAIDPIRLQDLKGHGMVESWTD 368

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
                RLR T  G  +LD+VIA+LA 
Sbjct: 369 EQGRPRLRATPAGWLVLDAVIADLAA 394


>gi|146337343|ref|YP_001202391.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. ORS278]
 gi|146190149|emb|CAL74141.1| putative oxygen-independent coproporphyrinogen III oxidase (yggW)
           [Bradyrhizobium sp. ORS278]
          Length = 385

 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/385 (52%), Positives = 263/385 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M+   S + GVYVHWPFC+ KCPYCDFNSHVR   + Q+ F ++F  E+      TGPR+
Sbjct: 1   MSSAESEAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDQDRFARAFAQEIANTAARTGPRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++PQ +  ILD I K+W V+ +VE+++EANP+SVE   F GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPQTVGAILDAIGKHWHVAPDVEVSLEANPTSVEATRFAGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ++++ SL+ LGR H A EA+ A+ +AR  F R SFDLIYA P QT   W  E
Sbjct: 121 NRVSLGVQAMDDASLKMLGRLHTAEEAMKAVAIARGAFERYSFDLIYARPDQTAAMWTEE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA+  A +HLSLYQLTIE+GT F+ +H  G L    E +A  LY++TQ I + HGL A
Sbjct: 181 LTRAIGEAAEHLSLYQLTIEEGTPFFGLHAAGKLKTLDEGLARTLYDVTQEICARHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R A + +K PE+WL  V  
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIEGIRHATATDKRPEAWLMRVET 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           NGH V+  + L+SE++ADEFL+MGLRL EGI  + +  +AGR LD      L+ +G I  
Sbjct: 301 NGHGVMTDDLLNSEERADEFLLMGLRLSEGIDPRRYAAIAGRTLDPRRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 EPDGRLRVTQDGFPVLDAVVADLAA 385


>gi|316931693|ref|YP_004106675.1| oxygen-independent coproporphyrinogen III oxidase [Rhodopseudomonas
           palustris DX-1]
 gi|315599407|gb|ADU41942.1| oxygen-independent coproporphyrinogen III oxidase [Rhodopseudomonas
           palustris DX-1]
          Length = 385

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/385 (52%), Positives = 262/385 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +E F + F  E+    +  GPR 
Sbjct: 1   MRASPDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARGFAREIATTAERIGPRQ 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +A ILD IA++W V    E+++EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVAAILDAIARHWHVEPGAEVSLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EAI A+ +A++ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKALGRLHSAEEAINAVAIAKSAFDRYSFDLIYARPGQTAAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A +HLSLYQLTIE  T FY +HK G L  P E  A  LY++TQS+ +  GL A
Sbjct: 181 LRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEARALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G+ R A + EK PESWL  V  
Sbjct: 241 YEISNHARPGAECRHNLIYWRGQEYAGIGPGAHGRLDIGAVRYATATEKRPESWLMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  E L+SE++ADEFL+MGLRL EGI  + ++ L+GR LD      L+ +G I  
Sbjct: 301 TGHGLIADERLTSEERADEFLLMGLRLAEGIDPQRYQALSGRPLDPSRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DADGRLRVTQEGFPVLDAVVADLAA 385


>gi|319898242|ref|YP_004158335.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           clarridgeiae 73]
 gi|319402206|emb|CBI75737.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           clarridgeiae 73]
          Length = 399

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/397 (52%), Positives = 270/397 (68%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFCV KCPYCDFNS+VR   V Q  F  +F  EM       GPR I+SIF
Sbjct: 2   TKPFGIYIHWPFCVSKCPYCDFNSYVRINGVDQPRFAAAFEREMTTQAHEIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  IAKNWT+    EIT+EANPSSVE + F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMTPQTVDRLLQAIAKNWTIDDKTEITLEANPSSVEADRFRGYRLAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++L+ LGR HN  +A+ AI+LAR IFPR+SFDLIYA PKQT+ QWE EL +A+
Sbjct: 122 GVQALNDKALQQLGRLHNVKQALYAINLAREIFPRLSFDLIYARPKQTLKQWESELLQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A DHLSLYQLTIE GT F K+H  G L+LP+   A +LY LTQ IT+ +GL AYEISN
Sbjct: 182 NLAADHLSLYQLTIEDGTNFKKLHAAGKLILPTSERAANLYTLTQEITTMYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV-----------------KVGSHRVAISI- 297
           H+  GAES HNL YWRY +Y G GPGAH R                  K  +H   ++I 
Sbjct: 242 HAIPGAESCHNLLYWRYHEYAGFGPGAHGRFIKQQLKNSSFLSETLLSKTENHNRYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EK+PE+WLK+V   GH  ++ E L+ EQQA+E L+MGLRL EG+++K +E L+G++L  +
Sbjct: 302 EKYPENWLKLVETIGHGCIDTEQLTQEQQANEMLLMGLRLSEGLNLKRYETLSGQSLSPK 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ++G IE      L+ T  G  +LD +I  LA
Sbjct: 362 KLISLQQKGLIEMTSNQHLKATATGRILLDHIICQLA 398


>gi|148251802|ref|YP_001236387.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. BTAi1]
 gi|146403975|gb|ABQ32481.1| putative oxygen-independent coproporphyrinogen III oxidase (yggW)
           [Bradyrhizobium sp. BTAi1]
          Length = 385

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/385 (52%), Positives = 264/385 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           MT   + + GVYVHWPFC+ KCPYCDFNSHVR   + Q+ F ++F  E++      G R+
Sbjct: 1   MTSAENEAFGVYVHWPFCLSKCPYCDFNSHVRHTAIDQDRFARAFAREIETTAARIGART 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++PQ +  ILD I K+W V+S+VE+++EANP+SVE   F GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPQTVGAILDAIGKHWHVASDVEVSLEANPTSVEATRFAGYRTAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ++++ SL+ LGR H A EA+ A+ +AR  F R SFDLIYA P QT   W  E
Sbjct: 121 NRVSLGVQAMDDASLKMLGRLHTAEEAMKAVAIARQAFTRYSFDLIYARPDQTPAMWTEE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA+  A +HLSLYQLTIE+GT F+ +H  G L  P E +A  LY++TQ + + HGL A
Sbjct: 181 LTRAIGEAAEHLSLYQLTIEEGTPFFGLHAAGKLKTPDEGLARTLYDVTQEVCARHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ +K PE+WL  V  
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGIRHAIATDKRPEAWLMRVES 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           NGH V+  + L+ E++ADEFL+MGLRL EGI  K +  ++GR LD      L+ +G I  
Sbjct: 301 NGHGVMTDDELNREERADEFLLMGLRLAEGIDPKRYAAISGRPLDPRRIALLREEGAIIV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DGDGRLRVTQDGFPVLDAVVADLAA 385


>gi|163867355|ref|YP_001608549.1| coproporphyrinogen III oxidase [Bartonella tribocorum CIP 105476]
 gi|161016996|emb|CAK00554.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           tribocorum CIP 105476]
          Length = 399

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/397 (51%), Positives = 268/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+ +F  E++      GPR I+SIF
Sbjct: 2   NEPFGIYIHWPFCTAKCPYCDFNSHVRIHGVDQPRFVSAFEREIETQYHKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EPQ +  +L  +A+ W +   VEIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMEPQTVDALLQALARKWILDDKVEITLEANPSSVEAERFRGYRAAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +++LR LGR HN  +A+ AI LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GIQALNDKALRKLGRLHNVEQALYAIDLARQIFPRLSFDLIYARPEQTLEQWKSELIQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F ++H  G L+LP      DLY+LTQ IT+ +GL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTAFKRLHDAGRLILPPSEQTADLYHLTQEITALYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV-----------------KVGSHRVAISI- 297
           H+  GAES HNL YWRY  Y G GPGAH R                     +H   ++I 
Sbjct: 242 HAMPGAESAHNLLYWRYHQYAGFGPGAHGRFIENIPNYSSAFSKTSLSHFENHERYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           E+HPE WL++V K GH  +E E L++EQQA+E L+MGLRL EG+ +  +E L+ + + +E
Sbjct: 302 ERHPEQWLELVEKTGHGCIETERLTTEQQANEMLLMGLRLCEGLELTRYETLSSKRIPME 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ+Q  +E V   RL+ T +G  +LD +I+ LA
Sbjct: 362 KLIDLQQQELVEMVNNQRLKATTKGRIVLDHIISQLA 398


>gi|319403535|emb|CBI77116.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 399

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/397 (51%), Positives = 267/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNS+VR   V Q  F  +F  E+    +  GPR I+SIF
Sbjct: 2   TKPFGIYIHWPFCTSKCPYCDFNSYVRINGVDQPRFANAFEREITTQAKEIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AKNWT+    EIT+EANPSSVE N F+GY+ AGVNR+SL
Sbjct: 62  IGGGTPSLMAPQTVDRLLQAVAKNWTIDDKAEITLEANPSSVEANRFRGYQLAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++L+ LGR HN  +A+ AI+LAR IFPR+SFDLIYA PKQT+ QWE EL +A+
Sbjct: 122 GVQALNDKALQQLGRLHNVKQALHAINLAREIFPRLSFDLIYARPKQTLKQWETELLQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A DHLSLYQLTIE GT F K+H  G L+LP+   A +LY LTQ IT+ +GL AYEISN
Sbjct: 182 NLAADHLSLYQLTIEDGTTFKKLHAAGKLILPASEQAANLYTLTQEITTMYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV-----------------KVGSHRVAISI- 297
           H+  GAES HNL YWRY +Y G GPGAH R                  K+ +H   ++I 
Sbjct: 242 HAIPGAESCHNLLYWRYHEYAGFGPGAHGRFIKQSLKNSSFFSETFPSKIENHSRYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE+WL++V   GH  ++ E LS EQQA+E L+MG+RL EG+ +  +E L+ ++L  +
Sbjct: 302 EKHPENWLELVETKGHGCIDTEHLSQEQQANEMLLMGMRLSEGLDLARYETLSCQSLSRK 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
               LQ+QG IE      L+ T  G  +LD +I  LA
Sbjct: 362 KLIRLQQQGLIEITDKQHLKATTTGRILLDHIIGQLA 398


>gi|49474877|ref|YP_032918.1| coproporphyrinogen III oxidase [Bartonella henselae str. Houston-1]
 gi|49237682|emb|CAF26869.1| Oxygen-independent coproporphyrinogen III oxidase [Bartonella
           henselae str. Houston-1]
          Length = 399

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/394 (51%), Positives = 269/394 (68%), Gaps = 18/394 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+ +F  E++      GPR I SIF GG
Sbjct: 5   FGIYIHWPFCAAKCPYCDFNSHVRLHGVDQPRFVTAFEREIETQYHKIGPRCIKSIFIGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ PQ +  +L  +A+ W +    EIT+EANPSSVE   F+GYR AGVNR+SLGVQ
Sbjct: 65  GTPSLMTPQTVDALLQILARTWNIDDKAEITMEANPSSVEAERFRGYRVAGVNRLSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +++LR LGR H+  +A+ AI LAR IFPR+SFDLIYA P QT+ QW+ EL +A+  A
Sbjct: 125 ALNDKALRQLGRLHDVKQALHAIALARKIFPRLSFDLIYARPGQTLEQWKCELFQAIDLA 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT F ++H  G L LP   +A DLY LTQ IT+ HGL AYEISNH+ 
Sbjct: 185 ADHLSLYQLTIEEGTAFKRLHAAGRLFLPESELAADLYQLTQEITALHGLPAYEISNHAI 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRV-----------------KVGSHRVAISI-EKH 300
            GAES+HNL YWRY +Y G GPGAH R                  ++ +   +++I EK+
Sbjct: 245 SGAESVHNLLYWRYHEYAGFGPGAHGRFIEHSQNHSSASSKADPSQIENRERSVTINEKY 304

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PE WL++V K GH  +E E L++EQQA+E L+MGLRL EG+ +  ++ L+ +NL +E   
Sbjct: 305 PEHWLELVEKTGHGCIETEQLTTEQQANEMLLMGLRLCEGLDLIRYKSLSSKNLPMEKLI 364

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           +LQ+QG +E V+  RL+ T +G  +LD +I  LA
Sbjct: 365 DLQQQGLVEMVENQRLKATNKGRILLDYIINQLA 398


>gi|319404961|emb|CBI78563.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella sp.
           AR 15-3]
          Length = 398

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/394 (52%), Positives = 265/394 (67%), Gaps = 18/394 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC+ KCPYCDFNS+VR   V Q  F  +F  E+       GPR I+SIF GG
Sbjct: 4   FGIYIHWPFCMSKCPYCDFNSYVRINGVDQSRFANAFEREITTQAHEIGPRRITSIFIGG 63

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ PQ +  +L  +AKNWT+   VEIT+EANPSSVE N F+GY  AGVNR+SLGVQ
Sbjct: 64  GTPSLMTPQTVDRLLQAVAKNWTIDDKVEITLEANPSSVEANRFRGYHLAGVNRLSLGVQ 123

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +++L+ LGR HNA +A+ AI+LAR IFPR+SFDLIYA PKQT+ QW+ EL +A++ A
Sbjct: 124 ALNDKALQQLGRLHNAKQALHAINLARKIFPRLSFDLIYARPKQTLKQWKSELLQAINLA 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE GT F K+H  G L+LP+   A +LY LTQ IT+ HGL AYEISNH+ 
Sbjct: 184 TDHLSLYQLTIEDGTTFKKLHAAGKLILPASEQAANLYTLTQEITTMHGLPAYEISNHAI 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRV-----------------KVGSHRVAISI-EKH 300
            GAES HNL YWRY +Y G GPGAH R                  K  +H   ++I EKH
Sbjct: 244 PGAESCHNLLYWRYHEYAGFGPGAHGRFIKQSLKNSSLFSEKLPSKTENHNRYVTINEKH 303

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PE+WL++V   GH  +  E LS EQQA+E L+MGLRL EG+ +  +E L  ++L  +   
Sbjct: 304 PENWLELVETTGHGCINTEHLSREQQANEMLLMGLRLTEGLDLIRYETLNRQSLSSKKLI 363

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           +LQ+QG +E      L+ T +G   LD +I  LA
Sbjct: 364 HLQQQGLVEITDNKHLKATIKGRIFLDHIIYQLA 397


>gi|91974877|ref|YP_567536.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB5]
 gi|91681333|gb|ABE37635.1| coproporphyrinogen III oxidase, anaerobic [Rhodopseudomonas
           palustris BisB5]
          Length = 385

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 261/385 (67%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +  F ++F  E+       GPR 
Sbjct: 1   MGADPDKAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEARFARAFAREIAATAARIGPRD 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +  ILD I K+W V+ + E+++EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVGAILDAIGKHWRVTPDAEVSLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H A EA+ A+ +AR+ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKTLGRLHTAQEAMDAVAIARSAFDRYSFDLIYARPGQTPAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+RA+  A +HLSLYQLTIE  T F+ +H+ G L  P E+ +  LY++TQS+ +  GL A
Sbjct: 181 LRRAIGEAAEHLSLYQLTIEAETPFFALHRAGKLQTPDESASRALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R AI+ EK PESW+  V  
Sbjct: 241 YEISNHARPGAECKHNLVYWRGQEYAGIGPGAHGRLDIGGTRYAIATEKRPESWMMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            G  V+  + L+SE++ADEFL+MGLRL EGI  + ++ LAGR+LD      L  +G I  
Sbjct: 301 TGTGVITDDRLNSEERADEFLLMGLRLAEGIDPRRYQALAGRSLDPSRIALLCAEGAIVV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               RLR TQ G  +LD+V+A+LA 
Sbjct: 361 DADGRLRVTQAGFPVLDAVVADLAA 385


>gi|115522383|ref|YP_779294.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisA53]
 gi|115516330|gb|ABJ04314.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodopseudomonas palustris BisA53]
          Length = 386

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/382 (52%), Positives = 263/382 (68%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
              N+ GVYVHWPFC+ KCPYCDFNSHVR   + +E ++ +F+ E++     TG R ++S
Sbjct: 5   DADNAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERYLSAFVREIETTAARTGAREVTS 64

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL++P  +  ILD I ++W V+ +VE+++EANP+SVE + F+GYR AGVNR+
Sbjct: 65  IFLGGGTPSLMQPSTVGGILDAIGRHWRVAGDVEVSMEANPTSVEASRFRGYRAAGVNRV 124

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLGVQ+L++ SL+ LGR H A EA+ A+ +AR IF R SFDLIYA P+QT   W  EL+ 
Sbjct: 125 SLGVQALDDVSLKSLGRMHTAQEAMEAVGIARQIFDRYSFDLIYARPEQTPAMWADELRL 184

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A++ A +HLSLYQLTIE  T F+ +H  G L  P E+    LY++TQ + +  GL AYEI
Sbjct: 185 AIAQAAEHLSLYQLTIEPETPFFGLHAAGKLRTPDEDTGRALYDVTQEVCAQAGLPAYEI 244

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R AI+ EK PE+WL  V   GH
Sbjct: 245 SNHARPGAECRHNLVYWRGQEYAGIGPGAHGRIDLGGRRHAIATEKRPEAWLMRVEACGH 304

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
            VV  + L+SE++ADEFL+MGLRL EGI  + ++ LAGR LD      L  +G I     
Sbjct: 305 GVVTDDSLNSEERADEFLLMGLRLAEGIDPRRYQALAGRALDPARIATLLDEGAIVVDAD 364

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            RLR TQ G  +LD+V+A+LA 
Sbjct: 365 GRLRVTQSGFPVLDAVVADLAA 386


>gi|319406449|emb|CBI80089.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella sp.
           1-1C]
          Length = 399

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/397 (51%), Positives = 266/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC+ KCPYCDFNS+VR   V Q  F  +F  E+    +  GPR I+SIF
Sbjct: 2   TKPFGIYIHWPFCMSKCPYCDFNSYVRTNGVDQPRFANAFEREITTQAKKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AKNWT+    EIT+EANPSSVE + F+GY+ AGVNR+SL
Sbjct: 62  IGGGTPSLMAPQTVDRLLQAVAKNWTIDDKAEITLEANPSSVEADRFRGYQLAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++L+ LGR H+  +A  AI+LAR IFPR+SFDLIYA PKQT+ QWE EL +A+
Sbjct: 122 GVQALNDKALQQLGRLHSVKQAFHAINLAREIFPRLSFDLIYARPKQTLKQWETELLQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A DHLSLYQLTIE GT F K+H  G L+LP    A +LY LTQ IT+ +GL AYEISN
Sbjct: 182 NLAADHLSLYQLTIEDGTTFKKLHAAGKLILPPSEQAANLYTLTQEITTMYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV-----------------KVGSHRVAISI- 297
           H+  GAES HNL YWRY +Y G GPGAH R                  K+ +H   ++I 
Sbjct: 242 HAIPGAESRHNLLYWRYHEYAGFGPGAHGRFIKQSLKNSSFFPETFPSKIENHNRYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE+WL++V   GH  +E E LS EQQA+E L+MG+RL EG+ +  ++ L+ ++L  +
Sbjct: 302 EKHPENWLELVENTGHGCIETELLSQEQQANEMLLMGMRLAEGLDLARYKTLSCQSLPRK 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
               LQ+QG IE      L+ T+ G   LD +I  LA
Sbjct: 362 KLIRLQKQGLIEITDNQHLKATKTGRIFLDHIIYQLA 398


>gi|90421847|ref|YP_530217.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB18]
 gi|90103861|gb|ABD85898.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodopseudomonas palustris BisB18]
          Length = 386

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 264/378 (69%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           + GVY+HWPFC+ KCPYCDFNSHVR   + QE ++++F+ E++   + T  R ++SIF G
Sbjct: 9   AFGVYIHWPFCLSKCPYCDFNSHVRHVAIDQERYLRAFVREIETTAERTPGREVTSIFLG 68

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +  IL+ I K+W V+++VEI++EANP+SVE   F+GYR AGVNR+SLGV
Sbjct: 69  GGTPSLMQPATVGGILEAIGKHWNVAADVEISMEANPTSVEATRFRGYRAAGVNRVSLGV 128

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ SL+ LGR H A EA+ A+ +AR+IF R SFDLIYA P QT   W+ ELQ+A+  
Sbjct: 129 QALDDLSLKTLGRLHTAQEAMEAVAIARSIFERYSFDLIYARPGQTPAMWQAELQKAIGE 188

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A +HLSLYQLTIE  T F+ +H  G L  P E  A  LY++TQ + +AHGL +YEISNH+
Sbjct: 189 AAEHLSLYQLTIEADTPFFGLHAAGKLQTPDEATARALYDVTQEVCAAHGLPSYEISNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V   GH VV 
Sbjct: 249 RAGAECRHNLLYWRGQEYAGIGPGAHGRLDINGIRHAIATEKRPEAWLMRVEACGHGVVV 308

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
            + L+SE++ADEFL+MGLRL EGI    ++ L+GR LD      L+ +G I      RLR
Sbjct: 309 DDRLNSEERADEFLLMGLRLAEGIDPTRYQALSGRALDPARIAVLREEGAIVVDPNGRLR 368

Query: 378 CTQRGMTMLDSVIANLAV 395
            T  G  +LD+V+A+LA 
Sbjct: 369 VTLSGFPLLDAVVADLAA 386


>gi|158425915|ref|YP_001527207.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Azorhizobium caulinodans ORS 571]
 gi|158332804|dbj|BAF90289.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Azorhizobium caulinodans ORS 571]
          Length = 385

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/385 (51%), Positives = 259/385 (67%), Gaps = 2/385 (0%)

Query: 11  MTGQGS-NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
           MT Q +    GVYVHWPFC+ KCPYCDFNSHVR+    Q  ++ +F  E+  MR LTGPR
Sbjct: 1   MTAQDTAGGFGVYVHWPFCLAKCPYCDFNSHVRQAPPDQARYVAAFRREIAHMRALTGPR 60

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
           +  S+FFGGGTPSL+ P+ +  ILD I + WT++ + EIT+EANP+SVE   F+GYR AG
Sbjct: 61  TAGSVFFGGGTPSLMAPETVGAILDAIREAWTLAPDAEITLEANPTSVEAGRFRGYRAAG 120

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR+SLGVQ+L++  L+ LGR H   EA+ A+ +AR+IF R+SFDLIYA P Q    W  
Sbjct: 121 VNRVSLGVQALDDGELKKLGRMHTVDEALGAVGIARSIFERVSFDLIYARPGQNPQDWAR 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL RA+    +HLSLYQLTIE GT F K++  G L++P +  A  L+++TQ +T+A GL 
Sbjct: 181 ELSRAIDEGCEHLSLYQLTIEPGTAFEKLYSAGKLLIPDDEHARALWDVTQEVTAASGLP 240

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
           AYEISNH+  GAE+ HNL YWRYG Y G+GPGAH RV     R A   E+HPE WLK V 
Sbjct: 241 AYEISNHARPGAEARHNLVYWRYGLYAGVGPGAHGRVGQKGERRATYTERHPEGWLKAVE 300

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
            NGH +V +E L++ +QADE L+MGLRL EG+ +     L G  +D      L  +G + 
Sbjct: 301 ANGHGIVSEEVLTAAEQADEMLLMGLRLAEGVDLARHAALGGTPIDPARIAMLADEGLV- 359

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
           R+  +RL+    G  +L++VI  LA
Sbjct: 360 RLDGTRLKVLPPGFPVLNAVIGTLA 384


>gi|240137079|ref|YP_002961548.1| putative oxidase [Methylobacterium extorquens AM1]
 gi|240007045|gb|ACS38271.1| putative oxidase [Methylobacterium extorquens AM1]
          Length = 392

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 249/376 (66%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+     L   R+++SIF GG
Sbjct: 16  FGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIFLGG 75

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 76  GTPSLMAPDTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSLGVQ 135

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+ YA
Sbjct: 136 ALDDGDLKRLGRLHSVAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAIDYA 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I    GL AYEISNH+ 
Sbjct: 196 AEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICGRAGLPAYEISNHAR 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V ++GH +VE 
Sbjct: 256 PGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEDWLARVERDGHGIVET 315

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R+  
Sbjct: 316 ETLSAEDQGDEFLMMGLRLTEGIDSARYASLKGRPLHAGRLDALARDGLVARRPDGRIAA 375

Query: 379 TQRGMTMLDSVIANLA 394
           T RG  +L++V+A LA
Sbjct: 376 TARGAPVLNAVVAELA 391


>gi|298293790|ref|YP_003695729.1| oxygen-independent coproporphyrinogen III oxidase [Starkeya novella
           DSM 506]
 gi|296930301|gb|ADH91110.1| oxygen-independent coproporphyrinogen III oxidase [Starkeya novella
           DSM 506]
          Length = 381

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/377 (50%), Positives = 249/377 (66%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC  KCPYCDFNSHVR     Q  F+++F  E+   R+  G R   S+FFGG
Sbjct: 5   FGVYVHWPFCKAKCPYCDFNSHVRHSPPDQARFLKAFRAEIAHTRERIGQRRTQSVFFGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP  +  ILD I + W + +  E+T+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 65  GTPSLMEPATVGAILDAINEAWPLDARAEVTLEANPTSVEAGRFRGYRAAGVNRVSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ SL+ LGR H A EA+ A+ +AR  F R+SFDLIYA P Q    W  EL+RA+   
Sbjct: 125 ALDDASLKALGRMHTAQEALGAVAVARAAFERVSFDLIYARPDQKPEAWAAELKRAIEEG 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F  +H+ G L++P + VA  L+++TQ  T   GL +YE+SNH+ 
Sbjct: 185 CEHLSLYQLTIEDGTPFAALHRAGKLIVPEDEVARALWDVTQETTREAGLPSYEVSNHAR 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYG+Y G+GPGAH R+     RVA S E+ PE W+  V   GH V+  
Sbjct: 245 PGAESRHNLLYWRYGEYAGLGPGAHGRLDTPEGRVATSTERGPEDWVARVEHAGHGVIVD 304

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L+  +QADE+L+MGLRL EGI    +  LAG +LD      L     IE +   RLR 
Sbjct: 305 ERLTRAEQADEYLLMGLRLAEGIDRARFARLAGHDLDAGRVATLIEDAMIEELPGERLRA 364

Query: 379 TQRGMTMLDSVIANLAV 395
           T  G+ +LD+++A+LA 
Sbjct: 365 TALGLPVLDAIVADLAA 381


>gi|188579739|ref|YP_001923184.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           populi BJ001]
 gi|179343237|gb|ACB78649.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           populi BJ001]
          Length = 392

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 246/376 (65%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVY+HWPFC  KCPYCDFNSHVR   V Q  F+++F  E+     L   R ++SIF GG
Sbjct: 16  FGVYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLEAFRREIAHAAALAPGRMVTSIFLGG 75

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +A +LD +A  W V+ + E+T+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 76  GTPSLMAPETVAGLLDAVAGAWAVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSLGVQ 135

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++  L+ LGR H+  EA++A+  A   F R SFDLIYA P QT   W  EL+RA++YA
Sbjct: 136 ALDDGDLKRLGRLHSVEEALSAVRTAAAHFERFSFDLIYARPDQTAQAWAAELRRAIAYA 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I  A GL AYEISNH+ 
Sbjct: 196 AEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICEAAGLPAYEISNHAR 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V + GH +   
Sbjct: 256 PGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEGWLARVEREGHGITGT 315

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS E Q DEFLMMGLRL EGI    +  L GR LD      L   G + R    R+  
Sbjct: 316 ESLSPEDQGDEFLMMGLRLSEGIDPDRYAALKGRPLDATRLEALVTDGLVARRPNGRIAA 375

Query: 379 TQRGMTMLDSVIANLA 394
           T RG  +L++V+A LA
Sbjct: 376 TARGAPVLNAVVAELA 391


>gi|218528484|ref|YP_002419300.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           chloromethanicum CM4]
 gi|218520787|gb|ACK81372.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           chloromethanicum CM4]
          Length = 398

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 248/376 (65%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+    +L   R+++SIF GG
Sbjct: 22  FGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAELAPGRTVTSIFLGG 81

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 82  GTPSLMAPDTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSLGVQ 141

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+ YA
Sbjct: 142 ALDDGDLKRLGRLHSVAEALDAVRTAAAHFERFSFDLIYARPEQTPEAWAAELRRAIDYA 201

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F+ + + G LV P ++    LY++TQ I    GL AYEISNH+ 
Sbjct: 202 AEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDATRALYDVTQEICGLAGLPAYEISNHAR 261

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V ++G  VVE 
Sbjct: 262 PGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEEWLARVERDGDGVVET 321

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R+  
Sbjct: 322 ETLSAEDQGDEFLMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGRIAA 381

Query: 379 TQRGMTMLDSVIANLA 394
           T RG  +L++V+A LA
Sbjct: 382 TARGAPVLNAVVAELA 397


>gi|163849853|ref|YP_001637896.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           extorquens PA1]
 gi|163661458|gb|ABY28825.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           extorquens PA1]
          Length = 405

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 248/376 (65%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+     L   R+++SIF GG
Sbjct: 29  FGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIFLGG 88

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 89  GTPSLMAPDTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSLGVQ 148

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+ YA
Sbjct: 149 ALDDGDLKRLGRLHSVAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAIDYA 208

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I    GL AYEISNH+ 
Sbjct: 209 AEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICGLAGLPAYEISNHAR 268

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE W   V ++GH +VE 
Sbjct: 269 PGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEEWRARVERDGHGIVET 328

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R+  
Sbjct: 329 ETLSAEDQGDEFLMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGRIAA 388

Query: 379 TQRGMTMLDSVIANLA 394
           T RG  +L++V+A LA
Sbjct: 389 TARGAPVLNAVVAELA 404


>gi|254559087|ref|YP_003066182.1| oxidase [Methylobacterium extorquens DM4]
 gi|254266365|emb|CAX22129.1| putative oxidase [Methylobacterium extorquens DM4]
          Length = 392

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 248/376 (65%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+     L   R+++SIF GG
Sbjct: 16  FGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIFLGG 75

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 76  GTPSLMAPNTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSLGVQ 135

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+ YA
Sbjct: 136 ALDDGDLKRLGRLHSVAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAIDYA 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I    GL AYEISNH+ 
Sbjct: 196 AEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICGLAGLPAYEISNHAR 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GA+S HN  YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V ++GH +VE 
Sbjct: 256 PGAQSRHNQLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEDWLARVERDGHGIVET 315

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R+  
Sbjct: 316 ETLSAEDQGDEFLMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGRIAA 375

Query: 379 TQRGMTMLDSVIANLA 394
           T RG  +L++V+A LA
Sbjct: 376 TARGAPVLNAVVAELA 391


>gi|217978308|ref|YP_002362455.1| oxygen-independent coproporphyrinogen III oxidase [Methylocella
           silvestris BL2]
 gi|217503684|gb|ACK51093.1| oxygen-independent coproporphyrinogen III oxidase [Methylocella
           silvestris BL2]
          Length = 389

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/387 (48%), Positives = 255/387 (65%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
           +++        GVYVHWPFC+ KCPYCDFNSHVR   V +  F  + + E+    + T  
Sbjct: 3   DDLQNGADPGFGVYVHWPFCLSKCPYCDFNSHVRHEPVDEARFGSALIREIAHRAETTRG 62

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R ++SIFFGGGTPSL+    +A +++ I ++WT++   EIT+EANP+SVE   F G+R A
Sbjct: 63  RRVASIFFGGGTPSLMSASTVARVIEAIDRHWTLAPGAEITLEANPTSVEATKFAGFRAA 122

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNR+S+GVQ+L +  L+ LGR H++ EA+AA+ +AR  F R SFDLIYA   Q++ QW 
Sbjct: 123 GVNRVSIGVQALNDADLKALGRTHSSVEALAALEIARKTFERFSFDLIYARAGQSVAQWR 182

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            EL  AL+ A DHLSLYQLTIE GT+F +M   G LV+P  ++  D ++ TQ I +  GL
Sbjct: 183 SELASALALARDHLSLYQLTIEPGTMFERMRDAGKLVVPGPDLGRDFWDATQEIMNGAGL 242

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
            AYEISNH+  GAES HNL YWR GDY G+GPGAH R+   + R A + E+ P+ WL  V
Sbjct: 243 PAYEISNHARPGAESRHNLIYWRTGDYAGVGPGAHGRITGQNKRRAQATERDPQKWLSAV 302

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
              GH ++E + LS E+Q DEFL+MGLRL EGI    +E ++GR LD    ++L   G +
Sbjct: 303 ESAGHGLIEDDVLSREEQGDEFLLMGLRLAEGIEPGRFEAMSGRGLDPRRVQSLIADGMV 362

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E     RLR +  G  +LD+V+A+LA 
Sbjct: 363 EYTSGGRLRVSAEGFPLLDAVVADLAA 389


>gi|27375783|ref|NP_767312.1| coproporphyrinogen III oxidase [Bradyrhizobium japonicum USDA 110]
 gi|27348921|dbj|BAC45937.1| oxygen-independent coproporphyrinogen III oxidase [Bradyrhizobium
           japonicum USDA 110]
          Length = 373

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/373 (51%), Positives = 252/373 (67%)

Query: 23  VHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPS 82
           +HWPFC+ KCPYCDFNSHVR   + +  F  +F  E++   Q    R ++SIF GGGTPS
Sbjct: 1   MHWPFCLSKCPYCDFNSHVRHAAIDEARFASAFAREIETTAQRAPGREVTSIFLGGGTPS 60

Query: 83  LIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEE 142
           L++P  +  +LD I K+W V+ +VE+T+EANP+SVE   F GYR AGVNR+SLGVQ+L++
Sbjct: 61  LMQPATVGAVLDSIGKHWQVARDVEVTLEANPTSVEATRFAGYRAAGVNRVSLGVQALDD 120

Query: 143 QSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHL 202
            SL+ LGR H+A EA+ A+ +AR  F R SFDLIYA P QT   W  EL+ A++ A +HL
Sbjct: 121 ASLKALGRMHSAREALDAVAIARRSFERYSFDLIYARPDQTPAMWADELRLAIAEAAEHL 180

Query: 203 SLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAE 262
           SLYQLTIE+GT F+ +H+ G L  P E VA  LY++TQ      GL AYEISNH+  GAE
Sbjct: 181 SLYQLTIEEGTPFFGLHQAGKLKTPDEAVARALYDVTQETCDKLGLPAYEISNHARRGAE 240

Query: 263 SLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLS 322
             HNL YWR  +Y GIGPGAH R+ +   R A + EK PE+WL  V  NGH VV  + L+
Sbjct: 241 CRHNLVYWRGDEYAGIGPGAHGRLDIDGIRHATATEKRPEAWLLRVETNGHGVVTDDLLN 300

Query: 323 SEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRG 382
           SE++ADEFL+MGLRL EGI  + +  L+GR LD +    L+ +G I      RLR T  G
Sbjct: 301 SEERADEFLLMGLRLAEGIDPERYTALSGRALDPKRIALLREEGAITVDATGRLRVTSSG 360

Query: 383 MTMLDSVIANLAV 395
             +LD+V+A+LA 
Sbjct: 361 FPVLDAVVADLAA 373


>gi|288956858|ref|YP_003447199.1| oxygen-independent coproporphyrinogen III oxidase [Azospirillum sp.
           B510]
 gi|288909166|dbj|BAI70655.1| oxygen-independent coproporphyrinogen III oxidase [Azospirillum sp.
           B510]
          Length = 394

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/389 (49%), Positives = 256/389 (65%), Gaps = 6/389 (1%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
            ++ GQ      VYVHWPFC  KCPYCDFNSHVR  +V  + +    L E+     LT  
Sbjct: 6   GSVPGQDGPGFAVYVHWPFCKSKCPYCDFNSHVRE-RVDHDRWRAGLLRELDHYADLTAG 64

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R+++SIFFGGGTPSL+EP  +  I+D +A+ W V+  +E+T+EANP+SVE + F+ +R A
Sbjct: 65  RTVTSIFFGGGTPSLMEPATVGAIIDRVAQRWPVAERLEVTLEANPTSVEADKFRAFRGA 124

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           G+NR+SLG+Q+L++ SL+FLGR H+A+EA  AI LA  IF R SFDLIYA P QT+  W+
Sbjct: 125 GINRVSLGIQALDDTSLKFLGRQHSAAEATGAITLAARIFDRFSFDLIYARPGQTVAAWQ 184

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            EL RAL +AV HLS+YQLTIE+GT F+ +H  GDLVLP E++A DLY  TQS  +A GL
Sbjct: 185 AELARALDHAVGHLSVYQLTIEEGTAFHPLHARGDLVLPDEDLAGDLYEATQSQLAAAGL 244

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
            AYEISNH+ LG ES HNL YWRYGDY+GIGPGAH R+ +   + A    + PE WL+ V
Sbjct: 245 PAYEISNHARLGEESRHNLTYWRYGDYVGIGPGAHGRLTLDGEKFATRAHRAPEIWLERV 304

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE----RNLQR 364
            ++GHA    + +  + +  E LMMGLRL EG+ +       GR LD   +      L  
Sbjct: 305 ERDGHAAAPPDPIDRDARGTELLMMGLRLTEGVRLSRLVEETGRTLDEFVDPAALSRLID 364

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANL 393
            GF+ R    RL  T  G+  L++V+  +
Sbjct: 365 GGFLSR-DAKRLVATSEGLQRLNAVLGAI 392


>gi|323137232|ref|ZP_08072311.1| oxygen-independent coproporphyrinogen III oxidase [Methylocystis
           sp. ATCC 49242]
 gi|322397590|gb|EFY00113.1| oxygen-independent coproporphyrinogen III oxidase [Methylocystis
           sp. ATCC 49242]
          Length = 388

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/377 (48%), Positives = 255/377 (67%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC+ KCPYCDFNSHVRR  V ++ F+++F  E+     L   R + S+FFGG
Sbjct: 12  FGVYVHWPFCLSKCPYCDFNSHVRRGDVDEDRFVEAFAVELAHRASLAPGREVRSVFFGG 71

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +  IL  IA +WT++ +VEIT+EANP+SVE + F+G++ AG+NR+SLG+Q
Sbjct: 72  GTPSLMSPSTVEAILSQIASHWTMARDVEITLEANPTSVEASRFKGFKAAGINRVSLGIQ 131

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  L+ LGR H+ +EA+ A+ +A ++F R SFDLIY    QT   W  EL  AL+ A
Sbjct: 132 ALNDIDLKGLGRQHSVAEALMALDIANSVFDRTSFDLIYGRTGQTPAAWRKELDLALARA 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +H+SLYQLTIE  TLF +M   G + +P  +    L+++TQ +T+ HGL +YE+SNH+ 
Sbjct: 192 PEHVSLYQLTIEPDTLFERMVNTGKMTVPDVDTQRALWDVTQEVTARHGLPSYEVSNHAR 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAE  HNL YWRYG+Y G+GPGAH R+     R A + E+HPE WL  V   GH +VE 
Sbjct: 252 PGAECRHNLVYWRYGEYAGVGPGAHGRIVTTRGRRAQATERHPEMWLTCVETEGHGLVED 311

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L++EQ+ DEFL+MGLRLREGI  + + +L G+ L       L   G +E  + +RLR 
Sbjct: 312 ELLNAEQEGDEFLLMGLRLREGIDPQRYFLLTGKKLSQSRISELIGDGLVEVTRENRLRV 371

Query: 379 TQRGMTMLDSVIANLAV 395
           +  G  +LD+V+A+LA 
Sbjct: 372 SSEGFPVLDAVVADLAA 388


>gi|170738391|ref|YP_001767046.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           sp. 4-46]
 gi|168192665|gb|ACA14612.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           sp. 4-46]
          Length = 398

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 249/377 (66%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVY+HWPFC  KCPYCDFNSHVR     +  +  +F  E+     L   R+++S+F GG
Sbjct: 22  FGVYLHWPFCAAKCPYCDFNSHVRHAPPDEAAWRAAFAREIAHAAALAPGRTVTSVFLGG 81

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +  +LD +A  WTV+   EIT+EANP+SVE + F+GYR AGVNR+SLGVQ
Sbjct: 82  GTPSLMQPATVGALLDAVAAAWTVAPGAEITLEANPTSVEADRFRGYRLAGVNRVSLGVQ 141

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ +LR LGR H+A+EA+AA+  A   F R SFDLIYA P QT   W  EL++A++ A
Sbjct: 142 ALDDGALRRLGRLHSAAEALAAVETASRHFARFSFDLIYARPDQTPAAWAAELRQAIARA 201

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE+GT F+ +   G LV P E+ A  L+++TQ +  A GL AYEISNH+ 
Sbjct: 202 AEHLSLYQLTIEEGTPFHGLAAAGRLVPPDEDTARALFDVTQEVCGAAGLPAYEISNHAR 261

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYG+Y GIGPGAH R+ +   R     E+ PE+WL  V + GH +V  
Sbjct: 262 PGAESRHNLLYWRYGEYAGIGPGAHGRLVLPGGRTGTVTERAPEAWLARVAREGHGIVRT 321

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L+  ++ DEFL+MGLRL EGI    +  LAGR LD      L  +  +   Q  R+  
Sbjct: 322 EALTQAEEGDEFLVMGLRLAEGIDPARFARLAGRPLDRRRLDGLLAEDLVRVTQAGRIAA 381

Query: 379 TQRGMTMLDSVIANLAV 395
           T +G  +L++V+A LA 
Sbjct: 382 TPKGAPVLNAVVAELAA 398


>gi|154254013|ref|YP_001414837.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157963|gb|ABS65180.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Parvibaculum lavamentivorans DS-1]
          Length = 385

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/359 (52%), Positives = 243/359 (67%), Gaps = 1/359 (0%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
           +G      GVYVHWPFC  KCPYCDFNSHV    V Q  + ++   E+Q+MR LTGPRS+
Sbjct: 4   SGADEPGFGVYVHWPFCQSKCPYCDFNSHVV-ANVDQARWAKALTRELQYMRGLTGPRSV 62

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            SIFFGGGTPSL EP  +  +L  IA  WTV    EIT+EANP+SVE   F+GYRKAGVN
Sbjct: 63  RSIFFGGGTPSLTEPATVEAVLTQIAALWTVEQGAEITLEANPTSVEAARFRGYRKAGVN 122

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQSL+++ L+FLGR H A EA+ AI LAR  FPR+SFDLIYA P QT  +W  EL
Sbjct: 123 RLSLGVQSLDDRELKFLGRLHTADEALRAIALARETFPRLSFDLIYARPGQTKEKWTAEL 182

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           + AL++AVDHLSLYQLTIE+ T F ++++ G   LP E+ A +LY LT  I +  GL AY
Sbjct: 183 RAALAHAVDHLSLYQLTIEEETAFARLYEKGAFKLPGEDEAAELYALTGEIAAEAGLSAY 242

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           E+SN++  GAE+ HNL YWRYGDY G+GPGAH R+     R+A    + P +W++ V ++
Sbjct: 243 EVSNYARPGAEARHNLVYWRYGDYAGVGPGAHGRISTEGKRLATRTLRMPGAWIENVERD 302

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           GH +   E +    Q DE ++MGLRL EG+S+  +  LAG+ +      NL   G + R
Sbjct: 303 GHGLEASEEIPGAAQGDEMMLMGLRLEEGVSLARYAALAGKEIAAPRIGNLIADGLLMR 361


>gi|170749348|ref|YP_001755608.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655870|gb|ACB24925.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 391

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 252/378 (66%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHVRR  V +  F+ +F  E+      T  R+++SIF G
Sbjct: 14  GFGIYLHWPFCAAKCPYCDFNSHVRRAGVDEPRFLAAFRAEIAHNAARTPGRTVTSIFLG 73

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A +LD +A +W V+ + E+T+EANPSSVE   F GYR AGVNR+SLG+
Sbjct: 74  GGTPSLMQPATVAGLLDAVAAHWAVAPDAEVTLEANPSSVEAGRFHGYRAAGVNRVSLGI 133

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ SLR LGR H+ ++A+ AI LA++ F R SFDLIYA P QT   W  EL  AL+ 
Sbjct: 134 QALDDASLRTLGRLHDTAQALDAIALAQSAFARTSFDLIYARPGQTPALWRAELAEALAR 193

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A +HLSLYQLTIE GT F+ +   G LV P + V   LY++TQ + +  GL AYEISNH+
Sbjct: 194 AAEHLSLYQLTIEPGTPFHGLAAAGKLVTPDDEVGRALYDVTQDLCARAGLPAYEISNHA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HNL YWRYG+Y GIGPGAH R+     R+    E+ PE+WL  V   GH +VE
Sbjct: 254 RPGAESRHNLLYWRYGEYAGIGPGAHGRLVTPGGRLGTVTERSPEAWLARVEAEGHGIVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
            E L++  QADEFL+MGLRLREGI    +  L GR L+      L   G +ER+   R+ 
Sbjct: 314 TEILTAADQADEFLVMGLRLREGIDPDTYAALKGRPLNGNRIGMLIGDGLLERLPGGRIA 373

Query: 378 CTQRGMTMLDSVIANLAV 395
            T RG  +L++++A LA 
Sbjct: 374 ATARGAPVLNALVAELAA 391


>gi|182680298|ref|YP_001834444.1| oxygen-independent coproporphyrinogen III oxidase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182636181|gb|ACB96955.1| oxygen-independent coproporphyrinogen III oxidase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 402

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/381 (48%), Positives = 253/381 (66%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G  + G+Y+HWPFC+ KCPYCDFNSHVR   + +  F+     E+     LT  R +SSI
Sbjct: 22  GEPAFGIYLHWPFCLSKCPYCDFNSHVRAEPIDEPRFLSGLKRELAHRASLTPGRQVSSI 81

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL++   +A ++D IA +W ++  VEIT+EANP+SVE   F  YR AGVNR+S
Sbjct: 82  FFGGGTPSLMQGSTVAALIDAIAGHWPLAPQVEITLEANPTSVEAERFAAYRAAGVNRVS 141

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LGVQ+L++ +L+ LGR H+A+EA+ A+  A ++F R SFDLIY  P QT+  W  EL  A
Sbjct: 142 LGVQALDDAALQSLGRKHSAAEALRAVKTAASLFERYSFDLIYGRPGQTLADWRRELGDA 201

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L YA DHLSLYQLTIE  T F ++   G   LP  ++  DL++LTQ + +  GL AYE+S
Sbjct: 202 LHYARDHLSLYQLTIEPETPFAQLAASGRFTLPEADLGRDLWDLTQEVMNKAGLPAYEVS 261

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYG+Y G+GPGAH R+     R A +  + P+ WLK V + G  
Sbjct: 262 NHARPGAESRHNLLYWRYGEYAGVGPGAHGRLLTPHGRRAQATLRQPDLWLKTVEERGEG 321

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           + E   L+ E+QADEFL+MGLRL EGI+ +++  +AGR+ D    + L  +G +E     
Sbjct: 322 LTEDMPLTREEQADEFLLMGLRLTEGIAPENFRAVAGRDFDPRRLQTLLSEGMLEYTPHG 381

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           R+R +  G  +LD+VIA+LA 
Sbjct: 382 RVRVSAEGFPVLDAVIADLAA 402


>gi|296447431|ref|ZP_06889356.1| oxygen-independent coproporphyrinogen III oxidase [Methylosinus
           trichosporium OB3b]
 gi|296255051|gb|EFH02153.1| oxygen-independent coproporphyrinogen III oxidase [Methylosinus
           trichosporium OB3b]
          Length = 389

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/377 (48%), Positives = 252/377 (66%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVYVHWPFC+ KCPYCDFNSHVR+ +V ++ F+ +F TE++    L   R   S+FFGG
Sbjct: 13  FGVYVHWPFCLSKCPYCDFNSHVRKGEVDEDRFVDAFRTELRHRAALAPGRETRSVFFGG 72

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +  IL  I   W ++ +VE+T+EANP+SVE + F+ ++ AGVNR+SLGVQ
Sbjct: 73  GTPSLMSASTVEAILREIGDCWPLAPDVEVTLEANPTSVEASRFRSFKAAGVNRVSLGVQ 132

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LR LGR H  +EA+AA+ +A  +F R SFDLIYA P+QT   W  EL+ AL+  
Sbjct: 133 ALNDIELRALGRQHTVAEALAALDVANKVFERTSFDLIYARPQQTPAAWRKELELALARV 192

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +H+SLYQLTIE  T+F +M++ G L +P  +    L+++TQ +T+  GL AYE+SNH+ 
Sbjct: 193 TEHVSLYQLTIEPETMFERMYEAGKLEVPDTDTQRALWDVTQEMTARAGLPAYEVSNHAR 252

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G E  HNL YWRYG+Y G+GPGAH R+     R A + E+HPE WL +V   GH +VE 
Sbjct: 253 PGGECRHNLVYWRYGEYAGVGPGAHGRLITPRGRRAQATERHPEMWLTVVESEGHGLVED 312

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E LS+EQ+ DEFL+MGLRLREGI    +  L G+ L       L   G +E  + +RLR 
Sbjct: 313 ELLSAEQEGDEFLLMGLRLREGIDPGRFFALTGKKLSQSRVSELVGDGLVELTRDNRLRV 372

Query: 379 TQRGMTMLDSVIANLAV 395
           +  G  +LD+V+A+LA 
Sbjct: 373 SSEGFPVLDAVVADLAA 389


>gi|300024894|ref|YP_003757505.1| oxygen-independent coproporphyrinogen III oxidase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526715|gb|ADJ25184.1| oxygen-independent coproporphyrinogen III oxidase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 474

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/359 (51%), Positives = 238/359 (66%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           + S GVYVHWPFC +KCPYCDFNSHVR     +  F+ +++ E+     L G R++SSIF
Sbjct: 49  APSFGVYVHWPFCAQKCPYCDFNSHVRFGGWDEARFLAAYVREIDATADLIGARTVSSIF 108

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P   A ILD IAK WT++ + EIT+EANP+SVE   F+G+R+AGVNR+S+
Sbjct: 109 FGGGTPSLMQPATTAAILDHIAKRWTIAPDAEITLEANPNSVEAARFRGFREAGVNRVSI 168

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL +  LR LGR H+ +EA AA+ +A + F R SFDLIYA PKQT   W  EL  AL
Sbjct: 169 GVQSLRDDELRKLGRIHSVAEAKAALDVAHSTFDRFSFDLIYARPKQTPDAWRAELSEAL 228

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE  T +  +H  G LV+P ++ A  LY +T  +T+A GL AYE+SN
Sbjct: 229 DLAGDHLSLYQLTIEPDTAYAALHAKGKLVIPDDDAARALYEITDELTAARGLAAYEVSN 288

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G+ES HNL YWRYG+Y GIG GAH R+ V   R A   E++PE+W + V  +G  V
Sbjct: 289 YARPGSESRHNLLYWRYGEYAGIGAGAHGRIIVKGQRTATVTERNPEAWAERVEASGTGV 348

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           VE   L+ E+QADE L+MGLRL EG+ +     L G          L   G +E V  S
Sbjct: 349 VESTVLTLEEQADEMLLMGLRLSEGVDLDQLAALGGVRPAAHVVGGLIAMGLLEVVAAS 407


>gi|220920080|ref|YP_002495381.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           nodulans ORS 2060]
 gi|219944686|gb|ACL55078.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           nodulans ORS 2060]
          Length = 387

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/377 (50%), Positives = 254/377 (67%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            GVY+HWPFC  KCPYCDFNSHVR     +  +  +F  E+  +  LT  R+++SIFFGG
Sbjct: 11  FGVYLHWPFCAAKCPYCDFNSHVRHAPPDEAVWRAAFAREIAHVSALTPGRTVTSIFFGG 70

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +  +LD +A  W++S + EIT+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 71  GTPSLMQPATVGALLDAVAGAWSLSPDAEITLEANPTSVEAERFRGYRLAGVNRVSLGVQ 130

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ SL+ LGR H+A+EA+AA+  A   F R SFDLIYA P QT   W  EL+ A++ A
Sbjct: 131 ALDDASLKRLGRLHSAAEALAAVATAARHFERYSFDLIYARPDQTQAAWAAELREAIARA 190

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE+GT F+ +   G LV P E+ A  L+++TQ + +A GL AYEISNH+ 
Sbjct: 191 AEHLSLYQLTIEEGTPFHGLAAAGKLVTPDEDAARALFDVTQEVCAAAGLPAYEISNHAR 250

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYG+Y GIGPGAH R+ +   R     E+ PE+WL  V ++GH +V  
Sbjct: 251 PGAESRHNLLYWRYGEYAGIGPGAHGRLVLPEGRTGTVTERVPEAWLARVARDGHGIVTM 310

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L   ++ADEFL+MGLRL EGI    +  LAGR +D      L ++G I      R+  
Sbjct: 311 EPLKPAEEADEFLLMGLRLAEGIDPARFAALAGRPIDRGRLDALVQEGLIALTGSGRIAA 370

Query: 379 TQRGMTMLDSVIANLAV 395
           T +G  +L++++A LA 
Sbjct: 371 TPKGAPVLNALVAELAA 387


>gi|83950769|ref|ZP_00959502.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
 gi|83838668|gb|EAP77964.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
          Length = 385

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/379 (49%), Positives = 254/379 (67%), Gaps = 4/379 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+YVHWPFC  KCPYCDFNSHV    + Q+ +++S+L E++    L   R ++SIFF
Sbjct: 8   GGFGIYVHWPFCQSKCPYCDFNSHVTA-SIDQDAWLESYLAEIKRYSDLLPGRVVNSIFF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL++P  +  ++D I K WT++++VEIT+EANP SVE   F GYR+AGVNRIS+G
Sbjct: 67  GGGTPSLMQPHVVGGVIDAIGKGWTLANDVEITLEANPGSVEAGRFLGYREAGVNRISMG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +  LR LGR H+ SEA+ A  +AR+ F R+SFDLIYA   QT+  WE EL RAL+
Sbjct: 127 IQALNDPDLRRLGRLHSVSEALQAFDVARSTFSRVSFDLIYARQDQTLADWEAELTRALT 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           YAVDHLSLYQLTIE+GT F   +  G L  LP+++ A D+Y+LTQ+I + HG+ AYEISN
Sbjct: 187 YAVDHLSLYQLTIEQGTAFGDRYNRGLLKGLPADDSAADMYDLTQTICADHGMPAYEISN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRYGDY+GIGPGAH R+ VG  + A    + P  WL  V KNG   
Sbjct: 247 HAGPGAQSRHNLIYWRYGDYVGIGPGAHGRITVGGRKFATEAHRAPGKWLAEV-KNGSGD 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
             K  +   +Q  E+L+M LRL EG+    +  LA R+   +    L+  G I       
Sbjct: 306 SAKNEVIGPEQGLEYLLMCLRLTEGLDRDRYRTLAQRDFAPDTLAELRDMGMIV-ADDQN 364

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T++G  +L++++A LA
Sbjct: 365 LRLTEKGRPVLNAILAELA 383


>gi|154246478|ref|YP_001417436.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Xanthobacter autotrophicus Py2]
 gi|154160563|gb|ABS67779.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Xanthobacter autotrophicus Py2]
          Length = 399

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/377 (50%), Positives = 252/377 (66%), Gaps = 2/377 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             GVYVHWPFC  KCPYCDFNSHVR     +  FI +F  E+  MR L+GP+   ++FFG
Sbjct: 24  GFGVYVHWPFCKAKCPYCDFNSHVRHAPPDEARFIAAFRREIAHMRALSGPKQAQTVFFG 83

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A IL+ I   W ++++ E+T+EANP+SVE   F GY  AGVNR+SLGV
Sbjct: 84  GGTPSLMAPATVAAILEAINAAWPLTADAEVTLEANPTSVEAERFAGYGAAGVNRVSLGV 143

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  L+ LGR H+ +EA+AA+ +AR  F R+SFDLIYA P+QT   W  EL+RAL+ 
Sbjct: 144 QALHDADLQGLGRMHSVAEALAAVAIARRAFRRVSFDLIYARPRQTPEGWAAELRRALAE 203

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +HLSLYQLTIE GT F +++  G L+LP ++++  L+++TQ +T+  GL AYE+SNH+
Sbjct: 204 GCEHLSLYQLTIEPGTPFERLYGAGKLILPDDDISRALWDVTQEVTAQAGLPAYEVSNHA 263

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAE+ HN  YWRYG Y GIG GAH R+ V   R A+  E+ PE WL  V  +GH +V 
Sbjct: 264 RPGAEARHNQIYWRYGTYAGIGAGAHGRLVVDGTRRALFTERAPEDWLARVEAHGHGIVS 323

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
            E LS+ +QADE L+MGLRL+EG+ +     L GR +D      L   GF+ R    RL 
Sbjct: 324 DEALSAAEQADEMLLMGLRLKEGVDLARHARLGGR-VDEARIAALAAAGFVTRTG-DRLA 381

Query: 378 CTQRGMTMLDSVIANLA 394
            T  G  +L++VIA LA
Sbjct: 382 VTPAGFPVLNAVIAQLA 398


>gi|89067429|ref|ZP_01154942.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
 gi|89046998|gb|EAR53052.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
          Length = 369

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/372 (48%), Positives = 246/372 (66%), Gaps = 6/372 (1%)

Query: 23  VHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPS 82
           +HWPFC  KCPYCDFNSHV    + Q  + ++  +E+   R+ TGPR + S+FFGGGTPS
Sbjct: 1   MHWPFCQAKCPYCDFNSHVV-SGIDQTRWARALASEIARYREETGPRLLRSVFFGGGTPS 59

Query: 83  LIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEE 142
           L+ P+ +  +L  + + W + ++ E+T+EANP+SVE   F+GYR AGVNR+SLGVQ+L +
Sbjct: 60  LMLPETVDTVLQAVRRAWPMVNDPEVTLEANPTSVEAGRFRGYRDAGVNRVSLGVQALND 119

Query: 143 QSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHL 202
             LR LGR H+  EA AA  LAR++FPR+SFDLIYA   Q +  W  EL++AL+ AVDHL
Sbjct: 120 ADLRRLGRLHDMREARAAFELARDVFPRVSFDLIYARQDQELAAWRAELEQALTMAVDHL 179

Query: 203 SLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGA 261
           SLYQLTIE+GT F   ++ G L  LP+E+ AVDL+ +TQ + +A G+  YE+SNH+   A
Sbjct: 180 SLYQLTIEEGTAFGDRYRAGKLAGLPNEDRAVDLWEVTQEVCAAAGMENYEVSNHARPEA 239

Query: 262 ESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFL 321
           ES HNL YWRYGDY+G+GPGAH R+ V   R+A    + P +WL  V   GH  V +E L
Sbjct: 240 ESRHNLVYWRYGDYVGVGPGAHGRITVDGRRIATEALRAPGAWLAQVEATGHGDVAREAL 299

Query: 322 SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQR 381
            +E Q  E L+MG+RLREG+ +   E L     D+   R L   GF+E +   RLR T  
Sbjct: 300 DAEAQLAEVLLMGMRLREGVDLARVEAL---GFDVAAARGLVDGGFVE-LTGGRLRLTPA 355

Query: 382 GMTMLDSVIANL 393
           G  +L+ V+  L
Sbjct: 356 GWPVLNGVLREL 367


>gi|146278694|ref|YP_001168853.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556935|gb|ABP71548.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 385

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 251/380 (66%), Gaps = 3/380 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+F
Sbjct: 6   NGGFGLYLHWPFCQSKCPYCDFNSHVA-ATIDQSRWQRAYLSEIRRLGTETEGRVLNSVF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP+ +A IL+ +   W +++++E+T+EANP SVE   F+G+R AGVNRIS+
Sbjct: 65  FGGGTPSLMEPELVAAILETVRATWPLANDLEVTLEANPGSVEAGRFRGFRDAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q++  W  EL  AL
Sbjct: 125 GIQALNDADLRQLGRLHTVAEARAAFDVARTTFDRVSFDLIYARQDQSLADWRQELSEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           + A DHLS+YQLTIE GT F +  K G L  LP E ++ D+Y LTQ +  A GL AYEIS
Sbjct: 185 AMAADHLSMYQLTIEDGTAFGERFKRGKLRGLPEEELSADMYALTQDLCDAAGLPAYEIS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWR GDY G GPGAH RV + + R A    K P  WL+ V ++G+ 
Sbjct: 245 NHAQPGAESRHNLIYWRGGDYAGAGPGAHGRVSLATGRWATEAPKAPGGWLERVERDGNG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
            + +  L  +  A E+LMM LRLREG+  +    LAGR LD     +LQ  G IE    +
Sbjct: 305 ELPRVRLDRDDHALEYLMMALRLREGLDSERHAALAGRPLDERRVTDLQEMGMIE-TDGA 363

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RLR T RG  +L+SVIA+LA
Sbjct: 364 RLRATTRGRMVLNSVIASLA 383


>gi|209966228|ref|YP_002299143.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Rhodospirillum centenum SW]
 gi|209959694|gb|ACJ00331.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Rhodospirillum centenum SW]
          Length = 387

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 246/387 (63%), Gaps = 6/387 (1%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M+        +YVHWPFC  KCPYCDFNSHVR   + QE +  + L E+     L   R 
Sbjct: 1   MSVPSDPGFALYVHWPFCASKCPYCDFNSHVRE-GIDQERWRAALLRELDHFAALAPGRR 59

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++S+FFGGGTPSL+ P  +  +L     +W + +  E+T+EANP+SVE   F+ +R AGV
Sbjct: 60  LTSVFFGGGTPSLMAPATVEALLRRADGHWGLPAGTEVTLEANPTSVEAGRFRDFRAAGV 119

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L++  LR LGR H+A+EA+ AI LAR  F R SFDLIYA P QT+  W+ E
Sbjct: 120 NRVSLGIQALDDADLRRLGRRHSAAEALGAIRLARAAFDRFSFDLIYARPGQTVAAWKQE 179

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RAL  AV HLSLYQLTIE+GT F+ +H+ G+LVLP E+   +LY  TQ++  A GL A
Sbjct: 180 LARALDEAVGHLSLYQLTIEEGTQFHTLHERGELVLPDEDTQGELYEETQALLEAAGLPA 239

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  G ES HNL YWRYGDY+G+GPGAH R+ +   +V     + P+ WL+ V +
Sbjct: 240 YEVSNHARPGEESRHNLTYWRYGDYVGVGPGAHGRLTLTQGKVGTRTHRAPDIWLERVER 299

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQG 366
           +G A    E +  +++  E LMMGLRLREG+ +      +GR     LD +    L+R G
Sbjct: 300 DGTAAKPFEPIGPQERLVELLMMGLRLREGVPLDRIAAESGRPAAQALDPDRLDGLRRHG 359

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANL 393
            +E     RLR T  G T L+ V+  L
Sbjct: 360 LLETAD-GRLRATAEGRTRLNGVLRAL 385


>gi|114769779|ref|ZP_01447389.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
 gi|114549484|gb|EAU52366.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
          Length = 384

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/379 (46%), Positives = 266/379 (70%), Gaps = 5/379 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR+  V Q  ++ +   E++     T  R++++IFFGG
Sbjct: 9   FGIYIHWPFCAAKCPYCDFNSHVRK-SVDQSRWLSAICLELKNSAIRTRGRTVNTIFFGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP+ +A I+  IAK W ++ ++EI++EANP+SVE   F  +RKAG+NRIS+G+Q
Sbjct: 68  GTPSLMEPETVAGIIKEIAKLWVLALDIEISLEANPTSVEAQKFSDFRKAGINRISMGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           SL    L+ LGR H+ +EA  A  +A++ F R+SFDLIYA   Q+   WE+EL+ A S A
Sbjct: 128 SLRNDDLKALGRMHSVNEARKAFDIAKDNFKRVSFDLIYARQDQSKVDWEIELKEASSMA 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE GT F  +++ G L  +P++++A D+Y++TQ +T  + + AYEISNH+
Sbjct: 188 VDHLSLYQLTIEDGTRFGDLYERGSLKGMPNDSLAADMYDITQEVTLQNDMPAYEISNHA 247

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HNL YWRYGDYIG+GPGAH R+    +++A +  ++PE+WL+ V  NG + ++
Sbjct: 248 IEGAESRHNLIYWRYGDYIGVGPGAHGRISENGNKIATTTIENPENWLRGVELNGTSTID 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE-CERNLQRQGFIERVQFSRL 376
            E ++   QA E+LMM LRL EG+ ++ ++ ++G  LD +  ++N++  G I +V  + L
Sbjct: 308 DEVINHIDQASEYLMMSLRLIEGVDMERYKKISGVALDNKLIDKNIE-NGLI-KVINNNL 365

Query: 377 RCTQRGMTMLDSVIANLAV 395
             TQRG  +L+++I +L +
Sbjct: 366 IATQRGRIILNTLIKDLLI 384


>gi|329113970|ref|ZP_08242737.1| Oxygen-independent coproporphyrinogen-III oxidase-like protein
           [Acetobacter pomorum DM001]
 gi|326696717|gb|EGE48391.1| Oxygen-independent coproporphyrinogen-III oxidase-like protein
           [Acetobacter pomorum DM001]
          Length = 384

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/383 (44%), Positives = 254/383 (66%), Gaps = 6/383 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           ++L +Y+HWPFC+ KCPYCDFNSHVR  ++ Q  F Q+  TE+       G R ++SIFF
Sbjct: 4   DALALYIHWPFCLAKCPYCDFNSHVRA-EIPQARFAQALRTELAHEANRLGRRRLTSIFF 62

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +A ++D     +  + N+EIT+EANP+SVE    + +R++G+NR+SLG
Sbjct: 63  GGGTPSLMAPQTVASLIDDATSLFDAAPNLEITLEANPTSVEAERLKDFRQSGINRVSLG 122

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +++L FLGR H+A++A+AA+ LAR++FPR++FDLIYA P Q++  W+ EL+ AL 
Sbjct: 123 IQALNDKALHFLGRQHSATQALAALELARSLFPRITFDLIYARPNQSVAAWKTELETALQ 182

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              DH+SLYQLTIE GT F  +++ G   LP E  A +LY  T +IT AHGL+AYE+SN+
Sbjct: 183 LVADHVSLYQLTIEPGTKFEALYRQGSFSLPDEETAAELYETTTAITHAHGLNAYEVSNY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G+ES HNL YW YGDY+G+GPGAH R+ +     A    + PE W ++V + G    
Sbjct: 243 AKPGSESRHNLTYWHYGDYLGLGPGAHGRITLDGQLYATRRHRAPEPWAELVERTGSGQT 302

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG----RNLDIECERNLQRQGFIERVQ 372
            +E L  +++A E L+MGLRL+EG+++K +E   G      LD         +G++ +  
Sbjct: 303 SQEPLVPQERAREMLLMGLRLQEGVALKHFEARTGLHLSETLDPVILAAAVEEGYLVQTP 362

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            + L  T+ G   L++++  L +
Sbjct: 363 -THLHATEEGRLRLEALLHALVL 384


>gi|259417573|ref|ZP_05741492.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter sp. TrichCH4B]
 gi|259346479|gb|EEW58293.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter sp. TrichCH4B]
          Length = 384

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 249/379 (65%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV   ++ Q  ++ ++ +E++ M +L   R ++SIF
Sbjct: 6   NGGFGLYVHWPFCQAKCPYCDFNSHVVS-QIDQSAWVTAYQSELRRMGELLPDRLLNSIF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +A +++   +NWT ++++EI++EANP SVE   F GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMHPDTVAAVIEAARENWTFANDIEISLEANPGSVEAGRFAGYRDAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +  LR LGR H   EA  A  +ARN F R+SFDLIYA   QT+  W+ EL  AL
Sbjct: 125 GIQALNDDDLRRLGRIHTVDEARTAFDVARNCFDRVSFDLIYARQGQTLEAWKAELSEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           S A+DHLSLYQLTIE GT F   +  G L  LP+++ A D+Y  TQ I  A+GL  YEIS
Sbjct: 185 SMAIDHLSLYQLTIEDGTAFGDRYARGKLRDLPTDDNAADMYLATQDICDAYGLPGYEIS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HN  YWRYGDY+G+GPGAH R+ +   R A    + P +WL  V+K G  
Sbjct: 245 NHARPGAESRHNQIYWRYGDYVGVGPGAHGRITLNGQRYATEAPRAPGAWLDAVKK-GQG 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           ++  E L  E Q  E +MMG+RL EG+ ++  E LAG+ L ++  + L   G I  V  +
Sbjct: 304 LLPFEILKPEDQVVEHMMMGMRLFEGLDLERHEALAGKPLSVKRIQELTDWGMIV-VDGA 362

Query: 375 RLRCTQRGMTMLDSVIANL 393
           RLR T +G  +L++V+  L
Sbjct: 363 RLRATSQGRAVLNAVLREL 381


>gi|126738499|ref|ZP_01754204.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
 gi|126720298|gb|EBA17004.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
          Length = 384

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/381 (47%), Positives = 250/381 (65%), Gaps = 4/381 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV   K+ QE + +++L E++        R ++SIF
Sbjct: 6   NGGFGLYVHWPFCQAKCPYCDFNSHVSA-KIDQEIWAKAYLAELERNAPALDGRVLNSIF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  +++  AK W  ++++EI++EANP SVE   F GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMHPDTVTTVIEAAAKIWPFANDIEISLEANPGSVEAGRFAGYRDAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L ++ LR LGR H+ +EA AA  +ARN F R+SFDLIYA   Q +  W+ EL  AL
Sbjct: 125 GIQALNDEDLRRLGRIHSVAEARAAFDIARNCFDRVSFDLIYARQGQDLRHWQAELTEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           S A+DHLSLYQLTIE+GT F   +  G L  LP+++ A D+Y  TQ I  AHG+ AYE+S
Sbjct: 185 SMAIDHLSLYQLTIEEGTAFGDRYARGKLRDLPTDDTAADMYQATQDICDAHGMPAYEVS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY+GIGPGAH RV +   + A    K P  WL  +RK G  
Sbjct: 245 NHAREGAESRHNLIYWRYGDYLGIGPGAHGRVTLAGRKYATETHKAPGKWLDQIRK-GSG 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +E L+   Q+ E++MM +RL EG+ +  ++ L+G  L  E  ++L   G +  +   
Sbjct: 304 ESLREELTFVDQSIEYMMMSMRLSEGMDIPRYQQLSGSELPAERVQDLVNLGMVT-ISDQ 362

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           R+R T +G ++L++V+  L V
Sbjct: 363 RIRATAQGRSVLNAVLRELLV 383


>gi|258543385|ref|YP_003188818.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634463|dbj|BAI00439.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637521|dbj|BAI03490.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640573|dbj|BAI06535.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643630|dbj|BAI09585.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646685|dbj|BAI12633.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649738|dbj|BAI15679.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652726|dbj|BAI18660.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655782|dbj|BAI21709.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 384

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 162/338 (47%), Positives = 234/338 (69%), Gaps = 1/338 (0%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           ++L +Y+HWPFC+ KCPYCDFNSHVR  ++ Q  F Q+  TE+ +     G R ++SIFF
Sbjct: 4   DALALYIHWPFCLAKCPYCDFNSHVRA-EIPQARFAQALRTELAYEANRLGHRRLTSIFF 62

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +A ++D     +  + N+EIT+EANP+SVE    + +R+AG+NR+SLG
Sbjct: 63  GGGTPSLMAPQTVANLIDDATSLFDAAPNLEITLEANPTSVEAERLKDFRQAGINRVSLG 122

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +++L FLGR H+A++A+AA+ LAR++FPR++FDLIYA P Q++  W+ EL+ AL 
Sbjct: 123 IQALNDEALHFLGRQHSATQALAALELARSLFPRITFDLIYARPNQSVAAWKTELETALQ 182

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              DH+SLYQLTIE GT F  +++ G   LP E  A  LY  T +IT AHGL+AYE+SN+
Sbjct: 183 LVADHVSLYQLTIEPGTKFEALYRQGSFSLPDEETAAALYETTTAITHAHGLNAYEVSNY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G+ S HNL YW YGDY+G+GPGAH R+ +     A    + PE W ++V + G    
Sbjct: 243 AKPGSASRHNLTYWHYGDYLGLGPGAHGRITLDDQLYATRRHRAPEPWAELVERTGSGQT 302

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            +E L  +++A E L+MGLRL+EGI++  ++   G  L
Sbjct: 303 SQEQLVPQERAREMLLMGLRLQEGIALSHFQARTGLQL 340


>gi|163745106|ref|ZP_02152466.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
 gi|161381924|gb|EDQ06333.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
          Length = 388

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 253/378 (66%), Gaps = 4/378 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+Y+HWPFC  KCPYCDFNSHV R ++ Q  +  ++L E+Q     T  R ++++FF
Sbjct: 12  GGFGLYIHWPFCEAKCPYCDFNSHVSR-QIDQSAWRDAYLAELQRAADETPGRILNAVFF 70

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL++P  +A I+  I ++W  ++++EIT+EANP SVE   F  YR+AGV+R+S+G
Sbjct: 71  GGGTPSLMDPDVVADIIAAIRRHWPTANDLEITLEANPGSVEAGRFAAYRQAGVSRVSMG 130

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +  L+ LGR H+A EA+ A  +ARN F R+SFDLIY    QT  QWE EL++ALS
Sbjct: 131 IQALNDADLKRLGRLHSADEAMTAFDIARNTFERVSFDLIYGRQDQTAAQWEAELKQALS 190

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDL-VLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            A+DH+SLYQLTIE+GT F   +  G L  LP E++  D++ +TQ I +  G+ AYE+SN
Sbjct: 191 LAIDHISLYQLTIEQGTAFGDRYARGKLGGLPDEDLGADMFMMTQEICNEMGMPAYEVSN 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRYGDYIGIGPGAH R+ +   ++A     +P+ WL  V KN  A 
Sbjct: 251 HARDGAQSRHNLIYWRYGDYIGIGPGAHGRLTLNGQKLATVAYSNPQRWLDGVAKN-EAE 309

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
             +  +S  +QA EFL+MGLRL+EG+ +  +  ++G  +D     +LQ  G  ER Q  R
Sbjct: 310 KPRVAISRGEQATEFLLMGLRLKEGVDLARYAAISGHAIDENAVAHLQDIGMAER-QGDR 368

Query: 376 LRCTQRGMTMLDSVIANL 393
           L  + +G+ +L++VI  L
Sbjct: 369 LIVSDQGVIVLNAVIETL 386


>gi|161170275|gb|ABX59245.1| coproporphyrinogen III oxidase-related FeS oxidoreductase
           [uncultured marine bacterium EB000_55B11]
          Length = 384

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 264/379 (69%), Gaps = 5/379 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR+  V Q  ++ +   E++     T  R++++IFFGG
Sbjct: 9   FGIYIHWPFCAAKCPYCDFNSHVRK-SVDQSRWLSAXRLELKNXAIRTKGRTVNTIFFGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP+ +A I+  IAK W ++ ++EI++EANP+SVE   F  +RKAG+NRIS+G+Q
Sbjct: 68  GTPSLMEPEXVAGIIKEIAKLWVLALDIEISLEANPTSVEAQKFSDFRKAGINRISMGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           SL    L+ LGR H+ +EA  A  +A++ F R+SFDLIYA   Q+   WE+ L+ A S A
Sbjct: 128 SLRNDDLKALGRMHSVNEARKAFDIAKDNFERVSFDLIYARQDQSKVDWEIXLKEASSMA 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE GT F  +++ G L  +P++++A D+Y++TQ +T  + + AYEISNH+
Sbjct: 188 VDHLSLYQLTIEDGTRFGDLYERGSLKGMPNDSLAADMYDITQEVTLQNDMPAYEISNHA 247

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HNL YWRYGDYIG+GPGAH R+    +++A +  ++PE+WL+ V  NG + ++
Sbjct: 248 IEGAESRHNLIYWRYGDYIGVGPGAHGRISENGNKIATTTIENPENWLRGVELNGTSTID 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE-CERNLQRQGFIERVQFSRL 376
            E ++   QA E+LMM LRL EG+ ++ ++ ++G  LD +  ++N++  G I+ +  + L
Sbjct: 308 DEVINHIDQASEYLMMSLRLIEGVDMERYKKISGVALDNKLIDKNIE-NGLIKVIN-NNL 365

Query: 377 RCTQRGMTMLDSVIANLAV 395
             TQ G  +L+++I +L +
Sbjct: 366 IATQXGRIILNTLIKDLLI 384


>gi|84501189|ref|ZP_00999394.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
 gi|84390480|gb|EAQ02968.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
          Length = 384

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 247/379 (65%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHV R  + Q+ ++ ++L+E+         R +SS+F
Sbjct: 7   AGGFGIYIHWPFCEAKCPYCDFNSHVSR-SIDQDRWLSAYLSELDRQAAEVPGRVVSSVF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P  +  +LD IA+ W  +++ EIT+EANP SVE + F+ Y  AGV+R+S+
Sbjct: 66  FGGGTPSLMDPHVVGAVLDRIARLWPQANDPEITLEANPGSVESSRFRAYHSAGVSRVSM 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G Q++ +  LR LGR H  +EA+ A  +AR+ F R+SFDLIYA   QT   W+ EL++AL
Sbjct: 126 GFQAMNDGDLRRLGRLHTVAEALRAFDIARSCFERVSFDLIYARQDQTPEDWQKELEQAL 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
             AVDHLSLYQLTIE+GT F   ++ G L  LP E+ A  +Y +TQ++T+A G   YE+S
Sbjct: 186 ELAVDHLSLYQLTIEEGTAFGDRYRIGKLRGLPDEDAAATMYEITQAVTAAAGFEPYEVS 245

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HN  YWRYGDY+GIGPGAH R+ +G  R A    + P+ WLK   + G+ 
Sbjct: 246 NHARPGAESRHNSLYWRYGDYVGIGPGAHGRLTLGGKRNATEAIRMPDGWLKAA-EQGNG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +  LS   QA EFL+MGLRL EG+ +  +  LAGR L      +L   G IE     
Sbjct: 305 DKRRTPLSPSDQATEFLLMGLRLTEGVDMMRYTRLAGRPLSQSSVLDLSEMGMIE-TDGQ 363

Query: 375 RLRCTQRGMTMLDSVIANL 393
           RLR + +G  +L++VIA L
Sbjct: 364 RLRVSPQGRLVLNAVIARL 382


>gi|110677822|ref|YP_680829.1| coproporphyrinogen III oxidase [Roseobacter denitrificans OCh 114]
 gi|109453938|gb|ABG30143.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Roseobacter denitrificans OCh 114]
          Length = 385

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 179/376 (47%), Positives = 246/376 (65%), Gaps = 4/376 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWP+C  KCPYCDFNSHV R ++ Q  +  ++LTE++   + T  R + S+FFGG
Sbjct: 10  FGLYIHWPYCEAKCPYCDFNSHVVR-RIDQTAWRDAYLTELRRTARETQGRVLRSVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +A+++  + K W V++++EIT+EANPSSVE   F  +R+ GV RIS+G+Q
Sbjct: 69  GTPSLMDPDTVAVVISEVRKLWPVANDLEITLEANPSSVEAGRFAAFRQGGVTRISMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LR LGR H  +EA  A  +AR+ F R+SFDLIYA   Q++  WE EL++AL  A
Sbjct: 129 ALNDDDLRRLGRIHTVTEAQTAFDIARSEFDRVSFDLIYARQGQSLHAWEQELKQALEMA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE+GT F   +  G L  LP E+++ DLY LTQ +  A G+  YE+SNH+
Sbjct: 189 VDHLSLYQLTIEQGTAFGDRYNAGKLRGLPDEDLSADLYTLTQDLCGAAGMPGYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GA S HNL YWRYGDY+GIGPGAH R+ V   R A     +P  WL  V  + H    
Sbjct: 249 RDGAHSRHNLIYWRYGDYLGIGPGAHGRLTVNGQRYATECYSNPAKWLAAV-GDEHTEKP 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +  L+ + QA EFL+MGLRL+EGI    +E LAG+ LD      L   G +   +  R+ 
Sbjct: 308 RGPLTYQDQASEFLLMGLRLKEGIDTHRYETLAGKALDSHAVSELADLGMVSTTE-DRIT 366

Query: 378 CTQRGMTMLDSVIANL 393
            + +G  +L++VIA L
Sbjct: 367 VSDQGFIILNAVIARL 382


>gi|326387917|ref|ZP_08209523.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207963|gb|EGD58774.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 384

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 253/383 (66%), Gaps = 14/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFC+ KCPYCDFNSHVR  +V    + ++ L +M     LTG R++ SIFF
Sbjct: 2   EPLALYIHWPFCLAKCPYCDFNSHVRD-RVDVAAWQEALLADMAHEASLTGGRTLGSIFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +  +L   A++W+ + N+EIT+EANPSSVE   F     AGVNR+SLG
Sbjct: 61  GGGTPSLMPPQLVETLLSAAARHWSFAPNIEITLEANPSSVEAARFAALAGAGVNRVSLG 120

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L++++LRFLGR H+A E +AA+ +A+  F R+SFDLIYA P QT  QW+ EL RAL 
Sbjct: 121 LQALDDETLRFLGRLHDAREGLAALEVAQRHFARVSFDLIYARPGQTPEQWQAELDRALG 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLYQLTIE GT F  + ++G L    ++ A DL+ LT+ +T+A G+ AYEISNH
Sbjct: 181 FGTGHLSLYQLTIEPGTRFATLVREGKLEPLDDDAAADLFTLTRDMTAAAGIPAYEISNH 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRKNGHA 314
           +  G ES HNL YWRYGDY+GIGPGAH R      R+A +  +H  PE+WL  + ++GH 
Sbjct: 241 ARPGEESRHNLTYWRYGDYVGIGPGAHGR------RLAQATVRHRKPENWLAAIDRDGHG 294

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISV----KDWEMLAGRNLDIECERNLQRQGFIER 370
           + E+  L+  +QA E L+MGLRL EGI +    K + +     +D +  R  +  G +  
Sbjct: 295 IAEQRPLALGEQASEALLMGLRLGEGIDLAALSKRFGLPQEALIDPDKARFYRDLGLVSE 354

Query: 371 VQFSRLRCTQRGMTMLDSVIANL 393
           +   RL  T RGM +LD+++  L
Sbjct: 355 IH-GRLVVTPRGMPLLDALLGEL 376


>gi|56694934|ref|YP_165279.1| coproporphyrinogen III oxidase [Ruegeria pomeroyi DSS-3]
 gi|56676671|gb|AAV93337.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Ruegeria pomeroyi DSS-3]
          Length = 385

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 180/378 (47%), Positives = 253/378 (66%), Gaps = 4/378 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+YVHWPFC  KCPYCDFNSHV R ++ Q+ +++++++E++        R +++IFF
Sbjct: 8   GGFGLYVHWPFCQAKCPYCDFNSHVAR-EIDQKAWVRAYVSELERCAAELPGRVLNTIFF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P+ +A +++ + + W  S+++EIT+EANP SVE   F  YR  GVNRIS+G
Sbjct: 67  GGGTPSLMMPETVAAVIETVRRLWPTSNDMEITLEANPGSVEAGRFAAYRDGGVNRISMG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQ+L ++ L  LGR H+ +EA AA  +AR  F R+SFDLIYA   QT   W  EL  AL+
Sbjct: 127 VQALNDRDLHRLGRIHSVAEARAAFDIARRCFERVSFDLIYARQDQTPEAWRAELNEALA 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            AVDHLSLYQLTIE GT F   +  G L  LP+++ A D+Y +TQ + + HGL AYE+SN
Sbjct: 187 MAVDHLSLYQLTIEDGTAFGDRYARGKLRGLPADDDAADMYLITQEVCATHGLPAYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G+ES HNL YWRYGDY+GIGPGAH R+ V   R A     +P +WL  V K G   
Sbjct: 247 HARPGSESRHNLIYWRYGDYVGIGPGAHGRITVDGQRFATESPLNPGAWLGAVAK-GSGE 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           + +  LS + QADE+LMMGLR+ EG+ +  +E L+ + L+     +L   G IE ++ +R
Sbjct: 306 LSRVALSLQDQADEYLMMGLRIAEGLDIHRYEALSPQPLNRNRLAHLTELGMIE-IEGTR 364

Query: 376 LRCTQRGMTMLDSVIANL 393
           L+ T +G  +L++VI +L
Sbjct: 365 LKATAQGRAVLNAVILDL 382


>gi|89052695|ref|YP_508146.1| coproporphyrinogen III oxidase [Jannaschia sp. CCS1]
 gi|88862244|gb|ABD53121.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Jannaschia sp. CCS1]
          Length = 385

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 248/379 (65%), Gaps = 3/379 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV   ++ Q  +++++L+E+  +      R++ S+F
Sbjct: 7   AGGFGLYVHWPFCEAKCPYCDFNSHVSA-RIDQGAWLKAYLSELDRVAAELPNRTLGSVF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P ++A I++ + + W VS+++E+T+EANPSSVE   F GY+ AGVNR+S+
Sbjct: 66  FGGGTPSLMAPDSVASIIEAVRRLWPVSNDLEVTLEANPSSVEAGRFAGYKDAGVNRVSV 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++  L+ LGR H+  EA AAI +AR  F RMSFDLIYA   Q++  W  EL +AL
Sbjct: 126 GVQALDDVDLKRLGRLHSVKEAYAAIDVARAHFERMSFDLIYARQDQSLAAWRTELTQAL 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           + A DHLSLYQLTIE GT F   H  G L  LP E+++ D+Y+LTQ +  A GL AYE+S
Sbjct: 186 NLAADHLSLYQLTIEPGTAFGTRHAKGGLRGLPEEDLSADMYDLTQDLCGAAGLPAYEVS 245

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+   A+S HNL YW  GDY GIGPGAH RV +   R        P++WL  V K+G  
Sbjct: 246 NHAADFAQSRHNLVYWHAGDYAGIGPGAHGRVTLAGRRYGTETYLQPQAWLDAVGKSGSG 305

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
             ++  LS+ +QA+E+LMM LRL EG     +E L G+ LD    R+L   G IE     
Sbjct: 306 ESDRTALSAREQAEEYLMMSLRLTEGSDPARYEALNGQPLDPVKIRDLVDLGLIESTP-E 364

Query: 375 RLRCTQRGMTMLDSVIANL 393
           R++ T  G  +L+ ++ +L
Sbjct: 365 RIKATACGRPVLNGILRDL 383


>gi|260431970|ref|ZP_05785941.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415798|gb|EEX09057.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 384

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/377 (48%), Positives = 246/377 (65%), Gaps = 6/377 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+YVHWPFC  KCPYCDFNSHV R  + Q+ ++ ++L+E++     T  R +++IFFGG
Sbjct: 10  FGLYVHWPFCEAKCPYCDFNSHVSR-NIDQQQWLDAYLSELKRSAAETPDRVLNTIFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +A ++D     W  ++++EIT+EANP SVE   F  YR AGVNRIS+G+Q
Sbjct: 69  GTPSLMAPETVAAVIDTARSLWRPANDMEITLEANPGSVEAGRFAAYRDAGVNRISMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           ++ ++ LR LGR H  +EA AA  +AR  F R+SFDLIYA   QT+  W  EL  ALS A
Sbjct: 129 AMNDEDLRRLGRIHTVAEARAAFDIARTCFDRVSFDLIYARQYQTLEDWRAELTEALSMA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +DHLSLYQLTIE GT F   +  G L  LP ++ A D+Y  TQ I  AHG+ AYE+SNH+
Sbjct: 189 IDHLSLYQLTIEAGTAFGDRYSVGKLRGLPEDDNAADMYLATQEICEAHGMPAYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAVV 316
             GAES HNL YWRYGDY+GIGPGAH R+ V   R+A      P +WL  V + NG  + 
Sbjct: 249 VPGAESRHNLIYWRYGDYVGIGPGAHGRITVNGQRIATETHLAPRAWLDAVAQGNGEKL- 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L+ ++Q+ E+LMM +RL EG+ +  +  LAGR+L       LQ  G I + Q +RL
Sbjct: 308 -RVPLAPDEQSSEYLMMCIRLAEGLDIDRFHALAGRSLPQRKLDYLQEIGMITQ-QENRL 365

Query: 377 RCTQRGMTMLDSVIANL 393
             T  G  +L++VI  L
Sbjct: 366 AATADGRAVLNAVIREL 382


>gi|58040027|ref|YP_191991.1| coproporphyrinogen III oxidase [Gluconobacter oxydans 621H]
 gi|58002441|gb|AAW61335.1| HemN [Gluconobacter oxydans 621H]
          Length = 392

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 182/390 (46%), Positives = 240/390 (61%), Gaps = 10/390 (2%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQLTG--- 67
           T      L +Y+HWPFC+ KCPYCDFNSHVR   + Q+ F +    E+     +LT    
Sbjct: 3   TTSQPGPLSLYIHWPFCLAKCPYCDFNSHVREV-IPQQRFAEVLRRELAHDAARLTRDGV 61

Query: 68  PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRK 127
            R + SIFFGGGTPSL+ P+ +A +++   + +    ++EIT+EANP+SVE   F  +R+
Sbjct: 62  KRPLRSIFFGGGTPSLMAPETVAALIEDAHRLFDAEDDLEITLEANPTSVEAGKFAAFRQ 121

Query: 128 AGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQW 187
           AGVNR+SLGVQSL + +LR LGR H+A++AI A+  AR +FPR+SFDLIYA P Q+   W
Sbjct: 122 AGVNRVSLGVQSLRDDALRKLGREHSATQAIRALETARTLFPRISFDLIYARPGQSDADW 181

Query: 188 EMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHG 247
             EL  AL    DHLSLYQLTIE GT F  MH+ G+L LP E+ A  LY+LT  I + HG
Sbjct: 182 TDELTTALDLVADHLSLYQLTIEPGTKFEAMHRRGELTLPDEDTAARLYDLTGEIAARHG 241

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKM 307
           L  YE+SN++  GAES HNL YWRY DYIGIGPGAH R+ +     A    + PE W + 
Sbjct: 242 LLPYEVSNYARPGAESRHNLTYWRYADYIGIGPGAHGRLTLDGELYATRRHRAPEPWAER 301

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGF 367
           + K G    E+  LS E++  E L+MGLRL EGI    +    GR L ++C      +  
Sbjct: 302 IEKTGSGSTEETLLSPEEKGREALLMGLRLSEGIDAARFAARTGRAL-MDCVDPALLEAC 360

Query: 368 IERVQFSR----LRCTQRGMTMLDSVIANL 393
           IE     R    LR T  G   L++++A L
Sbjct: 361 IEENYLERDNGILRATGEGRLRLEAILARL 390


>gi|254487813|ref|ZP_05101018.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. GAI101]
 gi|214044682|gb|EEB85320.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. GAI101]
          Length = 385

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 175/376 (46%), Positives = 251/376 (66%), Gaps = 4/376 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV R  + Q+ +  ++L E++     T  R ++++FFGG
Sbjct: 10  FGLYIHWPFCEAKCPYCDFNSHVSR-TIDQQAWRDAYLLELERGAAETKGRVLNAVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P+ +A ++  I + W V++++EIT+EANP SVE   F+G+R AGVNR+S+G+Q
Sbjct: 69  GTPSLMDPEIVADVIAAIYRLWPVANDLEITLEANPGSVEAGRFKGFRDAGVNRVSMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LR LGR HN +EA+AA  +AR+ F R+SFDLIY    QT+++W+ EL++ALS A
Sbjct: 129 ALNDTDLRKLGRIHNTTEALAAFDIARSTFDRVSFDLIYGRQNQTLSEWKTELKQALSLA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +DH+SLYQLTIE+GT F   +  G L  LP +++  D+Y  TQ I    G+ +YE+SNH+
Sbjct: 189 IDHISLYQLTIEQGTAFGDRYAVGKLRGLPDDDLGADMYAATQEICDQMGMPSYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
              A+S HNL YWRYGDY+GIGPGAH R+  G  R A     +P+ WL     +G     
Sbjct: 249 RDSAQSRHNLIYWRYGDYLGIGPGAHGRLTKGGDRFATECFSNPKRWLDAA-VSGSTEKP 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +E L+   QA EFLMMGLRL+EG+ +K +E LAG  L  +    +Q  G I  +   RL 
Sbjct: 308 REQLAKSDQASEFLMMGLRLKEGVDLKRYEALAGSPLSAKKIIRMQDIGMIS-ISGDRLT 366

Query: 378 CTQRGMTMLDSVIANL 393
            T +G  +L++++  L
Sbjct: 367 VTNQGFMVLNAILEEL 382


>gi|99082710|ref|YP_614864.1| coproporphyrinogen III oxidase [Ruegeria sp. TM1040]
 gi|99038990|gb|ABF65602.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Ruegeria sp. TM1040]
          Length = 384

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 181/379 (47%), Positives = 249/379 (65%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV   ++ Q  ++ ++  E++ M +L   R ++SIF
Sbjct: 6   NGGFGLYVHWPFCQAKCPYCDFNSHVVS-QIDQSAWVTAYQAELRRMGELLPDRLLNSIF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +A +++   +NWT ++++EI++EANP SVE   F GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMHPDTVAAVIEAARENWTFANDIEISLEANPGSVEAGRFAGYRDAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L ++ LR LGR H+  EA  A  +ARN F R+SFDLIYA   QT+  W+ EL  AL
Sbjct: 125 GIQALNDEDLRRLGRIHSVEEARKAFDVARNCFDRVSFDLIYARQGQTLNAWKAELSEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           S A+DHLSLYQLTIE GT F   +  G L  LP+++ A D+Y  TQ I   +GL  YEIS
Sbjct: 185 SMAIDHLSLYQLTIEDGTAFGDRYARGKLRDLPTDDHAADMYLATQEICELYGLPGYEIS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY+GIGPGAH R+ +   R A    + P +WL  V + G+ 
Sbjct: 245 NHARPGAESRHNLIYWRYGDYVGIGPGAHGRITLNGTRFATEAPRAPGAWLSAVEQ-GNG 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
           ++  + L+SE Q +E +MMGLRL EG+ +     LA + L     + L   G ++ +  S
Sbjct: 304 LLPFDALNSEDQVNEHMMMGLRLFEGVDLDRHTALAQKPLSPSKIQELCNLGMLD-LDGS 362

Query: 375 RLRCTQRGMTMLDSVIANL 393
           RLR T +G  +L++V+  L
Sbjct: 363 RLRATSQGRAVLNAVLREL 381


>gi|149204372|ref|ZP_01881339.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
 gi|149142257|gb|EDM30304.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
          Length = 395

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 252/377 (66%), Gaps = 6/377 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV R+ + Q  +  ++LTE+     L   R ++++FFGG
Sbjct: 20  FGLYLHWPFCEAKCPYCDFNSHVARH-IDQSRWCAAYLTEIDRYAALLPGRVLNTVFFGG 78

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +A I++ I  +W ++++ EIT+EANP SVE   F+ + +AG++RIS+G+Q
Sbjct: 79  GTPSLMAPETVAAIIERIKHHWPMANDPEITLEANPGSVEAGRFRAFAQAGISRISMGIQ 138

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  L+ LGR H+A+EA  A  +AR  F R+SFDLIYA   QT+  W+ EL+ ALS A
Sbjct: 139 ALNDTDLKRLGRIHSAAEARQAFDIARENFERVSFDLIYARQDQTLDSWKTELRSALSMA 198

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE GT F   +  G L  LP +++A ++Y  TQ I ++ GL AYE+SNH+
Sbjct: 199 VDHLSLYQLTIESGTAFGDRYAAGKLRGLPEDDIAAEMYETTQEICASAGLPAYEVSNHA 258

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HNL YWRYGDYIGIGPGAH R+     + A    + P  WL+ V  +G  V+E
Sbjct: 259 RAGAESRHNLIYWRYGDYIGIGPGAHGRITHNGQKYATEAHRAPGKWLESVENSG--VIE 316

Query: 318 -KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +E LS   QA E+L+MGLR+ +GI    +E LAG+ LD     +L   G IE    +RL
Sbjct: 317 TRERLSGPDQAVEYLLMGLRITDGIDPARFERLAGKPLDPAAVDHLVSIGMIE-THDTRL 375

Query: 377 RCTQRGMTMLDSVIANL 393
           R T+ G  +L++VI +L
Sbjct: 376 RATRSGRAVLNAVIRDL 392


>gi|254475038|ref|ZP_05088424.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ruegeria sp. R11]
 gi|214029281|gb|EEB70116.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ruegeria sp. R11]
          Length = 384

 Score =  362 bits (928), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 183/382 (47%), Positives = 253/382 (66%), Gaps = 6/382 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLTGPRSISSI 74
           +   G+YVHWPFC  KCPYCDFNSHV   ++ Q  + +++  E+ +   QL+G R +++I
Sbjct: 6   NGGFGLYVHWPFCQAKCPYCDFNSHVT-ARIDQSKWAEAYRRELLRAAPQLSG-RVLNTI 63

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL+ P  +A ++D   + W  S+++EI++EANP+SVE   F GYR AGVNRIS
Sbjct: 64  FFGGGTPSLMHPDTVATVIDTAREIWPFSNDIEISLEANPTSVEAGRFVGYRDAGVNRIS 123

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQ+L +  LR LGR H+ SEA AA  +ARN F R+SFDLIYA   QT+  W+ EL  A
Sbjct: 124 MGVQALNDDDLRRLGRMHSVSEARAAFDVARNCFDRVSFDLIYARQGQTIETWKAELNDA 183

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEI 253
           LS A+DHLSLYQLTIE GT F   ++ G L  LPS++ A D+Y  TQ I  AHGL AYE+
Sbjct: 184 LSMAIDHLSLYQLTIEAGTAFGDRYERGTLRDLPSDDNAADMYLATQEICEAHGLPAYEV 243

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SNH+  GAES HNL YWRYGDY+G+GPGAH R+ +G  R A      P +W++ V  +G 
Sbjct: 244 SNHARPGAESRHNLIYWRYGDYLGVGPGAHGRLTLGGDRYATETYLQPGAWMEAV-TSGS 302

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
              ++  LS +  + EFLMMG+RL EG+ +  +  ++G++L  +   +L   G +E  + 
Sbjct: 303 GEAQRTLLSKDDASAEFLMMGMRLVEGLDMGRYRNISGKDLPADRITHLVDIGMVE-TRG 361

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            RL  T  G  +L++++  L V
Sbjct: 362 DRLIATDDGRAVLNAILRELLV 383


>gi|221640721|ref|YP_002526983.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides KD131]
 gi|221161502|gb|ACM02482.1| oxygen-independent coproporphyrinogen III oxidase [Rhodobacter
           sphaeroides KD131]
          Length = 385

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 182/380 (47%), Positives = 244/380 (64%), Gaps = 3/380 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+F
Sbjct: 6   NGGFGLYLHWPFCQSKCPYCDFNSHVA-ATIDQGRWQRAYLSEIRRLGTETEGRVLNSVF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVEV  F+GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMEPDLVAAILETVRTTWPLANDLEVTLEANPGSVEVGRFRGYRAAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q +  W  EL  AL
Sbjct: 125 GIQALNDADLRKLGRLHTVAEARAAFDVARATFDRVSFDLIYARQDQPLDHWRSELTEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           + A DHLS+YQLT+E GT F +  K G L  LP E ++ D+Y LTQ +    GL AYE+S
Sbjct: 185 AMAADHLSMYQLTVEDGTAFGERFKRGKLRGLPEEELSADMYALTQHLCERAGLPAYEVS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWR GDY G+GPGAH R+   + R A    K P +WL+ V ++G+ 
Sbjct: 245 NHARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPKAPGAWLERVERDGNG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +  L  E  A E+LMM LRLREG+       LAGR LD     +L+  G IE +   
Sbjct: 305 ESPRVRLDPEDHALEYLMMSLRLREGLDRARHAALAGRPLDERRVADLREMGMIE-IDDE 363

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           R+  T  G  +L+SVI  LA
Sbjct: 364 RICATTEGRMVLNSVITALA 383


>gi|77464802|ref|YP_354306.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides 2.4.1]
 gi|77389220|gb|ABA80405.1| putative Coproporphyrinogen III oxidase and related Fe-S
           oxidoreductases [Rhodobacter sphaeroides 2.4.1]
          Length = 385

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 180/380 (47%), Positives = 242/380 (63%), Gaps = 3/380 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+F
Sbjct: 6   NGGFGLYLHWPFCQSKCPYCDFNSHVA-ATIDQGRWQRAYLSEIRRLGAETEGRVLNSVF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVE   F+GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMEPDLVAAILETVRATWPLANDLEVTLEANPGSVEAGRFRGYRAAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q +  W  EL  AL
Sbjct: 125 GIQALNDADLRKLGRLHTVAEARAAFDVARTTFDRVSFDLIYARQDQPLEHWRSELTEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           + A DHLS+YQLT+E GT F    K G L  LP E ++ D+Y LTQ +  A GL AYE+S
Sbjct: 185 TMAADHLSMYQLTVEDGTAFGDRFKRGKLRGLPEEELSADMYALTQDLCEAAGLPAYEVS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWR GDY G+GPGAH R+   + R A    + P +WL+ V ++G  
Sbjct: 245 NHARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPRAPAAWLERVERDGTG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +  L +E  A E+LMM LRLREG+       LAGR LD     +L+  G I+     
Sbjct: 305 EGPRVRLDAEDHALEYLMMSLRLREGLDRGRHAALAGRPLDERRVADLREMGMID-TDDE 363

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           R+  T  G  +L+SVI  LA
Sbjct: 364 RIFATTEGRMVLNSVITALA 383


>gi|209542808|ref|YP_002275037.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530485|gb|ACI50422.1| oxygen-independent coproporphyrinogen III oxidase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 393

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/390 (45%), Positives = 244/390 (62%), Gaps = 11/390 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLT--GPRSIS 72
           +  L +Y+HWPFC+ KCPYCDFNSHVR   + Q  F  +   E+ Q   +L   GPR + 
Sbjct: 5   AAPLALYIHWPFCLAKCPYCDFNSHVRDV-IPQARFAAALRRELAQDAARLNADGPRRLG 63

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIFFGGGTPSL++P  +A ++      +T   ++EIT+EANP+SVE    + +R AG+NR
Sbjct: 64  SIFFGGGTPSLMDPATVAALIADATTLFTPLPDLEITLEANPTSVEAGRLRAFRDAGINR 123

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLG+QSL++ +LR LGR H+A++AI A+ LAR +F R+SFDLIYA P Q++  W  EL 
Sbjct: 124 VSLGIQSLDDDALRLLGREHSATQAIDALDLARGLFDRISFDLIYARPGQSLPAWRAELD 183

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           RALS   DHLSLYQLTIE GT F  +H+ G L LP E+ A  LY  T  +   HGL  YE
Sbjct: 184 RALSLVSDHLSLYQLTIEPGTRFEGLHRQGLLALPDEDDAARLYEETAIVAGRHGLMGYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           +SN++  GAES HNL YWRYGDY+GIGPGAHSR+ +     A    + PE W + V + G
Sbjct: 244 VSNYARPGAESRHNLTYWRYGDYLGIGPGAHSRLTLDGTLHATRRHRAPEPWAERVERQG 303

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGIS----VKDWEMLAGRNLDIECERNLQRQGFI 368
             V++ E LS+  +A E L+MGLRL EGI+     +   M     LD         +G++
Sbjct: 304 SGVMQDETLSARDRAREMLLMGLRLSEGITEDRFARRTGMAMADALDPAILAAALEEGYL 363

Query: 369 ERVQFSR---LRCTQRGMTMLDSVIANLAV 395
            R + +    LR T  G   L++++  L +
Sbjct: 364 LRDETTDGPVLRATPSGRLRLEALLGALVL 393


>gi|332559698|ref|ZP_08414020.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
 gi|332277410|gb|EGJ22725.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
          Length = 385

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 180/380 (47%), Positives = 242/380 (63%), Gaps = 3/380 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+F
Sbjct: 6   NGGFGLYLHWPFCQSKCPYCDFNSHVA-ATIDQGRWQRAYLSEIRRLGTETEGRVLNSVF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVE   F+GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMEPDLVAAILETVRTTWPLANDLEVTLEANPGSVEAGRFRGYRAAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q +  W  EL  AL
Sbjct: 125 GIQALNDADLRKLGRLHTVAEARAAFDVARATFDRVSFDLIYARQDQPLEHWRSELTEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           + A DHLS+YQLT+E GT F    K G L  LP E ++ D+Y LTQ +  A GL AYE+S
Sbjct: 185 TMAADHLSMYQLTVEDGTAFGDRFKRGKLRGLPEEELSADMYTLTQDLCEAAGLPAYEVS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWR GDY G+GPGAH R+   + R A    + P +WL+ V ++G  
Sbjct: 245 NHARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPRAPAAWLERVERDGTG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +  L +E  A E+LMM LRLREG+       LAGR LD     +L+  G I+     
Sbjct: 305 EGPRVRLDAEDHALEYLMMSLRLREGLDRGRHAALAGRPLDERRIADLREMGMID-TDDE 363

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           R+  T  G  +L+SVI  LA
Sbjct: 364 RIFATTEGRMVLNSVITALA 383


>gi|83942032|ref|ZP_00954494.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
 gi|83847852|gb|EAP85727.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
          Length = 385

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 172/376 (45%), Positives = 246/376 (65%), Gaps = 4/376 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV R  + Q  +  ++L E++     T  R ++++FFGG
Sbjct: 10  FGLYIHWPFCEAKCPYCDFNSHVSR-TIDQRAWRDAYLAELERGAAETQGRVLNAVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +A ++  I + W  ++++EIT+EANP SVE   F  +R+AGVNRIS+G+Q
Sbjct: 69  GTPSLMDPDVVADVIAAIRRLWPTANDLEITLEANPGSVEAVRFAAFRQAGVNRISMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  L+ LGR H   E +AA  +ARN F R+SFDLIY    Q +  W  EL++ALS A
Sbjct: 129 ALNDADLKRLGRIHTVDEGLAAFDIARNTFERVSFDLIYGRQNQGLADWRTELKQALSLA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +DH+SLYQLTIE+GT F   +  G L  LPS+++  D+Y  TQ I    G+ +YE+SNH+
Sbjct: 189 IDHMSLYQLTIEQGTAFGDRYAVGKLRGLPSDDLGADMYAATQDICGEMGMPSYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GA+S HNL YWRYGDY+GIGPGAH R+    +R A     +P+ WL  V  +G     
Sbjct: 249 RDGAQSRHNLIYWRYGDYLGIGPGAHGRLTQNGNRFATECFSNPKRWLDAV-ASGATEKP 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +E L++E Q  EFLMMGLRL+EG+ ++ +E L+G  L  +    +Q  G I R +  +L 
Sbjct: 308 RELLTTEDQGSEFLMMGLRLKEGVDLRRYEALSGAPLSTKKITQMQDIGMISRDK-DQLY 366

Query: 378 CTQRGMTMLDSVIANL 393
            T +G  +L++++A L
Sbjct: 367 VTDQGFMVLNAILAEL 382


>gi|162148169|ref|YP_001602630.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786746|emb|CAP56329.1| putative oxygen-independent coproporphyrinogen III oxidase-like
           protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 393

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 179/390 (45%), Positives = 243/390 (62%), Gaps = 11/390 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLT--GPRSIS 72
           +  L +Y+HWPFC+ KCPYCDFNSHVR   + Q  F  +   E+ Q   +L   GPR + 
Sbjct: 5   AAPLALYIHWPFCLAKCPYCDFNSHVRDV-IPQARFAAALRRELAQDAARLNADGPRRLG 63

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIFFGGGTPSL++P  +A ++      +T   ++EIT+EANP+SVE    + +R AG+NR
Sbjct: 64  SIFFGGGTPSLMDPATVAALIADATTLFTPLPDLEITLEANPTSVEAGRLRAFRDAGINR 123

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLG+QSL++ +LR LGR H+A++AI A+ LAR +F R+SFDLIYA P Q++  W  EL 
Sbjct: 124 VSLGIQSLDDDALRLLGREHSATQAIDALDLARGLFDRISFDLIYARPGQSLPAWRAELD 183

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           RALS   DHLSLYQLTIE GT F  +H+ G L LP E+ A  LY  T  +   HGL  YE
Sbjct: 184 RALSLVSDHLSLYQLTIEPGTRFEGLHRQGLLALPDEDDAARLYEETAIVAGRHGLMGYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           +SN++  GAES HNL YWRYGDY+GIGPGAHSR+ +     A    + PE W + V + G
Sbjct: 244 VSNYARPGAESRHNLTYWRYGDYLGIGPGAHSRLTLDGTLHATRRHRAPEPWAERVERQG 303

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGIS----VKDWEMLAGRNLDIECERNLQRQGFI 368
             V++ E LS+  +A E L+MGLRL EGI      +   M     LD         +G++
Sbjct: 304 SGVMQDETLSARDRAREMLLMGLRLSEGIPEDRFARRTGMAMADALDPAILAAALEEGYL 363

Query: 369 ERVQFSR---LRCTQRGMTMLDSVIANLAV 395
            R + +    LR T  G   L++++  L +
Sbjct: 364 LRDETTDGPVLRATPSGRLRLEALLGALVL 393


>gi|307294008|ref|ZP_07573852.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           chlorophenolicum L-1]
 gi|306880159|gb|EFN11376.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           chlorophenolicum L-1]
          Length = 396

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 247/384 (64%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           ++ L +YVHWPFCV KCPYCDFNSHVR   +  + +  + L ++     L G R +SSIF
Sbjct: 18  ADPLALYVHWPFCVSKCPYCDFNSHVR-ADIDADAWRDALLKDLAHEAGLNGGRPLSSIF 76

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+ +  ++D  A++W  + ++EIT+EANPSSVE   F     AGVNR+SL
Sbjct: 77  FGGGTPSLMPPRIVEALIDAAARHWRPTPDIEITLEANPSSVEAARFADLAAAGVNRVSL 136

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+LE+++L FLGR H+  E +AA+ +A+++F R++FDLIYA P Q+   WE EL R L
Sbjct: 137 GLQALEDEALHFLGRAHDVREGLAALDVAQSVFGRVNFDLIYARPGQSEADWEAELARGL 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+  DHLSLYQLTIE GT F  +   G L+    + A  LY  TQ++T+A G+ AYEISN
Sbjct: 197 SFGTDHLSLYQLTIEPGTRFATLAAQGKLIPADPDHAATLYERTQAMTAAAGIPAYEISN 256

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRKNGH 313
           H+  G ES HNL YWRYGDY+G+GPGAH R      R  ++  +H  PE+W+  V +NGH
Sbjct: 257 HARPGQESRHNLTYWRYGDYLGVGPGAHGR------RGGLATMRHKKPENWMNAVARNGH 310

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE----RNLQRQGFIE 369
            +  +E LS E +A E L+MGLRL EG+ +     L+G  +D   +      L   G + 
Sbjct: 311 GLQSEEPLSPEDRAREALLMGLRLGEGVDLDRIARLSGLAVDALVDGKAVARLAGHGLV- 369

Query: 370 RVQFSRLRCTQRGMTMLDSVIANL 393
           R Q  RL     GM +LD+++  +
Sbjct: 370 RQQDQRLYVESAGMLLLDAILPEI 393


>gi|294679005|ref|YP_003579620.1| oxygen-independent coproporphyrinogen-III oxidase [Rhodobacter
           capsulatus SB 1003]
 gi|294477825|gb|ADE87213.1| oxygen-independent coproporphyrinogen-III oxidase-3 [Rhodobacter
           capsulatus SB 1003]
          Length = 385

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 246/378 (65%), Gaps = 3/378 (0%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+Y+HWPFC  KCPYCDFNSHV    +  + +++++L E+  +   T  R ++++FF
Sbjct: 8   GGFGLYLHWPFCAAKCPYCDFNSHVA-AAIDHDRWLRAYLAEIDRIGAETQGRVLNTVFF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P+ +A ++D I   W  ++++EIT+EANP+S++   F+ + + GV R+S+G
Sbjct: 67  GGGTPSLMAPETVAAVIDRIRATWPTANDLEITLEANPTSIDAGKFRAFAQGGVTRLSMG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q++++ SLR LGR H+A+E  AA  +AR  FPR+SFDLIYA   Q +  W  EL+ ALS
Sbjct: 127 MQAMDDDSLRRLGRMHSAAEGRAAFDIARAHFPRVSFDLIYARQGQGLDDWARELRGALS 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            AVDH SLYQLTIE GT F ++   G L  LP +++A D+Y  TQ I  A GL AYE+SN
Sbjct: 187 MAVDHFSLYQLTIEDGTAFGRLFAAGKLRDLPEDDLAADMYLKTQEICDAAGLPAYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAE  HNL YWRYGDY GIGPGAH R+ +G  R A    K P  WL  V + G+  
Sbjct: 247 HARPGAECRHNLVYWRYGDYAGIGPGAHGRLTLGGVRHATEAPKAPADWLDRVERLGNGE 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           + +E L  ++QA EFL+ GLRL EGI    +E L+G+ L      +L+  G I R    R
Sbjct: 307 MPREPLERQEQATEFLLFGLRLAEGIDPTRYERLSGQALPALALADLEAMGMIAR-DAGR 365

Query: 376 LRCTQRGMTMLDSVIANL 393
           +R T +G  +L++VI  L
Sbjct: 366 IRATAQGRAVLNAVIRAL 383


>gi|332187820|ref|ZP_08389554.1| radical SAM superfamily protein [Sphingomonas sp. S17]
 gi|332012170|gb|EGI54241.1| radical SAM superfamily protein [Sphingomonas sp. S17]
          Length = 387

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 184/374 (49%), Positives = 239/374 (63%), Gaps = 8/374 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVHWPFCV KCPYCDFNSHVR   V Q  +  + L ++     +   R ++SIFFGG
Sbjct: 12  LALYVHWPFCVSKCPYCDFNSHVRE-SVDQAAWADALLADLAHEAAMLPGRQLTSIFFGG 70

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +A ILD   ++W  +  +EIT+EANPSSVE   F     AGVNR SLGVQ
Sbjct: 71  GTPSLMPPATVAAILDAAERHWGFAEGIEITLEANPSSVEAARFADLAAAGVNRASLGVQ 130

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++++LRFLGR H   EA+ A+  A+  F R+SFDLIYA P Q +  WE EL RA+ Y 
Sbjct: 131 ALDDEALRFLGRAHGVDEALRALQTAQEQFGRVSFDLIYARPGQPLADWEAELTRAIGYG 190

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F      G L +P  + A DL+  T++IT+A GL AYE SNH+ 
Sbjct: 191 TEHLSLYQLTIEPGTRFATEAAAGRLTIPDGDAAADLFETTRAITAAAGLPAYETSNHAR 250

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
           +GAES HNL YWRYGDY GIGPGAH R       VA +  K PE+W+  V +NGH +  +
Sbjct: 251 IGAESRHNLTYWRYGDYAGIGPGAHGR----REGVATARRKKPENWMAAVDRNGHGIELE 306

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLA-GRNL-DIECERNLQRQGFIERVQFSRL 376
           E L+   +A E L+MGLRL EG+ ++    LA GR + D      L +QG + R    RL
Sbjct: 307 EALAPVARATEALVMGLRLTEGVDLRYVTALAKGREMVDAAQVERLAQQGLVRR-DGERL 365

Query: 377 RCTQRGMTMLDSVI 390
             T+ G  +LD+++
Sbjct: 366 IVTEAGALLLDAIL 379


>gi|254464716|ref|ZP_05078127.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacterales bacterium Y4I]
 gi|206685624|gb|EDZ46106.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacterales bacterium Y4I]
          Length = 384

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 177/379 (46%), Positives = 248/379 (65%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV   K+ Q  +++++L+E+  + +    R +++IF
Sbjct: 6   NGGFGLYVHWPFCQAKCPYCDFNSHVS-AKIDQTLWVRAYLSELDRLSEHFSGRVLNTIF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +A ++    + W  ++++EI++EANP SVE   F GYR AGVNR+S+
Sbjct: 65  FGGGTPSLMHPDTVAAVIARAREIWPFANDMEISLEANPGSVEAGRFAGYRDAGVNRVSM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L ++ LR LGR H+ +EA AA  +AR  F R+SFDLIY    QT+  W+ EL+ AL
Sbjct: 125 GIQALNDEDLRKLGRIHSVAEARAAFDIARECFDRVSFDLIYVRQGQTLEAWKAELKEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           S A+DHLSLYQLTIE GT F   +  G L  LP ++ A D+Y  TQ +T+AHG+  YEIS
Sbjct: 185 SMAIDHLSLYQLTIEDGTAFGDRYARGKLRGLPEDDTAADMYLATQDLTAAHGMACYEIS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWRYGDY GIGPGAH R+ +G  R A      P +WL+   K G+ 
Sbjct: 245 NHARPGAESRHNLIYWRYGDYAGIGPGAHGRLTLGGVRYATETHLAPGAWLQAA-KAGNG 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +  L+ E  A E+LMMG+RL EG+ +  +  L+GR+L      +L   G +  +   
Sbjct: 304 ESLRVPLTREDAAAEYLMMGMRLSEGLDMVRFSQLSGRHLPESKLNDLVDLGMVT-ISEK 362

Query: 375 RLRCTQRGMTMLDSVIANL 393
           RLR T +G  +L++V+ +L
Sbjct: 363 RLRATAQGRAVLNAVLRDL 381


>gi|159046000|ref|YP_001534794.1| coproporphyrinogen III oxidase [Dinoroseobacter shibae DFL 12]
 gi|157913760|gb|ABV95193.1| oxygen-independent coproporphyrinogen III oxidase [Dinoroseobacter
           shibae DFL 12]
          Length = 387

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 243/376 (64%), Gaps = 3/376 (0%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHVR  +V Q  +  +FL+E+      T  R + ++FFGG
Sbjct: 9   FGLYLHWPFCAAKCPYCDFNSHVR-ARVDQAAWENAFLSEIGRAGIETEGRRLDTVFFGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP  +A I+D I + W  S+++EIT+EANP+SVE   F+ YR AGVNR+S+G+Q
Sbjct: 68  GTPSLMEPDLVASIIDRIRRTWPTSNSLEITLEANPTSVEAGRFRAYRDAGVNRVSMGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  L+ LGR H+  EA +A  +A+  F R+SFDLIYA   QT+  W  EL+ ALS A
Sbjct: 128 ALNDADLKALGRLHSVKEAQSAFEVAQAHFERVSFDLIYARQGQTLEAWIAELRAALSMA 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +DHLSLYQLT+E GT F      G L  LP  ++  D++  TQ + S  G+ AYE+SNH+
Sbjct: 188 IDHLSLYQLTVEPGTAFGDRAARGMLRGLPDGDLGADMFEATQDLCSDAGMPAYEVSNHA 247

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YWRYGDY+GIGPGAH R+ +   + A S   HPE+WL  V+ +GH    
Sbjct: 248 AEGCESRHNLIYWRYGDYVGIGPGAHGRLTLSGQKWATSTPLHPEAWLAQVQDSGHGETP 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           ++ L+  + ++E L+MGLRL EG+S+     +AG  L       LQ    I RV   RLR
Sbjct: 308 RQLLTPNEISEELLLMGLRLSEGVSLNRITAIAGAPLPERKLSELQEAQLI-RVDGDRLR 366

Query: 378 CTQRGMTMLDSVIANL 393
            T +G  +L++++  L
Sbjct: 367 TTLQGRMVLNAILREL 382


>gi|83953081|ref|ZP_00961803.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
 gi|83842049|gb|EAP81217.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 247/376 (65%), Gaps = 4/376 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV R  + Q  +  ++L E++     T  R ++++FFGG
Sbjct: 10  FGLYIHWPFCEAKCPYCDFNSHVSR-TIDQRAWRDAYLAELERGAAETQGRVLNAVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +A ++  I + W  ++++EIT+EANP SVE + F  +R+AGVNRIS+G+Q
Sbjct: 69  GTPSLMDPDVVADVIAAIRRLWPTANDLEITLEANPGSVEADRFAAFRQAGVNRISMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L    L+ LGR H   E +AA  +ARN F R+SFDLIY    Q++  W+ EL++ALS A
Sbjct: 129 ALNVADLKRLGRIHTVDEGLAAFDIARNTFERVSFDLIYGRQNQSLPDWKAELKQALSLA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +DH+SLYQLTIE+GT F   +  G L  LPS+++  D+Y  TQ I    G+ +YE+SNH+
Sbjct: 189 IDHMSLYQLTIEQGTAFGDRYAVGKLRGLPSDDLGADMYAATQDICGEMGMPSYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GA+S HNL YWRYGDY+GIGPGAH R+    +R A     +P+ WL     +G     
Sbjct: 249 RDGAQSRHNLIYWRYGDYLGIGPGAHGRLTQNGNRFATECFSNPKRWLDAA-ASGATEKP 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +E L++E Q  EFLMMGLRL+EG+ ++ +E L+G  L  +    +Q  G I R +  +L 
Sbjct: 308 RELLTTEDQGSEFLMMGLRLKEGVDLRRYEALSGAPLSTKKITQMQDIGMISRDK-DQLY 366

Query: 378 CTQRGMTMLDSVIANL 393
            T +G  +L++++A L
Sbjct: 367 VTDQGFMVLNAILAEL 382


>gi|148260690|ref|YP_001234817.1| coproporphyrinogen III oxidase [Acidiphilium cryptum JF-5]
 gi|146402371|gb|ABQ30898.1| coproporphyrinogen III oxidase, anaerobic [Acidiphilium cryptum
           JF-5]
          Length = 382

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 175/381 (45%), Positives = 240/381 (62%), Gaps = 6/381 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFC  KCPYCDFNSHVR  ++ +   + + L E+ +     GPR ++SIFF
Sbjct: 2   TPLALYIHWPFCKAKCPYCDFNSHVRE-RIPERRIVAALLAELDFEAARLGPRRLTSIFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P+ ++ ++    + +  + ++EIT+EANP+S+E   F+ YR+AGVNR+S+G
Sbjct: 61  GGGTPSLMAPEGVSALIARACRLFAPAPDLEITLEANPTSIEAGRFRAYREAGVNRVSIG 120

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQSL + +LRFLGR H A+EA+AA+ L R IFPR+SFDLIYA P QT+  W  EL  AL+
Sbjct: 121 VQSLNDDALRFLGREHGAAEAMAAVELGRAIFPRLSFDLIYARPGQTLAAWRAELGAALA 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             +DHLSLYQLTIE GT F   H  GD  LP ++ A  LY+ T    +  GL  YEISN+
Sbjct: 181 VGLDHLSLYQLTIEPGTRFATAHARGDFALPEDDDAAALYDATAEEAARFGLGPYEISNY 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRY DY GIG GAH R+ +G   +A    + PE W   V   GH   
Sbjct: 241 AKPGEESRHNLAYWRYRDYAGIGAGAHGRISLGGTLLATRRHRAPEEWAARVEAAGHGST 300

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
           E+  + ++++A E L+MGLRL EGI    +    GR+    LD +        G+++ V 
Sbjct: 301 EEIEIGADERAREALLMGLRLAEGIDRDAYAARTGRDLMDMLDPDVTAQAIEAGYLD-VT 359

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
            +R+  T  G   LDS++A L
Sbjct: 360 PARVSATYEGRKRLDSLLAAL 380


>gi|326403884|ref|YP_004283966.1| putative coproporphyrinogen III oxidase [Acidiphilium multivorum
           AIU301]
 gi|325050746|dbj|BAJ81084.1| putative coproporphyrinogen III oxidase [Acidiphilium multivorum
           AIU301]
          Length = 382

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 175/381 (45%), Positives = 241/381 (63%), Gaps = 6/381 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFC  KCPYCDFNSHVR  ++ +   + + L E+ +     GPR ++SIFF
Sbjct: 2   TPLALYIHWPFCKAKCPYCDFNSHVRE-RIPERRIVAALLAELDFEAARLGPRRLTSIFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P++++ ++    + +  + ++EIT+EANP+S+E   F+ YR+AGVNR+S+G
Sbjct: 61  GGGTPSLMAPESVSALIARSCRLFAPAPDLEITLEANPTSIEAGRFRAYREAGVNRVSIG 120

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQSL + +LRFLGR H A+EA+AA+ L R IFPR+SFDLIYA P QT+  W  EL  AL+
Sbjct: 121 VQSLNDDALRFLGREHGAAEAMAAVELGRAIFPRLSFDLIYARPGQTLAAWRAELGAALA 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             +DHLSLYQLTIE GT F   H  GD  LP ++ A  LY+ T    +  GL  YEISN+
Sbjct: 181 VGLDHLSLYQLTIEPGTRFATAHARGDFALPEDDDAAALYDATAEEAARFGLGPYEISNY 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRY DY GIG GAH R+ +G   +A    + PE W   V   GH   
Sbjct: 241 AKPGEESRHNLAYWRYRDYAGIGAGAHGRISLGETLLATRRHRAPEEWAARVEAAGHGST 300

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
           E+  + ++++A E L+MGLRL EGI    +    GR+    LD +        G+++ V 
Sbjct: 301 EEIEIGADERAREALLMGLRLAEGIDRDAYAARTGRDLMDMLDPDVTAQAIEAGYLD-VT 359

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
            +R+  T  G   LDS++A L
Sbjct: 360 PARVSATYEGRKRLDSLLAAL 380


>gi|126463645|ref|YP_001044759.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105309|gb|ABN77987.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 385

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 241/380 (63%), Gaps = 3/380 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+F
Sbjct: 6   NGGFGLYLHWPFCQSKCPYCDFNSHVA-ATIDQGRWQRAYLSEIRRLGTETEGRVLNSVF 64

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVE   F+GYR AGVNRIS+
Sbjct: 65  FGGGTPSLMEPDLVAAILETVRTTWPLANDLEVTLEANPGSVEAGRFRGYRAAGVNRISM 124

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +  LR LGR H  +EA AA  +A   F R+SFDLIYA   Q +  W  EL  AL
Sbjct: 125 GIQALNDADLRKLGRLHTVAEARAAFDVAHTTFDRVSFDLIYARQDQPLEHWRSELTEAL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           + A DHLS+YQLT+E GT F    K G L  LP E ++ D+Y LTQ +  A GL AYE+S
Sbjct: 185 TMAADHLSMYQLTVEDGTAFGDRFKRGKLRGLPEEELSADMYALTQDLCEAAGLPAYEVS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWR GDY G+GPGAH R+   + R A    + P +WL+ V ++G  
Sbjct: 245 NHARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPRAPGAWLERVERDGTG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +  L +E  A E+LMM LRLREG+       LAGR LD     +L+  G I+     
Sbjct: 305 EGPRVRLDAEDHALEYLMMSLRLREGLDRGRHAALAGRPLDERRVADLREMGMID-TDDE 363

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           R+  T  G  +L+SVI  LA
Sbjct: 364 RIFATTEGRMVLNSVITALA 383


>gi|126730099|ref|ZP_01745911.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
 gi|126709479|gb|EBA08533.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
          Length = 385

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 239/378 (63%), Gaps = 3/378 (0%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+YVHWPFC  KCPYCDFNSHV R ++ Q  +  +  +E++ +   T  R + SIFF
Sbjct: 8   GGFGLYVHWPFCEAKCPYCDFNSHVVR-EIDQTRWAAALASEVRRVAAETSGRVLGSIFF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P+ +A ++D     WT  +N+EIT+EANP SVE   F+GY +AGVNR+SLG
Sbjct: 67  GGGTPSLMAPETVAAVIDAARDGWTFGNNIEITLEANPRSVEAARFEGYARAGVNRVSLG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQSL E  LR LGR H+ +EA AA  +AR +F R+SFDLIYA   QT+  WE EL  AL 
Sbjct: 127 VQSLREPDLRKLGRLHDVTEARAAFAIARQVFDRVSFDLIYARQGQTLAGWEEELGEALD 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            AVDHLSLYQLTIE GT F+   + G L  LPS+++  D+Y LTQ + +  G+ AYE+SN
Sbjct: 187 MAVDHLSLYQLTIEPGTAFWDRSQAGKLRGLPSDDLGADMYELTQEMCARAGMPAYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+   AES HNL YWRYGD++G+GPGAH R  +   R+     + P  WL  V +     
Sbjct: 247 HAGADAESRHNLVYWRYGDWVGVGPGAHGRFDLNRQRMESVAWRMPGRWLTAVEEVKSGD 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
             +  +    QA E+LMMGLRL EG+ +     ++     ++  ++LQ    +E V   R
Sbjct: 307 ELRSSVDGNDQAIEYLMMGLRLSEGLDLARLHQMSRNVATLKQIKDLQEMQLLE-VYSGR 365

Query: 376 LRCTQRGMTMLDSVIANL 393
           L  T RG  +L+SVI +L
Sbjct: 366 LVATPRGRLVLNSVIESL 383


>gi|163732968|ref|ZP_02140412.1| coproporphyrinogen III oxidase [Roseobacter litoralis Och 149]
 gi|161393503|gb|EDQ17828.1| coproporphyrinogen III oxidase [Roseobacter litoralis Och 149]
          Length = 385

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/376 (46%), Positives = 242/376 (64%), Gaps = 4/376 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWP+C  KCPYCDFNSHV R ++ Q  +  ++L E++     T  R + S+FFGG
Sbjct: 10  FGLYIHWPYCEAKCPYCDFNSHVVR-QIDQAAWRDAYLVELRRAAAETRGRVLRSVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +A ++  I   W V++++EIT+EANPSSVE   F  +R+ G+ RIS+G+Q
Sbjct: 69  GTPSLMDPDTVADVIREIRALWPVANDLEITLEANPSSVEAGRFAAFREGGITRISMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LR LGR H   EA  A  +AR+ F R+SFDLIYA   Q++  WE EL++AL  A
Sbjct: 129 ALNDDDLRRLGRIHTVKEAQTAFDIARSTFERVSFDLIYARQGQSLQAWEQELKQALDMA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE+GT F   +  G L  LP E+++ DLY LTQ +  + G+  YE+SNH+
Sbjct: 189 VDHLSLYQLTIEQGTAFGDRYNAGKLRDLPDEDLSADLYTLTQDLCGSAGMPGYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GA+S HNL YWRYGDY+GIGPGAH R+     R A     +P  WL  V     A   
Sbjct: 249 RDGAQSRHNLIYWRYGDYLGIGPGAHGRLTANRQRWATECHSNPNRWLNSV-TGKDAEKP 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +  L+S+ QA EFL+MGLRL+EGI    +E L+G+ LD     +L   G I   + +RL 
Sbjct: 308 RAALTSQDQASEFLLMGLRLKEGIDKNRYETLSGKPLDANAISDLVNLGMISDSE-NRLV 366

Query: 378 CTQRGMTMLDSVIANL 393
              +G  +L++VI+ L
Sbjct: 367 VLDQGFIVLNAVISRL 382


>gi|114326692|ref|YP_743849.1| coproporphyrinogen III oxidase [Granulibacter bethesdensis CGDNIH1]
 gi|114314866|gb|ABI60926.1| oxygen-independent coproporphyrinogen-III oxidase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 394

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 160/340 (47%), Positives = 227/340 (66%), Gaps = 1/340 (0%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +  L +Y+HWPFC+ KCPYCDFNSHVR  ++ Q  F  +   E+ W     G R ++S+F
Sbjct: 13  TEPLALYIHWPFCLSKCPYCDFNSHVRD-EIPQARFAAALRAELAWEASRLGRRPLASVF 71

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+ +A +++   + +    ++EIT+EANP+SVE   F+ +R+AGVNR+SL
Sbjct: 72  FGGGTPSLMAPETVAALIEEATRYFPPCDDLEITLEANPTSVEAGRFRAFRQAGVNRVSL 131

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QSL +++L+ LGR H+A +A+AA+ LA  IFPR+SFDLIYA P QT+  W  EL++AL
Sbjct: 132 GIQSLHDEALKGLGRQHDAGQAMAALELAHTIFPRLSFDLIYARPGQTVAAWRQELRQAL 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S A DHLSLYQLTIE GT +    + G+++LPS+  A +LY +T    +  G+ AYE+SN
Sbjct: 192 SLAGDHLSLYQLTIEPGTAYEASFRRGEIILPSDEQAAELYEVTGEEAAQFGMTAYEVSN 251

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  GAES HNL YWRY DY GIGPGAH RV       A    + PE W ++V + GH  
Sbjct: 252 YARSGAESRHNLAYWRYADYAGIGPGAHGRVSHSGSLFATRRHRAPEPWAELVERQGHGS 311

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
             +E +  +++A E L+MGLR+ +GI    +    G  L+
Sbjct: 312 TLEEEVEPQERAREMLLMGLRITDGIDEARFRQRTGLTLE 351


>gi|149912894|ref|ZP_01901428.1| coproporphyrinogen III oxidase [Roseobacter sp. AzwK-3b]
 gi|149813300|gb|EDM73126.1| coproporphyrinogen III oxidase [Roseobacter sp. AzwK-3b]
          Length = 385

 Score =  352 bits (904), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 178/380 (46%), Positives = 247/380 (65%), Gaps = 4/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+Y+HWPFC  KCPYCDFNS V R  + Q  +++++L E+     +   R ++S+F 
Sbjct: 8   GGFGLYLHWPFCEAKCPYCDFNSQVSR-DIDQSRWLRAYLHEIDRYAGMLPGRVLNSVFL 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL++P  +A IL+ + ++W  ++++E+T+EANP SVE   F+GY +AGV+R+S+G
Sbjct: 67  GGGTPSLMDPDVVAAILERVRQSWPQANDLEVTLEANPGSVEARRFRGYAEAGVSRVSMG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L ++ LR LGR H+ +EA  A  +AR  F R+SFDLIYA   QT+  W  EL  AL 
Sbjct: 127 IQALNDEDLRRLGRIHSLAEARQAHDIARKNFDRVSFDLIYARQDQTVEAWRAELGEALE 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            AVDHLSLYQLTIE+GT F   +  G L  LP+E+ A D+Y  TQ I +  G+ AYE+SN
Sbjct: 187 MAVDHLSLYQLTIEQGTAFADRYARGGLKGLPAEDAAADMYEATQEICAGAGMDAYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYGDY+GIGPGAH RV +   R A     +P+ WL  V   G + 
Sbjct: 247 HAKPGAESRHNLIYWRYGDYVGIGPGAHGRVTLDGQRHATEAWSNPDRWLSAV-DAGQSE 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
              E +  + QA E+LMMGLR+REGI V  +E +AG  L  E    L+  G IE     R
Sbjct: 306 KSCEAIDPKDQAAEYLMMGLRIREGIDVVRYEAMAGEALSEEKLIELRELGMIES-NGQR 364

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           +  T++G  +L++V+ +L V
Sbjct: 365 VWVTEQGRPVLNAVLRDLLV 384


>gi|260576114|ref|ZP_05844107.1| oxygen-independent coproporphyrinogen III oxidase [Rhodobacter sp.
           SW2]
 gi|259021594|gb|EEW24897.1| oxygen-independent coproporphyrinogen III oxidase [Rhodobacter sp.
           SW2]
          Length = 385

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 173/378 (45%), Positives = 242/378 (64%), Gaps = 3/378 (0%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV   ++ Q+ + +++L+E+  +   T  R ++S++FGG
Sbjct: 9   FGLYLHWPFCQSKCPYCDFNSHVS-TRIDQDRWQRAYLSEISRVGAETQGRLLNSVYFGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ ++ IL  +   WT++++ EIT+EANP SVE   F+GYR AGVNR+S+G+Q
Sbjct: 68  GTPSLMRPELVSAILARVRATWTLANDCEITLEANPGSVEAGRFRGYRDAGVNRVSMGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LR LGR H+ +EA AA  +AR  F R+SFDLIYA   QT+  W+ EL  AL+ A
Sbjct: 128 ALADGDLRALGRAHSVAEARAAFDVARTTFDRVSFDLIYARQNQTLKNWQKELSDALTMA 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            DH+SLYQLT+E GT F      G L  LP E ++ D Y  TQ I  A G+ AYE+SNH+
Sbjct: 188 ADHISLYQLTVEDGTAFGDRLAHGKLRGLPGEELSADFYAATQEICGAAGMDAYEVSNHA 247

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G+ES HNL YWR GDY+GIGPGAH R+     R A    + P +WL  V   G+    
Sbjct: 248 KTGSESRHNLIYWRAGDYVGIGPGAHGRLSQNDDRWATEGLRAPGAWLSKVESEGNGEAL 307

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +E L    +A E+LMM LRLREG+S+  +   AG  +  +   +L   G I  V  +++R
Sbjct: 308 REILRPADRAAEYLMMSLRLREGMSLPRYSSFAGDRISPQKLADLVEIGMIS-VATNQIR 366

Query: 378 CTQRGMTMLDSVIANLAV 395
            T  G  +L+++IA L+ 
Sbjct: 367 ATDAGRMVLNTLIAELSA 384


>gi|312114384|ref|YP_004011980.1| oxygen-independent coproporphyrinogen III oxidase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219513|gb|ADP70881.1| oxygen-independent coproporphyrinogen III oxidase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 386

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 174/373 (46%), Positives = 235/373 (63%), Gaps = 3/373 (0%)

Query: 23  VHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPS 82
           +HWPFC KKCPYCDFNSH  R  + +  ++ + L E++     T  + ++S+FFGGGTPS
Sbjct: 1   MHWPFCEKKCPYCDFNSHAAR-SIDEARWLAAILRELETYACETARQPVASVFFGGGTPS 59

Query: 83  LIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEE 142
           L++ ++   +LD IA  W +S   EIT+EANPSSVE   F GYR AGVNRISLG+QSL +
Sbjct: 60  LMQARSAGAVLDRIAALWPISETCEITLEANPSSVEAGRFAGYRAAGVNRISLGIQSLHD 119

Query: 143 QSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHL 202
            +L+ LGR H+A+EA AA+ +A   F RMSFDLIYA P QT+  W  EL  ALS A  HL
Sbjct: 120 DALKALGRIHDAAEARAALDIAARTFDRMSFDLIYARPGQTLDAWHAELTEALSLARGHL 179

Query: 203 SLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAE 262
           SLYQLTIE  T F+ + + G L LP   +A + Y LTQ +  A GL AYE+SNH+  G E
Sbjct: 180 SLYQLTIEPETAFFALQRRGRLRLPEAELAAEFYTLTQKLCQATGLPAYEVSNHAAPGEE 239

Query: 263 SLHNLNYWRYGDYIGIGPGAHSRVKVGSHR-VAISIEKHPESWLKMVRKNGHAVVEKEFL 321
           S HNL YWRYGDY+G+GPGAH R +  + R +A +  K P +W + V   GH   E+  L
Sbjct: 240 SRHNLAYWRYGDYVGVGPGAHGRYRGAAGRKIATAALKSPLAWAEKVEALGHGREERVEL 299

Query: 322 SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQR 381
            +  +A+E ++MGLR+ EG+ V+  E   G          L+ +  IE     R+  T  
Sbjct: 300 GAHDEAEEAVLMGLRISEGLDVRRLEARTGFRPAASVVTMLESERLIEGAD-GRISTTGA 358

Query: 382 GMTMLDSVIANLA 394
           G  +L++V+  +A
Sbjct: 359 GRLVLNAVVEAVA 371


>gi|85706898|ref|ZP_01037988.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
 gi|85668509|gb|EAQ23380.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
          Length = 396

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 243/378 (64%), Gaps = 4/378 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+YVHWPFC  KCPYCDFNSHV R ++ Q  +  ++L E+     L   R ++++FF
Sbjct: 18  GGFGLYVHWPFCEAKCPYCDFNSHVAR-EIDQTRWCTAYLAEIDRYAALVPGRVLNTVFF 76

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P+ IA +++ I  +W +++  EIT+EANP SVE   F+ + +AGV RIS+G
Sbjct: 77  GGGTPSLMAPETIAALIERIKASWPMANAPEITLEANPGSVEAGRFRAFAEAGVTRISMG 136

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQ+L +  L+ LGR H+ +EA  A  +AR  F R+SFDLIYA   QT+  W+ EL+ AL+
Sbjct: 137 VQALNDIDLKRLGRIHSVAEARQAFDIARENFDRVSFDLIYARQDQTLEAWKAELREALA 196

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            AVDHLSLYQLTIE GT F   +  G L  LP +  A D+Y  TQ I  A GL AYE+SN
Sbjct: 197 MAVDHLSLYQLTIETGTAFGDRYAAGKLRGLPEDETAADMYEATQEICDAAGLPAYEVSN 256

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G+ES HNL YWRYGDYIGIGPGAH R+     + A    + P  WL  V +   + 
Sbjct: 257 HARPGSESRHNLIYWRYGDYIGIGPGAHGRITRNGQKHATEAHRAPGRWLDSV-ETASSE 315

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
            +   LS + QA E+L+MGLR+ +GI    +E LAG+ L      +LQ+ G IE +  +R
Sbjct: 316 RKPVRLSGQDQAVEYLLMGLRISDGIDPGRFEKLAGQPLSPTVVDHLQQIGMIESLG-TR 374

Query: 376 LRCTQRGMTMLDSVIANL 393
           LR T+ G  +L++VI +L
Sbjct: 375 LRATRAGRAVLNAVIRDL 392


>gi|241762328|ref|ZP_04760408.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|241373122|gb|EER62761.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 393

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 177/381 (46%), Positives = 247/381 (64%), Gaps = 10/381 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+HWPFC+ KCPYCDFNSHVR   +    +  + L++M     LT  R +SSIFFGG
Sbjct: 19  LALYIHWPFCLAKCPYCDFNSHVRP-DIDAALWQDALLSDMAHEAALTQGRRLSSIFFGG 77

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +A ++D   + W  + ++EIT+EANPSSVE + FQ    AGVNR+SLG+Q
Sbjct: 78  GTPSLMPPETVAALIDAATRYWQPTPDIEITLEANPSSVEADRFQSLALAGVNRLSLGIQ 137

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ SL FLGR HN  EA++A+ +A+  F R+SFDLIY  P Q++  WE EL++AL++ 
Sbjct: 138 ALDDTSLHFLGRIHNVQEALSALDIAQKNFSRVSFDLIYGRPNQSLKDWEEELKQALAFG 197

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT F+ + + G       + A DL++LT+ +T A G+ AYEISNH+ 
Sbjct: 198 SDHLSLYQLTIEEGTRFHSLVRQGQFTPMDGDKAADLFDLTRDMTKAAGIPAYEISNHAR 257

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
             +ES HNL YWRYGDYIGIG GAH R     + V I   K PE+WL  V+K    + E+
Sbjct: 258 KNSESRHNLTYWRYGDYIGIGAGAHGRRL---NNVTIR-HKKPENWLSAVQKQQQGIQEE 313

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQFS 374
             LS + QA E ++MGLRL EGI  K+ +   G +    LDI   +    QG +      
Sbjct: 314 TPLSPKDQAIEAVLMGLRLTEGIDPKNIQKRTGLDISEFLDIAAIQYYSDQGLLT-FNNG 372

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            LR T++G  + D++I  +++
Sbjct: 373 LLRITEQGALLTDALIREISL 393


>gi|87200079|ref|YP_497336.1| coproporphyrinogen III oxidase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135760|gb|ABD26502.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 384

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 249/379 (65%), Gaps = 10/379 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVHWPFC+ KCPYCDFNSHVR  +     +  + L +M+   +LT  R +SSIFFGG
Sbjct: 4   LALYVHWPFCLAKCPYCDFNSHVR-ARTDIAAWQAALLADMRHEARLTPGRPLSSIFFGG 62

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +  +L    + W  +  +EIT+EANPSSVE  NF     AG+NR+SLG+Q
Sbjct: 63  GTPSLMPPALVEALLAEAERLWGFAPGIEITLEANPSSVEAANFAALSSAGINRVSLGLQ 122

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ +L+FLGR H+ SE++AA+ LA+  F R+SFDLIYA P QT  QWE EL+RAL + 
Sbjct: 123 ALDDNTLKFLGRLHDVSESLAALDLAQTHFGRVSFDLIYARPGQTPAQWEAELKRALGFG 182

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLSLYQLTIE GT F  + ++G L    ++ A DL+ LT+ +TSA  L AYE SNH+ 
Sbjct: 183 TGHLSLYQLTIEPGTRFATLVREGKLAPLDDDEAADLFALTRELTSAASLPAYETSNHAR 242

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YWRY DYIGIGPGAH R ++G+  V     K PE++L+ V ++G  +VE+
Sbjct: 243 PGEESRHNLTYWRYQDYIGIGPGAHGR-RLGAATVR---HKKPENFLRAVSEHGQGIVEE 298

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER----NLQRQGFIERVQFS 374
             L+  +QA E ++MGLRL EGIS        G   D   +R    +  R G++   + +
Sbjct: 299 RQLTPSEQAIEAVLMGLRLAEGISPPALAARFGFAEDEMIDRRNRESFARMGYLNDTE-T 357

Query: 375 RLRCTQRGMTMLDSVIANL 393
            L+ T++G  +L++++A+L
Sbjct: 358 CLKVTEQGAPVLEALLADL 376


>gi|260753400|ref|YP_003226293.1| coproporphyrinogen III oxidase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552763|gb|ACV75709.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 393

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 177/381 (46%), Positives = 249/381 (65%), Gaps = 10/381 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+HWPFC+ KCPYCDFNSHVR   +    +  + L++M     LT  R +SSIFFGG
Sbjct: 19  LALYIHWPFCLAKCPYCDFNSHVRP-DIDAALWQDALLSDMAHEAALTQGRRLSSIFFGG 77

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +A ++D   + W  +S++EIT+EANPSSVE + FQ    AGVNR+SLG+Q
Sbjct: 78  GTPSLMSPETVAALIDAATRYWQPTSDIEITLEANPSSVEADRFQSLALAGVNRLSLGIQ 137

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ SL FLGR HN  EA++A+ +A+  F R+SFDLIY  P Q++  WE EL++AL++ 
Sbjct: 138 ALDDTSLHFLGRIHNVQEALSALDIAQKNFSRVSFDLIYGRPNQSLKDWEEELKQALAFG 197

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT F+ + + G       + A DL++LT+ +T A G+ AYEISNH+ 
Sbjct: 198 SDHLSLYQLTIEEGTRFHSLVRQGQFTPMDGDKAADLFDLTRDMTKAAGIPAYEISNHAR 257

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
             +ES HNL YWRYGDYIGIG GAH R     + V I   K PE+WL  V+K    + E+
Sbjct: 258 KNSESRHNLTYWRYGDYIGIGAGAHGRRL---NNVTIR-HKKPENWLSAVQKQQQGIQEE 313

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQFS 374
             LS + QA E ++MGLRL EGI  ++ +   G +    LDI   +    QG +      
Sbjct: 314 TPLSPKDQAIEAVLMGLRLTEGIHPENIQKRTGLDISEFLDIAAIQYYSDQGLLT-FNNG 372

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            LR T++G+ + D++I  +++
Sbjct: 373 LLRITEQGVLLTDALIREISL 393


>gi|85374027|ref|YP_458089.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
 gi|84787110|gb|ABC63292.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
          Length = 383

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 241/382 (63%), Gaps = 20/382 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +Y+HWPFC KKCPYCDFNSHVR   V    + ++ L +M++     G  +++SIFFGGGT
Sbjct: 5   LYIHWPFCAKKCPYCDFNSHVR-ASVDHALWERAMLADMRYEAGKAGGEALTSIFFGGGT 63

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL+ P  +A +L    + W  + ++EIT+EANPSSVE  NF     AGVNR+SLGVQSL
Sbjct: 64  PSLMPPALVASLLQQAERLWGFAPDIEITLEANPSSVETANFHALAAAGVNRVSLGVQSL 123

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           ++ +LRFLGR H   EA+ A+  A+  F R+SFDLIYALP QT + W   L+RALS+   
Sbjct: 124 DDAALRFLGRLHGVEEALTALETAQKAFQRVSFDLIYALPDQTESDWRAGLERALSFGTS 183

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           HLSLYQLTIE GT F    + G     +++ A DLY +TQ++T++ GL AYEISNH+  G
Sbjct: 184 HLSLYQLTIEPGTRFATDVRRGVFDPLADDPAADLYTVTQAVTASAGLPAYEISNHARPG 243

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRKNGHAVVEK 318
            ES HNL YWRY DY GIGPGAH R      R   +  +H  PE+WL  V + G    E+
Sbjct: 244 EESRHNLTYWRYHDYCGIGPGAHGR------RGGFATLRHKKPENWLAAVDECGSGAQEE 297

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR------NLDIECERNLQRQ-GFIERV 371
             LS  +QA E L+MGLRL  G+   D E L+ R      +L    +R L  Q G IE V
Sbjct: 298 RRLSPAEQASEALVMGLRLAAGV---DLETLSARFGIGEVSLIDPDKRQLYSQLGLIEHV 354

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
              RLR T +GM +LD+++  L
Sbjct: 355 N-ERLRVTAKGMPLLDALLGEL 375


>gi|310817158|ref|YP_003965122.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
 gi|308755893|gb|ADO43822.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
          Length = 390

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 178/373 (47%), Positives = 240/373 (64%), Gaps = 4/373 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC+ KCPYCDFNSHV ++ + Q  +  ++  E+  +   T  R ++S+FFGG
Sbjct: 15  FGLYIHWPFCMAKCPYCDFNSHVAQH-IDQSRWAAAYEVEIDRIAAETEGRVLNSVFFGG 73

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +  +L  +   W+++++VEIT+EANP+SVE   F GYR AGVNRIS+GVQ
Sbjct: 74  GTPSLMLPETVDRVLSRVRARWSLANDVEITLEANPTSVEAGRFHGYRDAGVNRISMGVQ 133

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           SL E+ L+ LGR H+ +EA AA  +AR++F R+SFDLIYA   QT   W  EL  ALS A
Sbjct: 134 SLNERDLKALGRMHSVTEARAAFDIARDVFDRVSFDLIYARQHQTPEDWRAELSEALSMA 193

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE  T F   +  G L  LP E+ A +++++TQ +    G  AYEISNH+
Sbjct: 194 VDHLSLYQLTIEPNTAFGARYDRGLLRGLPDEDNADEMWDITQEVADRLGFPAYEISNHA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HN  YWRYGDY GIGPGAH R+ +   R A      P  WL+ V K G +   
Sbjct: 254 RAGAESRHNSVYWRYGDYAGIGPGAHGRLTLNGQRYATETPLAPGRWLEDVEKTGKSETV 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +  L+   Q +EF+MMGLRL EGIS      L G  L    +R ++  G +E+V  S LR
Sbjct: 314 RAALTPTDQLEEFVMMGLRLSEGISKARLYRLGGARLQANIDRVIE-IGMLEQVGDS-LR 371

Query: 378 CTQRGMTMLDSVI 390
            T  G  +L++++
Sbjct: 372 TTTAGRPVLNAIL 384


>gi|83594968|ref|YP_428720.1| coproporphyrinogen III oxidase [Rhodospirillum rubrum ATCC 11170]
 gi|83577882|gb|ABC24433.1| coproporphyrinogen III oxidase, anaerobic [Rhodospirillum rubrum
           ATCC 11170]
          Length = 414

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 231/379 (60%), Gaps = 9/379 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS--I 71
           QG    GVYVHWPFC+ KCPYCDFNSHV    + Q  + Q  L +++       PR   +
Sbjct: 19  QGDEGFGVYVHWPFCLSKCPYCDFNSHVAAAPLDQAAWRQGLLRDLETQAGALPPRQRRL 78

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           +S+FFGGGTPSL++P  +  ++D     W V+ ++EIT+EANP +VE   F  +R+AGV 
Sbjct: 79  TSVFFGGGTPSLMDPATVGAVIDKALALWPVADDLEITLEANPGTVERGRFADFRQAGVT 138

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQSLE+++LRFLGR H+A+ A+AA+  AR +F R SFDLIYA P QT+  WE EL
Sbjct: 139 RLSLGVQSLEDEALRFLGRRHDAAGALAALETARALFERFSFDLIYARPGQTLDAWEDEL 198

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            RA++    HLS+YQLTIE GT F+  H  G  VLP E++   L+ LT+   +  GL AY
Sbjct: 199 ARAVALGPSHLSVYQLTIEAGTRFFAEHARGAFVLPDEDLGAALFELTRQRLTEAGLPAY 258

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS---IEKHPESWLKMV 308
           E+SNH+  G ES HNL YWR G+Y+G+GPGAH R+   +   A       + PE WL+ V
Sbjct: 259 EVSNHARPGEESRHNLIYWRGGEYLGVGPGAHGRLTSATDEGAFQATVAHRAPEVWLRHV 318

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQR 364
            + GH +     +   Q+A+E +MMGLRL EG+  +    L G      LD         
Sbjct: 319 SQQGHGLKSTTAIDRRQRAEEMVMMGLRLEEGLVEERLLRLTGLGFAEVLDAGGLAMASE 378

Query: 365 QGFIERVQFSRLRCTQRGM 383
           +G + R     LR T  GM
Sbjct: 379 EGLLHRPAPGVLRATGAGM 397


>gi|294012807|ref|YP_003546267.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           japonicum UT26S]
 gi|292676137|dbj|BAI97655.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           japonicum UT26S]
          Length = 391

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 176/382 (46%), Positives = 244/382 (63%), Gaps = 16/382 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVHWPFCV KCPYCDFNSHVR  ++  + +  + L+++     L+G R +SSIFFGG
Sbjct: 16  LALYVHWPFCVSKCPYCDFNSHVR-AEIDNDAWRAALLSDLAHEAALSGGRPLSSIFFGG 74

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P  +  ++D   + W  ++++EIT+EANPSSVE   F     AGVNR+SLG+Q
Sbjct: 75  GTPSLMPPDIVEALIDAATRRWRPTNDIEITLEANPSSVEAARFADLAAAGVNRVSLGLQ 134

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +LE+++L FLGR H+  E +AA+ +A++ F R++FDLIYA P Q++T WE EL R LS+ 
Sbjct: 135 ALEDEALHFLGRAHDVREGLAALDVAQSAFGRVNFDLIYARPDQSLTDWESELARGLSFG 194

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLSLYQLTIE GT F  +   G L     + A DLY  TQ++T+A GL AYEISNH+ 
Sbjct: 195 TGHLSLYQLTIEPGTRFATLAAQGRLKPADPDHAADLYEATQAMTAAAGLPAYEISNHAR 254

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRKNGHAVV 316
            G ES HNL YWRYGDY+G+GPGAH R      R  ++  +H  PE+W+  V +NGH + 
Sbjct: 255 PGQESRHNLTYWRYGDYVGVGPGAHGR------RDGLATLRHRKPENWMNAVARNGHGLQ 308

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
            +E L    +A E L+MGLRL EG+ ++    L+       +D E    L   G +   Q
Sbjct: 309 GEEPLDGRDRAREALLMGLRLAEGVELERIARLSSLPVEDLVDAEAVARLAGHGLVR--Q 366

Query: 373 FSRLRCTQ-RGMTMLDSVIANL 393
             R  C +  GM +LD+++  +
Sbjct: 367 EGRGLCVEPAGMLLLDAILPEI 388


>gi|56550908|ref|YP_161747.1| coproporphyrinogen III oxidase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56542482|gb|AAV88636.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 393

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 176/381 (46%), Positives = 248/381 (65%), Gaps = 10/381 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+HWPFC+ KCPYCDFNSHVR   +    +  + L++M     LT  R +SSIFFGG
Sbjct: 19  LALYIHWPFCLAKCPYCDFNSHVRP-DIDAALWQDALLSDMAHEAALTQGRRLSSIFFGG 77

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ +A ++D   + W  +S++EIT+EANPSSVE + FQ    AGVNR+SLG+Q
Sbjct: 78  GTPSLMSPETVAALIDAATRYWQPTSDIEITLEANPSSVEADRFQSLALAGVNRLSLGIQ 137

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ SL FLGR HN  EA++A+ +A+  F R+SFDLIY  P Q++  WE EL++AL++ 
Sbjct: 138 ALDDTSLHFLGRIHNVQEALSALDIAQKNFSRVSFDLIYGRPNQSLKDWEEELKQALAFG 197

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT F+ + + G       + A DL++LT+ +T A G+ AYEISNH+ 
Sbjct: 198 SDHLSLYQLTIEEGTRFHSLVRQGQFTPMDGDKAADLFDLTRDMTKAAGIPAYEISNHAR 257

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
             +ES HNL YWRYGDYIGIG GAH R     + V I   K PE+WL  V+K    + E+
Sbjct: 258 KNSESRHNLTYWRYGDYIGIGAGAHGRRL---NNVTIR-HKKPENWLSAVQKQQQGIQEE 313

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQFS 374
             LS + QA E ++MGLRL EGI  ++ +   G +    LD+   +    QG +      
Sbjct: 314 TPLSPKDQAIEAVLMGLRLTEGIHSENIQKRTGLDISEFLDLAAIQYYSDQGLLT-FNNG 372

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            LR T +G+ + D++I  +++
Sbjct: 373 LLRITAQGVLLTDALIREISL 393


>gi|144897366|emb|CAM74230.1| oxygen-independent coproporphyrinogen III oxidase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 385

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 247/382 (64%), Gaps = 10/382 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S   GVYVHWPFC+ KCPYCDFNSH     + Q+ + ++ L E++          ++SIF
Sbjct: 7   SPGFGVYVHWPFCLSKCPYCDFNSHAAD-TIDQDRWRRALLAELEHFAARKPEAEVTSIF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P  IA ++D I + W     +EIT+EANPS+VE   F+ +R AG+NR+SL
Sbjct: 66  FGGGTPSLMDPATIAALIDRIHQLWPCDPLIEITLEANPSTVEAQRFRDFRAAGINRLSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +  L FLGR H+A+EA+AA+ +A   F R SFDLIYA P QTM  W+ EL +AL
Sbjct: 126 GVQALNDADLHFLGRRHDAAEALAALDVAAATFERFSFDLIYARPGQTMAAWQTELTQAL 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE+GT FY +H  G+  LP E++A DL+ LT+S+ +  GL AYEISN
Sbjct: 186 ALTGGHLSAYQLTIEEGTAFYPIHARGEFQLPDEDLAADLFALTRSMAAEAGLPAYEISN 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G ES HNL YWR GDY+GIGPGAH R+   +HR A    + P+ WL+ V  +GHA 
Sbjct: 246 HARPGQESRHNLTYWRGGDYVGIGPGAHGRL---NHR-ATRQHRAPDVWLRRVEAHGHAC 301

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL----DIECERNLQRQGFIERV 371
             +E L +  +A+E +MMGLRL EGI    +    G +L    D++   +L++ G + R 
Sbjct: 302 QGEEALDARTRAEELVMMGLRLNEGIHADHFRDQCGLDLWQVIDVQAHAHLEQDGLLRRT 361

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
               +  T+ G+ +L+S+   L
Sbjct: 362 AHG-IAATEAGLLVLNSLTGAL 382


>gi|296284091|ref|ZP_06862089.1| coproporphyrinogen III oxidase [Citromicrobium bathyomarinum JL354]
          Length = 387

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 178/382 (46%), Positives = 240/382 (62%), Gaps = 10/382 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           ++ L +Y+HWPFC+KKCPYCDFNSHVR   V  + +    L ++     LT  R + SIF
Sbjct: 4   ADDLALYIHWPFCLKKCPYCDFNSHVRD-DVDADAWQAGLLADLAHEHALTQGRRVGSIF 62

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P     +++   + W ++ + EIT+EANP+S E   F  +R AGVNR+SL
Sbjct: 63  FGGGTPSLMPPALAGSLIEQAQRLWGLAPDAEITLEANPTSYEAGKFADFRAAGVNRVSL 122

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL E++L FLGR H+A+EA+AA+  A+ +F R++FDLIYA P Q+   WE EL RAL
Sbjct: 123 GVQSLHEEALAFLGREHSAAEAMAAVESAQGLFGRVTFDLIYARPGQSAEAWEAELARAL 182

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++  +HLSLYQLTIE GT F      G L     + A DL+  TQ    A GL AYEISN
Sbjct: 183 AFGTEHLSLYQLTIEPGTGFAGAVARGRLTPMDPDEAADLFVQTQEQMRAAGLPAYEISN 242

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRY DY+GIGPGAH R       +A    K PE++L+ V +NGH +
Sbjct: 243 HARPGAQSHHNLTYWRYRDYVGIGPGAHGR----RGGMATIRHKKPEAFLRRVGENGHGI 298

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNL--QRQGFIERV 371
            E+  L  E+Q  E L+MGLRL EG+ +       G   D  ++ +R       GF+E +
Sbjct: 299 SEERALGREEQLSEALLMGLRLAEGLDLAALATRFGTTPDALVDADRAAFYADLGFVE-L 357

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
              RL  T +GM +LD+++A L
Sbjct: 358 DGDRLTITPQGMPLLDALLAEL 379


>gi|148553493|ref|YP_001261075.1| coproporphyrinogen III oxidase [Sphingomonas wittichii RW1]
 gi|148498683|gb|ABQ66937.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingomonas wittichii RW1]
          Length = 397

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 176/381 (46%), Positives = 237/381 (62%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFCV KCPYCDFNSHVR   V Q+ +  + L ++         R + SIFF
Sbjct: 20  GGLALYIHWPFCVSKCPYCDFNSHVRE-SVDQQAWRDALLRDLAHEAAALPGRRLGSIFF 78

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P  +A ++D   ++W  + ++EIT+EANPSSVE   F    +AG+NR+SLG
Sbjct: 79  GGGTPSLMPPATVAALIDAATRHWPAADDIEITLEANPSSVEAARFADLARAGINRVSLG 138

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L++  L +LGR H  +E +AA+  A+  F R+SFDLIYA P QT   W  EL RALS
Sbjct: 139 LQALDDAVLGWLGRAHGVTEGLAALDTAQTSFGRVSFDLIYARPGQTPEAWAAELGRALS 198

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLYQLTIE GT F      G+ V    +   +L+  T++ T+A GL AYEISNH
Sbjct: 199 FGTEHLSLYQLTIEPGTQFATRVAKGEFVPLDPDAGAELFEQTRAATAAAGLPAYEISNH 258

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYG+Y GIGPGAH R + G   V     K PE+WL  V  NGH + 
Sbjct: 259 ARPGAESRHNLTYWRYGNYAGIGPGAHGR-RDGRATVR---RKKPENWLARVEANGHGIE 314

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA----GRNLDIECERNLQRQGFIERVQ 372
            ++ L SE +A E L+MGLRL EG+ +     ++    GR +D      L RQG + R  
Sbjct: 315 REDDLPSEARAQEALLMGLRLAEGVDLARIAAMSGLPVGRLVDAIAIDRLARQGLLAR-D 373

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
             RL  +  GM +LD+++A +
Sbjct: 374 GDRLTVSDAGMLLLDAILAEI 394


>gi|255261580|ref|ZP_05340922.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thalassiobium sp. R2A62]
 gi|255103915|gb|EET46589.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thalassiobium sp. R2A62]
          Length = 386

 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 176/376 (46%), Positives = 237/376 (63%), Gaps = 5/376 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNS V + ++ Q  +  +++ E++    LT  R ++S+FFGG
Sbjct: 10  FGLYIHWPFCQAKCPYCDFNSFVSK-EIDQTKWRDAYIVELRRTAALTPNRVLNSVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++PQ +  IL  + KNWT+++++EIT+EANP+SVE   F  +R AG+NR+S+G+Q
Sbjct: 69  GTPSLMDPQIVDDILQEVQKNWTIANDIEITLEANPTSVEAGRFADFRAAGINRVSMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           SL +Q LR LGR H+ SE IAA   ARN F R+SFDLIYA   QT+  W  EL +AL  A
Sbjct: 129 SLNDQDLRKLGRTHSVSEGIAAFETARNEFERVSFDLIYARQGQTLQDWNAELGQALEMA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDL-VLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE GT F      G L  LP+++ A D+Y  TQ +TS HG+ +YE+SNH+
Sbjct: 189 VDHLSLYQLTIEDGTAFGDRFAAGKLRDLPNDDNAADMYFATQELTSKHGMKSYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
            +G+ES HNL YW  GDYIGIGPGAH R+     R A   E  P +WL  V KNG     
Sbjct: 249 KVGSESRHNLIYWNGGDYIGIGPGAHGRLTNNGIRYATETELSPVAWLSKVAKNGSGQTI 308

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           ++ ++ + +  E   MGLRL  G+   D   L   N     E +   +  I  V    L 
Sbjct: 309 QDAMTRQDELTERFTMGLRLATGV---DLGRLGLENHQKSFENSWLAEDQIIEVAQESLI 365

Query: 378 CTQRGMTMLDSVIANL 393
            T +G  +L++VI  L
Sbjct: 366 VTAKGRPVLNAVIVEL 381


>gi|94496908|ref|ZP_01303482.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingomonas sp. SKA58]
 gi|94423584|gb|EAT08611.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingomonas sp. SKA58]
          Length = 393

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 178/383 (46%), Positives = 239/383 (62%), Gaps = 12/383 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +  L +Y+HWPFCV KCPYCDFNSHVR   +  + +  + L +M     LTG R ++SIF
Sbjct: 15  TEPLALYIHWPFCVSKCPYCDFNSHVRE-GIDVDAWRGALLADMAHEAALTGGRPLTSIF 73

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +A ++    + W ++ + EIT+EANP+SVE   F     AGVNR+SL
Sbjct: 74  FGGGTPSLMPPALVADLIAAADRQWGLAPDSEITLEANPNSVEAARFADLAAAGVNRVSL 133

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L+  +L FLGR H+  E +AA+  A+ +F R+SFDLIYA P Q+   WE EL RAL
Sbjct: 134 GLQALDNDALHFLGRAHDVDEGLAALATAQRVFDRVSFDLIYARPGQSEADWEAELARAL 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +   HLSLYQLTIE GT F  +   G L     +    LY LTQS+T A G+ AYEISN
Sbjct: 194 GFGTGHLSLYQLTIEPGTRFATLVAQGKLTPADPDHGATLYELTQSMTVAAGIPAYEISN 253

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G ES HNL YWRYGDY GIGPGAH R + G   V     K PE+W+  V +NGH  
Sbjct: 254 HARPGQESRHNLTYWRYGDYAGIGPGAHGR-RTGQATVR---HKKPENWMNAVARNGHGA 309

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-----DIECERNLQRQGFIER 370
             +E L+ E +A E L+MGLRLREG+ ++     +G  +     D+   R L   G ++R
Sbjct: 310 QGEEPLADEDRAREALLMGLRLREGVDLRRIASESGITISQLVDDLAVAR-LMEIGLMDR 368

Query: 371 VQFSRLRCTQRGMTMLDSVIANL 393
            Q S ++ T  GM +LD+++  +
Sbjct: 369 -QESHIQVTPAGMLLLDAILPEI 390


>gi|254461596|ref|ZP_05075012.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678185|gb|EDZ42672.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 384

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 241/379 (63%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV R ++ +  ++ ++L E+         R ++++F
Sbjct: 7   NGGFGIYVHWPFCEAKCPYCDFNSHVSR-EIDEARWLNAYLCELDRAAVELSGRVVNAVF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +A I++ I K+W V ++ EIT+EANP SVE   F+GY   GV RIS+
Sbjct: 66  FGGGTPSLMHPDTVAAIIERIRKHWPVPNDPEITLEANPGSVEAGRFRGYADGGVTRISM 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ L+ LGR H   EA  A ++AR+ F R+SFDLIYA   QT+  W+ EL  AL
Sbjct: 126 GVQALNDRDLKRLGRIHTVDEAKKAFNIARSTFERVSFDLIYARQDQTLENWKKELNEAL 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
             A+DHLSLYQLTIEKGT F   ++ G L  LP E++A D+Y+ T  +    GL  YE+S
Sbjct: 186 CLAIDHLSLYQLTIEKGTAFSARYEKGGLTGLPVEDLAADMYDATNELCERAGLFGYEVS 245

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N++  GAES HN+ YWRYGDY+GIGPGAH R+ V   + A    + P +WL+   + G  
Sbjct: 246 NYAKPGAESRHNMIYWRYGDYLGIGPGAHGRLTVDGTKYATEHFRMPSAWLENSER-GKG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              ++ LS+  QA+E+L+MGLR+ EGI     E LAG  +D     +L     I +   +
Sbjct: 305 EKIRDGLSNTDQANEYLIMGLRITEGIDRARLENLAGVPVDQSSLDHLNDLNLITQ-DGA 363

Query: 375 RLRCTQRGMTMLDSVIANL 393
            LR T +G  +L+SVI  L
Sbjct: 364 NLRTTPQGRLLLNSVIGEL 382


>gi|296114823|ref|ZP_06833472.1| coproporphyrinogen III oxidase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978637|gb|EFG85366.1| coproporphyrinogen III oxidase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 407

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 234/391 (59%), Gaps = 11/391 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS---- 70
           G  +L +YVHWPFC+ KCPYCDFNSHVR   + Q  F  +   E+       G       
Sbjct: 18  GGEALALYVHWPFCLSKCPYCDFNSHVRDV-IPQARFGNALRRELAHEAARIGTARDTRP 76

Query: 71  -ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + SIFFGGGTPSL+EP  +A ++      + +S ++EIT+EANP+SVE    + +R  G
Sbjct: 77  VLGSIFFGGGTPSLMEPATVAALIGDAGHLFRLSPDIEITLEANPTSVETARLRAFRDGG 136

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNRIS+G+QSL+ ++LRFLGR H   +AIAA+  AR +F R+SFDLIYA P+Q++  W  
Sbjct: 137 VNRISVGLQSLDPEALRFLGREHTVPQAIAALEQARALFGRISFDLIYARPEQSLASWRG 196

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL  AL  A DHLSLYQLTIE GT F  +++     LP +++A  LY  T  + + HGL 
Sbjct: 197 ELDAALDLASDHLSLYQLTIEPGTRFESLYRQNRFHLPDDDLAARLYEETARVAARHGLL 256

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+SN++  GAES HNL YWRYGDY+GIGPGAH RV       A    + PE W + V 
Sbjct: 257 GYEVSNYARPGAESRHNLTYWRYGDYLGIGPGAHGRVTRDGVTYATRRHRAPEPWAERVE 316

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
           + G     ++ LS  ++A E L+MGLRL EGI+   +    G +L    +  + +    E
Sbjct: 317 RTGTGTTHEDALSPREKAREMLLMGLRLDEGIAAGRFARRTGMSLGDATDPGILQAALEE 376

Query: 370 -----RVQFSRLRCTQRGMTMLDSVIANLAV 395
                    +RLR T  G   L+S++A L V
Sbjct: 377 DYLRWDAGGARLRATAEGRLRLESLLAALVV 407


>gi|163797075|ref|ZP_02191030.1| putative oxygen-independent coproporphyrinogen III oxidase [alpha
           proteobacterium BAL199]
 gi|159177591|gb|EDP62144.1| putative oxygen-independent coproporphyrinogen III oxidase [alpha
           proteobacterium BAL199]
          Length = 400

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/388 (44%), Positives = 238/388 (61%), Gaps = 6/388 (1%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
            +T      +GVYVHWPFC  KCPYCDFNSHV    V  + +  + + E++      G R
Sbjct: 7   ELTTTLDEPMGVYVHWPFCRSKCPYCDFNSHVSD-TVDHDRWRTALVRELETQAARVGRR 65

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + S+FFGGGTPSL+EP+ +A +LD +  ++ +++++E+T+EANP+SVE     G+R AG
Sbjct: 66  RVESVFFGGGTPSLMEPETVAAVLDTVRSSFRIANDLEVTLEANPTSVEAGRLDGFRDAG 125

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR+SLGVQ+L+++ LRFLGR H ASEA+AA+  AR  F R+SFDLIYA P Q+   W+ 
Sbjct: 126 VNRVSLGVQALDDEVLRFLGRTHAASEALAAVAAARERFDRVSFDLIYARPGQSPQSWKR 185

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL  AL +A  HLSLYQLTIE  T F+ +H  G   LP E+ A  L+++TQ    A GL 
Sbjct: 186 ELSEALKHAAGHLSLYQLTIEPTTPFHSLHARGAFRLPDEDTAATLWDVTQETLDAAGLS 245

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
           AYE+SNH+  G E  HN+ YW Y DY+G+GPGAH R+     + A    + P  WL  V 
Sbjct: 246 AYEVSNHARPGDECRHNVVYWTYRDYLGVGPGAHGRLSEAGGKTATRTHRAPSIWLDRVE 305

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQ 365
           ++GHA+V+ + L  ++   E  + GLRL  G+S + W  L  R      DI     L   
Sbjct: 306 RDGHALVDDQMLDPDEVLVEATLTGLRLASGLSRERWHALFDRPPEDLFDIRTIGLLTDG 365

Query: 366 GFIERVQFSRLRCTQRGMTMLDSVIANL 393
           GF+E  +   LR T  G   LD+V   L
Sbjct: 366 GFLELDEVG-LRATATGRARLDAVTDRL 392


>gi|114762201|ref|ZP_01441669.1| coproporphyrinogen III oxidase [Pelagibaca bermudensis HTCC2601]
 gi|114545225|gb|EAU48228.1| coproporphyrinogen III oxidase [Roseovarius sp. HTCC2601]
          Length = 383

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 238/379 (62%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+YVHWPFC  KCPYCDFNSHV  + V Q  +  + ++E+    + T  R + SI+
Sbjct: 7   DGGFGLYVHWPFCEAKCPYCDFNSHVVSH-VDQTRWAAALVSELARYGRQTEGRVLRSIY 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+ +  +LD    +W  ++++EIT+EANP SVE+N F+G+  AGVNR+SL
Sbjct: 66  FGGGTPSLMAPETVRAVLDASRDHWAWANDIEITLEANPRSVEINKFEGFAMAGVNRVSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L    LR LGR H+  +A+ A+ +A++ F R++FDLIY    Q+++ WE+EL+ AL
Sbjct: 126 GVQALRPDDLRRLGRLHDVDDAVRALEIAKSTFNRVNFDLIYGRQGQSLSDWEVELREAL 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
             A DHLSLYQLTIE+GT F+   + G L  LPSE++  DLY  TQ I  A G  AYE+S
Sbjct: 186 DLAADHLSLYQLTIEEGTAFWDRAQAGKLRDLPSEDLGADLYLATQEICEAAGKPAYEVS 245

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NHS  G ES HNL YWR GDY+GIGPGAH RV V   R A    + P  W+K   + G A
Sbjct: 246 NHSGEGDESRHNLVYWRGGDYVGIGPGAHGRVTVNGQRSATVARRAPGDWIKAA-EAGSA 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
             E E L  +    E+LMMGLRL EG+ ++   M+  +         L   G I R + +
Sbjct: 305 DQEVESLMLQDVWAEYLMMGLRLSEGLDLERARMIDPKRTAALSLDPLVELGLIWRNE-A 363

Query: 375 RLRCTQRGMTMLDSVIANL 393
           R   TQ+G  +L+++ A L
Sbjct: 364 RFGATQQGRMLLNTLTAEL 382


>gi|126724521|ref|ZP_01740364.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
 gi|126705685|gb|EBA04775.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
          Length = 384

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 242/382 (63%), Gaps = 17/382 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG--PRSISSIFF 76
            GVYVHWPFC  KCPYCDFNSHV    V Q+ +  +FL+E++  R + G   R +SSI+F
Sbjct: 10  FGVYVHWPFCQSKCPYCDFNSHVSA-NVDQKRWFSAFLSEIE--RTVVGLEGRQLSSIYF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+EP  +  ILD +   + +++++EIT+EANP+SVE   FQ Y  AGVNR+S+G
Sbjct: 67  GGGTPSLMEPWLVEGILDALKSKFLIANDIEITLEANPTSVEAGRFQAYHDAGVNRVSMG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L    L+ LGR H+ +E   A   AR+IF R+SFDLIYA   QT+ QW  EL++AL+
Sbjct: 127 IQALNVPDLKRLGRLHSVNEGQDAFDTARHIFDRVSFDLIYARQDQTLDQWRSELKQALA 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +VDHLSLYQLTIE GT F      G L  LPSE++  D+Y LTQ +  A G+ AYE SN
Sbjct: 187 MSVDHLSLYQLTIEPGTAFGDRFSKGGLAGLPSEDLGADMYELTQELCEAAGMPAYETSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+ +G+ES HNL YW  GDY+G+GPGAH R+    HR+A      P  WL  V  +G   
Sbjct: 247 HAAVGSESRHNLVYWNSGDYLGLGPGAHGRITQYGHRIATETHLAPGKWLDAVENSGSG- 305

Query: 316 VEKEFLSSEQQA----DEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
              E LS +Q      +E LMMGLRLR GI    +E +   N  +E  + L+  G +E  
Sbjct: 306 ---ESLSRKQDGFEAQEEALMMGLRLRSGIDEVRFEQVL--NTKVEKIQGLKEIGMLETA 360

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
               LR T++G  +L++++  L
Sbjct: 361 N-GFLRTTEQGRPVLNAILREL 381


>gi|330993132|ref|ZP_08317070.1| Radical S-adenosyl methionine domain-containing protein 1
           [Gluconacetobacter sp. SXCC-1]
 gi|329759902|gb|EGG76408.1| Radical S-adenosyl methionine domain-containing protein 1
           [Gluconacetobacter sp. SXCC-1]
          Length = 396

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 175/391 (44%), Positives = 232/391 (59%), Gaps = 13/391 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG------PR 69
           +  L +YVHWPFC+ KCPYCDFNSHVR   + +  F  +   E+ +     G      PR
Sbjct: 8   AEPLALYVHWPFCLSKCPYCDFNSHVRDV-IPRARFGAALRRELAFEAARMGDSPAERPR 66

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            I SIFFGGGTPSL+ P+ +A ++      + ++   EIT+EANP+SVE    + +R AG
Sbjct: 67  -IGSIFFGGGTPSLMAPETVAGLIADARTLFGLTDTAEITLEANPTSVETGLLRAFRDAG 125

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNRIS+GVQSL+ ++LRFLGR H+A +AIAA+  AR +F R+SFDLIYA P Q    W  
Sbjct: 126 VNRISVGVQSLDAEALRFLGREHDAGQAIAALETARGLFDRISFDLIYARPGQDARAWRA 185

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL+ AL+   DHLSLYQLTIE GT F  +++ G   LP  + A  LY LT  + + HGL 
Sbjct: 186 ELEAALALVSDHLSLYQLTIEPGTRFEGLYRQGRFRLPDGDDAAQLYELTAEVAARHGLL 245

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YEISN++  GAES HNL YWRYGDY+GIGPGAH R+       A    + PE W + V 
Sbjct: 246 GYEISNYARPGAESRHNLTYWRYGDYMGIGPGAHGRLTCNGVTSATRRHRAPEPWAERVE 305

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL----DIECERNLQRQ 365
           + G      E L +  +A E L+MGLRL EGI+   +    G  +    D    R    +
Sbjct: 306 RTGTGAHPDEPLDNRDRAREMLLMGLRLAEGIATPRFARRTGMTITEATDPATMRAAVEE 365

Query: 366 GF-IERVQFSRLRCTQRGMTMLDSVIANLAV 395
           G+ +       LR T  G   L+S++A L +
Sbjct: 366 GYLVHDTTRQTLRATAEGRLRLESLLAALVL 396


>gi|119382770|ref|YP_913826.1| coproporphyrinogen III oxidase [Paracoccus denitrificans PD1222]
 gi|119372537|gb|ABL68130.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Paracoccus denitrificans PD1222]
          Length = 394

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/380 (44%), Positives = 235/380 (61%), Gaps = 4/380 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+YVHWPFC  KCPYCDFNSHV    + Q  ++ ++  E+  + + T  R ++SIF
Sbjct: 17  AGGFGLYVHWPFCAAKCPYCDFNSHVA-AAIEQGRWLAAYRAEIARLGRETPGRVLNSIF 75

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+ +A +++     W  ++++EIT+EANP+SVE   F+ Y  AGVNR+S+
Sbjct: 76  FGGGTPSLMAPETVAGVIEAARAAWPFANDIEITLEANPTSVETGRFRAYADAGVNRVSM 135

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +  LR LGR H+A EA AA  +AR+ F R+SFDLIYA   Q    W  EL  AL
Sbjct: 136 GVQALNDDDLRRLGRMHSAGEARAAFDIARDCFTRVSFDLIYARQDQDRAHWRRELGEAL 195

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
             AVDHLS YQLTIE GT F   H  G L  LP ++++ D+Y  TQ I +A G+  YEIS
Sbjct: 196 GMAVDHLSAYQLTIEPGTAFGARHAKGGLKGLPDDDLSADMYLDTQEICAAAGMPTYEIS 255

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GAES HNL YWR GD+  +GPGAH R+ + S R A      P +WL+ V   G+ 
Sbjct: 256 NHARPGAESRHNLIYWRQGDWAAVGPGAHGRLTLPSGRWATEAHLAPGAWLEAVEARGNG 315

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
             ++E L    +A E+L+M +RL EG+ V  + +  G  L  +   NL   G I  ++  
Sbjct: 316 DSQREMLGLSDRALEYLLMSMRLVEGLDVPRY-LAHGAELPQDRLMNLAELGLIS-LRGD 373

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RL  T  G  +L++++  LA
Sbjct: 374 RLAATAAGRPVLNAILRELA 393


>gi|126734413|ref|ZP_01750160.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. CCS2]
 gi|126717279|gb|EBA14143.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. CCS2]
          Length = 385

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 173/380 (45%), Positives = 242/380 (63%), Gaps = 12/380 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV   ++ Q+ +  ++L+E++ + + T  R + S+FFGG
Sbjct: 10  FGLYIHWPFCQAKCPYCDFNSHVVA-QIDQKAWQAAYLSEIERIGEETKGRVLRSVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P  +  IL  +   W +++++EIT+EANP+SVE   F GYR AGVNR+S+G+Q
Sbjct: 69  GTPSLMDPAVVDAILTKVRATWPLANDIEITLEANPTSVEAGRFAGYRDAGVNRVSMGIQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  L+ LGR H A EA+ A  +ARN F R+SFDLIYA   Q++  W  EL +AL+ A
Sbjct: 129 ALNDADLKALGRLHTAREAMQAFDVARNAFDRVSFDLIYARQGQSLKDWTSELGQALNLA 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           VDHLSLYQLTIE GT F   +  G L  LP ++ A D+Y  TQ +    GL +YE+SNH+
Sbjct: 189 VDHLSLYQLTIEDGTAFGDRYAAGKLRDLPDDDAAADMYMATQEVCGEAGLFSYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               ES+HN  YW+YGDY GIGPGAH R+ +G  R A      P  WL  V K G+    
Sbjct: 249 RPECESVHNKIYWKYGDYAGIGPGAHGRLTLGGTRYATEASLAPTIWLSQVLKTGNGDGN 308

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWE----MLAGRNLDIECERNLQRQGFIERVQF 373
            E L  + Q  EFL+MG+RLREG+ +  +      +   N++     NLQ  GF+++ Q 
Sbjct: 309 LEALDRQDQFVEFLLMGMRLREGVQLSRFSDCVTYIFQNNIN-----NLQESGFVQK-QD 362

Query: 374 SRLRCTQRGMTMLDSVIANL 393
             LR T +G  +L++V+  L
Sbjct: 363 DVLRVTDQGYPVLNAVLREL 382


>gi|83313599|ref|YP_423863.1| coproporphyrinogen III oxidase [Magnetospirillum magneticum AMB-1]
 gi|82948440|dbj|BAE53304.1| Coproporphyrinogen III oxidase and related Fe-S oxidoreductase
           [Magnetospirillum magneticum AMB-1]
          Length = 375

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 168/377 (44%), Positives = 231/377 (61%), Gaps = 11/377 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC+ KCPYCDFNSH     +    +  + L E+      T  R  +S+FFGG
Sbjct: 6   FGIYIHWPFCLSKCPYCDFNSHAS-LAMDHGRWRAALLAELDHFAAQTSDRIPTSVFFGG 64

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP+    ++D +   W  + ++E+T+EANP+SVE + F+ +R+AG+NR+SLG+Q
Sbjct: 65  GTPSLMEPETAGALVDAVKSRWAAAPDLEVTLEANPTSVEADRFRAFREAGINRLSLGIQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L+ ++L FLGR H+  EA+AA+ LA+  FPRMSFDLIY+ P QT  QW  EL RAL  A
Sbjct: 125 ALDSKALAFLGRRHSVDEALAALRLAQATFPRMSFDLIYSRPGQTEAQWRTELARALDLA 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLYQLTIE GT F   H  G+  LP E+ A   +  TQ +    GL AYEISNH+ 
Sbjct: 185 GEHLSLYQLTIEDGTAFAPAHGRGEFALPDEDEATAQFETTQEMCEKAGLPAYEISNHAR 244

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAE  HNL YW+ G+++GIGPGAH R        A++  + P +WL  V  NGHA   +
Sbjct: 245 PGAECRHNLTYWQGGEWLGIGPGAHGRFD----GFALAQARSPGTWLAQVDANGHATETR 300

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERVQFSRL 376
             L   ++  E ++MGLRLR G+      +LA     LD E    +   GF+       L
Sbjct: 301 YALDPAERRSELVLMGLRLRNGLGPA---LLAEVRPALDPEALARMIEGGFLVEDTLG-L 356

Query: 377 RCTQRGMTMLDSVIANL 393
           R T RG  +L++V+  L
Sbjct: 357 RTTDRGRLVLNAVLGEL 373


>gi|84514913|ref|ZP_01002276.1| coproporphyrinogen III oxidase [Loktanella vestfoldensis SKA53]
 gi|84511072|gb|EAQ07526.1| coproporphyrinogen III oxidase [Loktanella vestfoldensis SKA53]
          Length = 382

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 240/379 (63%), Gaps = 15/379 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+Y+HWPFC  KCPYCDFNSHV   ++  + +  ++L+E+  +   T  R + S+FF
Sbjct: 8   GGFGLYIHWPFCQAKCPYCDFNSHVVT-QIDHKAWESAYLSEISRLGAETEGRILRSVFF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPS+++P  +  +L  +   W +++++EIT+EANP+SVE   F GYR AGVNR+S+G
Sbjct: 67  GGGTPSMMDPAVVDAVLTRVRATWPMANDIEITLEANPTSVEAERFAGYRAAGVNRVSMG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +  L+ LGR H   EA+ A  +AR +F R+SFDLIYA   QT+  WE EL  ALS
Sbjct: 127 IQALNDPDLKALGRLHGRDEALRAFEIARGVFDRVSFDLIYARQGQTLAAWEAELAEALS 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            AVDHLSLYQLTIE GT F   +  G L  LP ++ A D+Y LTQ + +AHG   YE+SN
Sbjct: 187 LAVDHLSLYQLTIEDGTAFGDRYAAGKLRGLPDDDAAADMYALTQEVCTAHGFAGYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G ES+HN  YWRYGDY GIGPGAH R+ +G HR A   E  P +WL  VRK G+  
Sbjct: 247 HARAGCESIHNQIYWRYGDYAGIGPGAHGRLTLGGHRHATEAELSPLAWLSQVRKIGNGD 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERN----LQRQGFIERV 371
           + +  L    QA E L+MG+RL EG+ ++         LDI    +    L   G +E +
Sbjct: 307 LTRSMLDDAAQATERLLMGMRLTEGVMLE--------RLDIAALSSKISYLSDIGMVE-I 357

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +  RLR T  G  +L++V+
Sbjct: 358 EQGRLRATAAGRPVLNAVL 376


>gi|189184081|ref|YP_001937866.1| coproporphyrinogen III oxidase [Orientia tsutsugamushi str. Ikeda]
 gi|189180852|dbj|BAG40632.1| oxygen-independent coproporphyrinogen III oxidase [Orientia
           tsutsugamushi str. Ikeda]
          Length = 400

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 244/391 (62%), Gaps = 15/391 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           S+ VY+HWPFC+ KCPYCDFNSHV   KV   ++  +F   +++   L   + I SIFFG
Sbjct: 11  SISVYIHWPFCLSKCPYCDFNSHVAT-KVNFNDWQLAFRKSIKYFEPLLTGKIIKSIFFG 69

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P+ +A IL+ ++     S  VEIT+EANP+SVE   FQ +R AG+NR+S+GV
Sbjct: 70  GGTPSLMDPELVASILNLLSSLAKFSDTVEITLEANPTSVEAKKFQQFRLAGINRVSIGV 129

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QSL   +L+FLGR H+   A  A+ LA+ IFP+ SFDLIYA+ +Q + +W+ ELQ A+  
Sbjct: 130 QSLRLNNLKFLGRTHDVESAKHAVTLAKTIFPKFSFDLIYAIAEQEVEEWKQELQEAMLI 189

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A  H+S+YQLTIEKGT F+  ++ G   LPS+  A  LYN T       G H YEISN+S
Sbjct: 190 AGSHVSIYQLTIEKGTKFFGDYRKGKFTLPSDETAAKLYNYTNHYLKNLGYHRYEISNYS 249

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV--------AISIEKHPESWL-KMV 308
            +GAE  HNLNYW YG Y+GIGPGAHSR+   ++ V        AI+++ +P+ WL  ++
Sbjct: 250 KIGAECYHNLNYWNYGSYLGIGPGAHSRIVCYNNGVNGDSKSVKAITMQYNPQKWLNDIL 309

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQR 364
             +G+ + +   L+ +    E ++MGLRL  GIS      L G N    L ++    LQ 
Sbjct: 310 LASGNGIQDLHTLTDDDVIKEVIIMGLRLSTGISHDRLLELTGCNFQQALSMKYVHQLQD 369

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            G+I  +  + +R T + M + + ++  + +
Sbjct: 370 TGYI-VMSNNNIRLTDKAMLVYNYIVNKIVI 399


>gi|51473375|ref|YP_067132.1| coproporphyrinogen III oxidase [Rickettsia typhi str. Wilmington]
 gi|51459687|gb|AAU03650.1| Coprogen oxidase [Rickettsia typhi str. Wilmington]
          Length = 391

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/383 (42%), Positives = 240/383 (62%), Gaps = 8/383 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSHV    +    +I+S+  E+++ + +   + I SIF
Sbjct: 10  TNDLSIYIHWPFCLSKCPYCDFNSHVVS-TIDYNQWIKSYEKEIEYFKFIIQNKYIKSIF 68

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  + +I++ I     + +  EIT+E NP+S E    + ++ AG+NRIS+
Sbjct: 69  FGGGTPSLMHPLIVEVIINKINNLGIIDNKTEITLETNPTSFEAEKLKAFKSAGINRISI 128

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H++ +AI  I  A  I PR+SFDLIYA   QT+  WE EL++A+
Sbjct: 129 GVQSLKEDDLKTLGRTHDSMQAIKTIEAANTIVPRVSFDLIYARNGQTLKDWEEELKQAM 188

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S A  H++LYQLTIEKGT FYK+ K+G+L+LPS + A ++Y  T     +     YEISN
Sbjct: 189 SLATSHIALYQLTIEKGTPFYKLFKNGNLILPSVDEAAEMYEWTNHYLESKKYFRYEISN 248

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ LG E LHNL YW Y  Y+GIGPGAHSR+   ++ V AI +  +P  WL  VR     
Sbjct: 249 YAVLGHECLHNLTYWNYNSYLGIGPGAHSRIIENANSVLAIMMLHNPAKWLDAVRIKNVG 308

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIER 370
           +     L++++  +E LMMGLRLR+GI++   E          LD+   ++ Q QG I+ 
Sbjct: 309 IQTHAKLTNQEIIEEILMMGLRLRKGINIPTLEQKLSAKLENILDMNNLQHYQNQGLIKL 368

Query: 371 VQFSRLRCTQRGMTMLDSVIANL 393
            +   +  T +G+ + + ++  L
Sbjct: 369 DE--HIYLTDKGLMLHNYIVPRL 389


>gi|67459492|ref|YP_247116.1| coproporphyrinogen III oxidase [Rickettsia felis URRWXCal2]
 gi|67005025|gb|AAY61951.1| Probable oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia felis URRWXCal2]
          Length = 386

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 159/383 (41%), Positives = 240/383 (62%), Gaps = 4/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +++L +Y+HWPFC+ KCPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 5   ADNLSIYIHWPFCLSKCPYCDFNSHVVS-TIDHHQWLKSYETEIEYFKDIIQNKYIKSIF 63

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +A I++ I+    + +  EIT+E NP+S E   F+ ++ AG+NR+S+
Sbjct: 64  FGGGTPSLMNPVVVAGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKSAGINRVSI 123

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+A +AI  I  A +IFPR+SFDLIYA   Q +  W+ EL++A+
Sbjct: 124 GVQSLKEDDLKKLGRTHDALQAIKTIEAANSIFPRVSFDLIYARSGQKLKDWQEELKQAM 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT FYK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 184 RLANGHISLYQLTIEKGTPFYKLFKEGNLILPHSDAAAEMYEWTNHYLESQKYLRYEISN 243

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSR-VKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           ++    E LHNL YW Y +Y+GIGPGAHSR ++  S   AI +   PE WL  V+     
Sbjct: 244 YALANQECLHNLTYWNYNNYLGIGPGAHSRIIEPASSVSAIMMWHKPEKWLDSVKTKNVG 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERNLQRQGFIERVQF 373
           +     L++++  +E LMMGLRL+ GI++ + E      L DI    NLQ     + ++ 
Sbjct: 304 IQTNAKLTNQEIIEEILMMGLRLKSGINIAELEQKINTKLVDILDMNNLQNYQNQDLIKL 363

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
            + +  T +G+ +   ++  L +
Sbjct: 364 DKNISLTDKGLMLHSYIVPRLII 386


>gi|85708629|ref|ZP_01039695.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
 gi|85690163|gb|EAQ30166.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
          Length = 383

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 238/378 (62%), Gaps = 10/378 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +Y+HWPFC KKCPYCDFNSHVR   V  + + ++ + +++   +  G   ++SIFFGGG
Sbjct: 4   ALYIHWPFCAKKCPYCDFNSHVRE-SVDIDLWERALIADLRAEAREGGYEKLTSIFFGGG 62

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ P+ ++ +L+   K W  +  +EIT+EANPSSVE  NF     AG+NR+SLGVQS
Sbjct: 63  TPSLMPPKLVSALLNEAEKLWGFAPEIEITLEANPSSVEAANFAALASAGINRVSLGVQS 122

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           L++++LR+LGR H A EAI A+ +A+  F R+SFDLIYALP QT  QWE +L RALS+  
Sbjct: 123 LDDKTLRWLGRLHGAQEAIGALDVAQAHFARVSFDLIYALPDQTAEQWEAQLTRALSFGT 182

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H+SLYQLTIE GT F    + G       + A +L+ LTQS+TSA GL AYE SNH+  
Sbjct: 183 SHMSLYQLTIEPGTRFETDVRLGRFAPLDNDEAAELFALTQSLTSAAGLPAYETSNHAHP 242

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             ES HNL YWRY DY G+GPGAH R        A    K PE++LK V +  H + E+ 
Sbjct: 243 DDESRHNLTYWRYQDYAGVGPGAHGR----RGGFATVRHKKPENFLKAVNERAHGISEQR 298

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEML----AGRNLDIECERNLQRQGFIERVQFSR 375
            L  ++ A E LMMGLRL EG+ +   E       G  +D    ++L+  G I + +  R
Sbjct: 299 LLDPKEAASEALMMGLRLVEGVDLSALEARFRQDRGEMVDAGKLKHLKDIGLIWQ-EDER 357

Query: 376 LRCTQRGMTMLDSVIANL 393
           +  T  G  +LD+V+ +L
Sbjct: 358 IGLTDAGRPVLDAVLGDL 375


>gi|103485753|ref|YP_615314.1| coproporphyrinogen III oxidase [Sphingopyxis alaskensis RB2256]
 gi|98975830|gb|ABF51981.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingopyxis alaskensis RB2256]
          Length = 381

 Score =  325 bits (834), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 173/381 (45%), Positives = 238/381 (62%), Gaps = 14/381 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVHWPFCV KCPYCDFNSHVR   V QE +  + L +++    +   R ++SIFFGG
Sbjct: 5   LALYVHWPFCVSKCPYCDFNSHVRD-SVEQEVWRAALLADLRHEAAVLPGRRVASIFFGG 63

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +A ++   A  W ++ + EIT+EANP+S EV  F     AGVNR+S+GVQ
Sbjct: 64  GTPSLMPAATVAAVIAEAAALWGLTDDCEITLEANPNSAEVAAFADLAAAGVNRVSIGVQ 123

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S + Q+L FLGR H+  EA  AI +A+  F R+SFDLIYA P QT+  WE EL  AL + 
Sbjct: 124 SFDAQALAFLGRAHSEDEARRAIAMAQEHFARVSFDLIYARPGQTLAAWEGELADALGFG 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLSLYQLTIE GT F+ +   G+L +P  + A DL++ TQ++T A GL  YE+SNH+ 
Sbjct: 184 TGHLSLYQLTIEPGTRFWALAAKGELTIPDGDAAADLFDATQAMTRAAGLPRYEVSNHAR 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRKNGHAVV 316
            G ES HNL YWRY DY G+GPGAH R      R+  + E+H  PE+++  V +NGH + 
Sbjct: 244 PGEESRHNLAYWRYADYAGVGPGAHGR------RLRQATERHRKPENFIAAVTRNGHGLK 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
            +  LS  ++A E ++MGLRL EG+ +   E  +G      +D +    L  QG +    
Sbjct: 298 VETDLSGRERATEAMLMGLRLTEGVDLARVEARSGLPRADFVDADAVARLAGQGLLV-AD 356

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
             RL  T  G+ +LDS+++ +
Sbjct: 357 GDRLAVTGAGILLLDSILSEV 377


>gi|46201193|ref|ZP_00055595.2| COG0635: Coproporphyrinogen III oxidase and related Fe-S
           oxidoreductases [Magnetospirillum magnetotacticum MS-1]
          Length = 375

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 171/381 (44%), Positives = 233/381 (61%), Gaps = 13/381 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S   G+Y+HWPFC+ KCPYCDFNSH     V    + ++ L E+      T  R+ +S+F
Sbjct: 3   SPGFGIYIHWPFCLSKCPYCDFNSHAG-LAVDHGRWRKALLAELDHFAAQTPDRTPTSVF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP+    ++  +   W    ++E+T+EANP+SVE + F+ +R AGVNR+SL
Sbjct: 62  FGGGTPSLMEPETAGALIAMVKSRWASGPDLEVTLEANPTSVEADRFRAFRDAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L+ +SL FLGR H+  EA+AA+ LA+  FPR+SFDLIY+ P QT  QW  EL RAL
Sbjct: 122 GIQALDPESLAFLGRRHSVDEALAALSLAQATFPRVSFDLIYSRPGQTQAQWRAELARAL 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A +HLSLYQLTIE GT F  +H  G   LP E+ A   + LTQ +    GL AYEISN
Sbjct: 182 DLAGEHLSLYQLTIEDGTAFAPLHARGGFALPDEDEATAQFELTQEMCERAGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+   A+  HNL YW+ G ++GIGPGAH R        A++  + P  WL  V   GHA 
Sbjct: 242 HARANAQCRHNLTYWQGGAWLGIGPGAHGRFG----GEALAQTRSPGPWLAQVESQGHAT 297

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERVQF 373
             +  L   ++  E ++MGLRLR G+      +LA   + LD E    +   GF+  VQ 
Sbjct: 298 ETRYVLDPAERLSELVLMGLRLRNGLGPA---LLAEVRQVLDAEGLARMIADGFL--VQD 352

Query: 374 SR-LRCTQRGMTMLDSVIANL 393
           +R LR T RG  +L++V+  L
Sbjct: 353 ARGLRTTDRGRLVLNAVLGQL 373


>gi|91205960|ref|YP_538315.1| coproporphyrinogen III oxidase [Rickettsia bellii RML369-C]
 gi|157826679|ref|YP_001495743.1| coproporphyrinogen III oxidase [Rickettsia bellii OSU 85-389]
 gi|91069504|gb|ABE05226.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia bellii RML369-C]
 gi|157801983|gb|ABV78706.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia bellii OSU 85-389]
          Length = 388

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/334 (44%), Positives = 218/334 (65%), Gaps = 2/334 (0%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M    +N L +Y+HWPFC+ KCPYCDFNSH+    +  +N+++S+  E+++ + +   + 
Sbjct: 1   MKEVKANDLSIYIHWPFCLSKCPYCDFNSHIAN-SIDDDNWLKSYEKEIEYFKDIIQNKY 59

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           I SIFFGGGTPSL+ P+ +  I++ I+    +    EIT+EANP+S E   F+ ++ AG+
Sbjct: 60  IRSIFFGGGTPSLMNPKIVEGIINKISGFARIDKQTEITLEANPTSFETEKFKAFKLAGI 119

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+GVQSL E  L+ LGR H++ +AI  I  A  IFPR+SFDLIYA   Q +  W+ E
Sbjct: 120 NRVSIGVQSLRENDLKKLGRTHDSLQAIKTIESASKIFPRVSFDLIYARSGQELKDWQQE 179

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A+     H+SLYQLTIEKGT FYK+  DG+L+LP+ ++A ++Y  T     +     
Sbjct: 180 LKQAMELVTGHISLYQLTIEKGTPFYKLFHDGNLILPNSDLAAEMYEWTNDYLESQKYFR 239

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVR 309
           YEISN++  G E +HNL YW Y DY+GIGPGAHSR+      V AI +   PE WL+ V 
Sbjct: 240 YEISNYAKKGQECVHNLTYWNYNDYLGIGPGAHSRIIENPSSVSAIMMWHKPEKWLEAVN 299

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISV 343
              + V     L+ ++  +E LMMGLRL++GI++
Sbjct: 300 NKNNGVQTNVKLTKQEIIEEILMMGLRLKDGINI 333


>gi|15604050|ref|NP_220565.1| coproporphyrinogen III oxidase [Rickettsia prowazekii str. Madrid
           E]
 gi|3860741|emb|CAA14642.1| PROBABLE OXYGEN-INDEPENDENT COPROPORPHYRINOGEN III OXIDASE (hemN)
           [Rickettsia prowazekii]
 gi|292571770|gb|ADE29685.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia prowazekii Rp22]
          Length = 399

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 240/383 (62%), Gaps = 8/383 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSH+    +    +++S+  E+++ + +   + I SIF
Sbjct: 18  ANDLSIYIHWPFCLSKCPYCDFNSHIVS-TIDYNQWLKSYEKEIEYFKFIIQNKYIKSIF 76

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P  + +I++ I     + +  EIT+E NP+S E    + ++ AG+NR+S+
Sbjct: 77  FGGGTPSLMQPLIVEVIINKINNLGIIDNKTEITLETNPTSFETEKLKAFKSAGINRVSI 136

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H++ +AI  I  A  I PR+SFDLIYA   QT+  WE EL++A+
Sbjct: 137 GVQSLKEDDLKKLGRTHDSMQAIKTIEAANTIVPRVSFDLIYARNGQTLKDWEKELKQAM 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H++LYQLTIEKGT FYK+ K+G+L+LP+ + A ++Y  T     +     YEISN
Sbjct: 197 YLATSHIALYQLTIEKGTPFYKLFKNGNLILPTSDEAAEMYEWTNHYLESKKYFRYEISN 256

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ LG E LHNL YW Y  Y+GIGPGAHSR+   S+ V AI +  +P  WL  V      
Sbjct: 257 YARLGHECLHNLTYWNYNSYLGIGPGAHSRIIENSNSVLAIMMLHNPAQWLDAVSTKNVG 316

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRN-LDIECERNLQRQGFIER 370
           +     L++++  +E LMMGLRLR+GI +   E     A  N LDI   ++ Q QG I+ 
Sbjct: 317 IQTHSKLTNKEIIEEILMMGLRLRKGIKISKLEQRLSTALENILDINNLQHYQNQGLIKL 376

Query: 371 VQFSRLRCTQRGMTMLDSVIANL 393
            +   +  T +G+ + + ++  L
Sbjct: 377 DE--HIYLTDKGLMLHNYIVPRL 397


>gi|294085189|ref|YP_003551949.1| coproporphyrinogen III oxidase-like protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664764|gb|ADE39865.1| Coproporphyrinogen III oxidase and related Fe-S oxidoreductase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 410

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 167/356 (46%), Positives = 217/356 (60%), Gaps = 5/356 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWM-RQLTGPRSISSIF 75
           + LG+YVHWPFC  KCPYCDFNSHV    +  + F+ ++LTEM +M  QL  P S+SSIF
Sbjct: 17  SPLGLYVHWPFCKAKCPYCDFNSHVSN-DIDADAFLAAYLTEMTYMADQLEQPASLSSIF 75

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+    +  I+D  A  +     +EI+ EANP+SVE +    +  AGVNRIS+
Sbjct: 76  FGGGTPSLMPAFVVEGIIDKAAAIFGFMPAIEISAEANPTSVEASKMLDFHHAGVNRISM 135

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL + +L FLGR H+A EA  A+   R  F  MS DL+YA P QT   W  EL  AL
Sbjct: 136 GVQSLRDDTLAFLGREHSADEARKALTTVRTAFDNMSIDLMYATPNQTPADWHDELSTAL 195

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +  +DHLSLYQLTIE GT FY   + G+++   ++ A  L+++T+ +T   GL AYEISN
Sbjct: 196 ALGLDHLSLYQLTIESGTHFYTRQRRGEVMALDDDHAATLFDITRMLTRDAGLPAYEISN 255

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G E  HNL YW+ G+++GIGPGAHSR     HR+ IS  + P  WL  + K+GHA 
Sbjct: 256 HAKDGYECRHNLIYWQSGNWLGIGPGAHSRFTQQDHRIGISTRRSPAGWLAAIAKDGHAT 315

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN---LDIECERNLQRQGFI 368
                      A E LMMGLRL  G+S+       G     LDIE  R     G++
Sbjct: 316 DTLVTDGKNDWAAEMLMMGLRLTSGLSLARLSAACGPYHNWLDIEGLRKCHDAGWL 371


>gi|254452932|ref|ZP_05066369.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Octadecabacter antarcticus 238]
 gi|198267338|gb|EDY91608.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Octadecabacter antarcticus 238]
          Length = 382

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 235/377 (62%), Gaps = 9/377 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWPFC  KCPYCDFNSHV    V Q  +  +F  E+  +  +TG R ++S+FFGG
Sbjct: 10  FGLYIHWPFCQAKCPYCDFNSHVV-ASVDQTRWAAAFEKEIDRIADMTGDRVLNSVFFGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPS+++   +  IL  I K W +++++E+T+EANP+S+E   F GY  AGVNR+S+GVQ
Sbjct: 69  GTPSMMDVSTVDRILTRIQKRWRLANDLEVTLEANPTSIEAQRFAGYYAAGVNRVSVGVQ 128

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  L+ LGR H+A EA+AA+ +AR  F R+SFDLIYA   Q++ QW+ EL RAL + 
Sbjct: 129 ALNDADLKALGRLHSADEAMAAVEIARTTFDRVSFDLIYARQDQSVGQWQAELTRALEFE 188

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            DHLSLYQLT+E GT F    K G L  LP+E++  DL+++TQ      GL AYE+SNH+
Sbjct: 189 PDHLSLYQLTVEDGTAFGDRFKRGLLRGLPNEDLGADLWDVTQDACEKAGLPAYEVSNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
            +G ES HNL YW+ GD+ GIGPGAH R+ +   R      K P  W+  V      +  
Sbjct: 249 KIGQESRHNLIYWQSGDWAGIGPGAHGRLTLDGVRRETVCVKSPGMWIAQVESGALDLDT 308

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVK-DWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
              L +    +E ++MGLR+ EGI +  DW       ++      L   G +ER   +RL
Sbjct: 309 GSALGASDILEERVLMGLRMVEGIEMSADWMTDKFNKIN-----ELVVIGHLERTT-NRL 362

Query: 377 RCTQRGMTMLDSVIANL 393
             T +G  +L++VI++L
Sbjct: 363 TVTAQGRPVLNAVISHL 379


>gi|229586416|ref|YP_002844917.1| coproporphyrinogen III oxidase [Rickettsia africae ESF-5]
 gi|228021466|gb|ACP53174.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia africae ESF-5]
          Length = 400

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 158/383 (41%), Positives = 234/383 (61%), Gaps = 4/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 19  ANDLSIYIHWPFCLSKCPYCDFNSHVAS-TIDHNQWLKSYETEIEYFKDIIQNKYIKSIF 77

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EIT+E NP+S E   F+ ++ AG+NRIS+
Sbjct: 78  FGGGTPSLMNPVIVEGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKAAGINRISI 137

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IF R+SFDLIYA   QT+  W+ EL++A+
Sbjct: 138 GVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFLRVSFDLIYARSGQTLKDWQEELKQAM 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT  YK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 198 QLATSHISLYQLTIEKGTPCYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISN 257

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +G E LHNL YW Y  Y+GIGPGAHSR+   S  V AI +   PE WL  V+     
Sbjct: 258 YAMIGYECLHNLTYWNYNSYLGIGPGAHSRIIESSSSVSAIMMWHKPEKWLDAVKTKNVG 317

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQRQGFIERVQF 373
           +     L+ ++  +E LMMGLRL +GI++   E      L+ I    NL+    ++ ++ 
Sbjct: 318 IQTNTNLTHQEIIEEMLMMGLRLSKGINISTLEQKLNTKLENILDMNNLKHYQALDLIRL 377

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
              +  T +G+ +   ++  L +
Sbjct: 378 DENIYLTDKGLMLYSYIVPRLII 400


>gi|15892142|ref|NP_359856.1| coproporphyrinogen III oxidase [Rickettsia conorii str. Malish 7]
 gi|15619271|gb|AAL02757.1| probable oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia conorii str. Malish 7]
          Length = 400

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 158/383 (41%), Positives = 233/383 (60%), Gaps = 4/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFCV KCPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 19  ANDLSIYIHWPFCVSKCPYCDFNSHVAS-TIDHNQWLKSYETEIEYFKDIIQNKYIKSIF 77

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EIT+E NP+S E   F+ ++  G+NRIS+
Sbjct: 78  FGGGTPSLMNPVIVEGIINKISTLAIIDNQTEITLETNPTSFETEKFKAFKAVGINRISI 137

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IF R+SFDLIYA   QT+  W+ EL++A+
Sbjct: 138 GVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFLRVSFDLIYARSGQTLKDWQEELKQAM 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT  YK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 198 QLATSHISLYQLTIEKGTPCYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISN 257

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +G E LHNL YW Y  Y+GIGPGAHSR+   S  V AI +   PE WL  V+     
Sbjct: 258 YAMIGYECLHNLTYWNYNSYLGIGPGAHSRIIESSSSVSAIMMWHKPEKWLDAVKTKNVG 317

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQRQGFIERVQF 373
           +     L+ ++  +E LMMGLRL +GI++   E      L+ I    NL+    ++ ++ 
Sbjct: 318 IQTNTKLTHQEIIEEMLMMGLRLSKGINISTLEQKLNTKLENILDMNNLKHYQALDLIRL 377

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
              +  T +G+ +   ++  L +
Sbjct: 378 DENIYLTDKGLMLYSYIVPRLII 400


>gi|157964241|ref|YP_001499065.1| coproporphyrinogen III oxidase [Rickettsia massiliae MTU5]
 gi|157844017|gb|ABV84518.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia massiliae MTU5]
          Length = 388

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 159/383 (41%), Positives = 236/383 (61%), Gaps = 5/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 8   ANDLSIYIHWPFCLSKCPYCDFNSHVAS-TIDHNQWLKSYETEIEYFKDIIQNKYIKSIF 66

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EIT+E NP+S E   F+ ++ AG+NR+S+
Sbjct: 67  FGGGTPSLMNPVIVEGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKAAGINRVSI 126

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IF R+SFDLIYA   QT+  W+ EL++A+
Sbjct: 127 GVQSLKEDDLKKLGRTHDCVQAIKTIEAANTIFLRVSFDLIYARSGQTLKDWQEELKQAM 186

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT FYK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 187 QLATSHISLYQLTIEKGTPFYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +G E LHNL YW Y  Y+GIGPGAHSR+   S  V AI +   P  WL  V KN   
Sbjct: 247 YAMIGYECLHNLTYWNYNSYLGIGPGAHSRIIESSSSVSAIMMWHKPAKWLDSVTKNV-G 305

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQRQGFIERVQF 373
           +     L+ ++  +E LMMGLRL +GI++   E      L+ I    NL+    ++ ++ 
Sbjct: 306 IQTNTKLTHQEVIEEMLMMGLRLSKGINISTLEQKLNTKLENILDMNNLKHYQALDLIRL 365

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
            + +  T +G+ +   ++  L +
Sbjct: 366 DKNIYLTDKGLMLHSYIVPRLII 388


>gi|34580828|ref|ZP_00142308.1| probable oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia sibirica 246]
 gi|28262213|gb|EAA25717.1| probable oxygen-independent coproporphyrinogen III oxidase
           [Rickettsia sibirica 246]
          Length = 400

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 157/383 (40%), Positives = 233/383 (60%), Gaps = 4/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSH+    +    + +S+ TE+++ + +   + I SIF
Sbjct: 19  ANDLSIYIHWPFCLSKCPYCDFNSHIAS-TIDHNQWFKSYETEIEYFKDIIQNKYIKSIF 77

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EIT+E NP+S E   F+ ++ AG+NRIS+
Sbjct: 78  FGGGTPSLMHPVIVEGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKAAGINRISI 137

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IF R+SFDLIYA   QT+  W+ EL++A+
Sbjct: 138 GVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFLRVSFDLIYARSGQTLKDWQEELKQAM 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT  YK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 198 QLATSHISLYQLTIEKGTPCYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISN 257

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +G E LHNL YW Y  Y+GIGPGAHSR+   S  V AI +   PE WL  V+     
Sbjct: 258 YAMIGYECLHNLTYWNYNSYLGIGPGAHSRIIESSSSVSAIMMWHKPEKWLDAVKTKNVG 317

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQRQGFIERVQF 373
           +     L+ ++  +E LMMGLRL +GI++   E      L+ I    NL+    ++ ++ 
Sbjct: 318 IQTNTKLTHQEIIEEMLMMGLRLSKGINISTLEQKLNTKLEHILDMNNLKHYQALDLIRL 377

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
              +  T +G+ +   ++  L +
Sbjct: 378 DENIYLTDKGLMLYSYIVPRLII 400


>gi|157828095|ref|YP_001494337.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932797|ref|YP_001649586.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. Iowa]
 gi|157800576|gb|ABV75829.1| coproporphyrinogen III oxidase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907884|gb|ABY72180.1| oxygen-independent coproporphyrinogen-III oxidase [Rickettsia
           rickettsii str. Iowa]
          Length = 400

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 157/383 (40%), Positives = 234/383 (61%), Gaps = 4/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 19  ANDLSIYIHWPFCLSKCPYCDFNSHVASI-IDHNPWLKSYETEIEYFKDIIQNKYIKSIF 77

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EIT+E NP+S E   F+ ++ AG+NR+S+
Sbjct: 78  FGGGTPSLMNPVIVEGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKAAGINRVSI 137

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IF R+SFDLIYA   QT+  W+ EL++A+
Sbjct: 138 GVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFLRVSFDLIYARSGQTLKDWQEELKQAM 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT  YK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 198 QLATSHISLYQLTIEKGTPCYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISN 257

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +G E LHNL YW Y  Y+GIGPGAHSR+   S  V AI +   PE WL  V+     
Sbjct: 258 YAMIGYECLHNLTYWNYNSYLGIGPGAHSRIIESSSLVSAIMMWHKPEKWLDAVKTKNVG 317

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQRQGFIERVQF 373
           +     L+ ++  +E LMMGLRL +GI++   E      L+ I    NL+    ++ ++ 
Sbjct: 318 IQTNTKLTHQEIIEEMLMMGLRLSKGINISTLEQKLNTTLENILDMNNLKHYQALDLIRL 377

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
              +  T +G+ +   ++  L +
Sbjct: 378 DENIYLTDKGLMLYSYIVPRLII 400


>gi|241563370|ref|XP_002401676.1| coproporphyrinigen III oxidase, putative [Ixodes scapularis]
 gi|215501868|gb|EEC11362.1| coproporphyrinigen III oxidase, putative [Ixodes scapularis]
          Length = 402

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 236/385 (61%), Gaps = 8/385 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 21  ANDLSIYIHWPFCLSKCPYCDFNSHVAG-NIDHNQWLKSYETEIEYFKAIIQNKYIKSIF 79

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EITIE NP+S E   F+ ++ AG+NR+S+
Sbjct: 80  FGGGTPSLMNPVIVEGIINKISNLAIIDNQTEITIETNPTSFETEKFKAFKSAGINRVSI 139

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+A +AI  +  A  IFPR+SFDLIYA   Q +  W+ EL++A+
Sbjct: 140 GVQSLKEDDLKKLGRTHDALQAIKTVEAANTIFPRVSFDLIYARSGQKLKDWQEELKQAM 199

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +A  H+SLYQLTIEKGT FYK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 200 QFANGHISLYQLTIEKGTPFYKLFKEGNLILPHSDEAAEMYEWTNHYLESKKYFRYEISN 259

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +  E LHNL YW Y +Y+GIGPGAHSR+   S  V AI +   PE WL  V      
Sbjct: 260 YAQVEHECLHNLAYWNYNNYLGIGPGAHSRIIDASSSVLAIMMWHKPEKWLDSVNTKNVG 319

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIER 370
           +     L+ ++  +E LMMGLRL +GI++   E          LD+   ++ Q Q  I+ 
Sbjct: 320 IQTNTKLTHQEIIEEMLMMGLRLSKGINISTLEQKLNTKLENILDMNNLKHYQSQDLIKL 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
            +   +  T +G+ +   ++  L +
Sbjct: 380 DK--NIYLTDKGLMLHSYIVPRLII 402


>gi|260429507|ref|ZP_05783484.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Citreicella sp. SE45]
 gi|260420130|gb|EEX13383.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Citreicella sp. SE45]
          Length = 383

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 229/379 (60%), Gaps = 4/379 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+YVHWPFC  KCPYCDFNSHV  + V Q  + ++ + E+     LT  R + SI+
Sbjct: 7   DGGFGLYVHWPFCEAKCPYCDFNSHVTAH-VDQTRWAEALVRELARYGALTEGRMLRSIY 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P+ +  +L     +W  ++++EIT+EANP SVE+  F+G+   GVNR+SL
Sbjct: 66  FGGGTPSLMQPETVGAVLRASRDHWAWANDIEITLEANPRSVEIRKFEGFAGVGVNRVSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L    LR LGR H   EA++A+ +AR+ F R+SFDLIY    Q++  WE EL+ AL
Sbjct: 126 GVQALRPDDLRRLGRLHGVDEALSALDIARSTFSRVSFDLIYGRQGQSLAAWETELREAL 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEIS 254
             A DHLSLYQLTIE+GT F++  + G L  LP+E++  D+Y  TQ I  A G  AYE+S
Sbjct: 186 DLAGDHLSLYQLTIEEGTAFWERAQAGGLKGLPNEDLGADMYLATQDICGAAGFEAYEVS 245

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+   A S HNL YWR GDY+GIGPGAH RV +   R A    + P  W+    + G  
Sbjct: 246 NHAQRDAMSRHNLVYWRGGDYVGIGPGAHGRVTLNGVRHASVARRLPGPWIAAA-EAGSG 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
                 L+ E    E++MMG+RL EG+ ++    + G   +       Q  G I R   +
Sbjct: 305 DESLLPLTGEDVWAEYIMMGMRLSEGLDLERAREIGGTRFEEMPLEKFQDLGLIWR-DAT 363

Query: 375 RLRCTQRGMTMLDSVIANL 393
           R   T +G  +L+++ + L
Sbjct: 364 RFGATLQGRMVLNTLTSEL 382


>gi|239948170|ref|ZP_04699923.1| oxygen-independent coproporphyrinogen III oxidase [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922446|gb|EER22470.1| oxygen-independent coproporphyrinogen III oxidase [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 400

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 158/385 (41%), Positives = 235/385 (61%), Gaps = 8/385 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+  CPYCDFNSHV    +    +++S+ TE+++ + +   + I SIF
Sbjct: 19  ANDLSIYIHWPFCLSXCPYCDFNSHVAG-NIDHNQWLKSYETEIEYFKAIIQNKYIKSIF 77

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EITIE NP+S E   F+ ++ AG+NR+S+
Sbjct: 78  FGGGTPSLMNPVIVEGIINKISNLAIIDNQTEITIETNPTSFETEKFKAFKSAGINRVSI 137

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+A +AI  +  A  IFPR+SFDLIYA   Q +  W+ EL++A+
Sbjct: 138 GVQSLKEDDLKKLGRTHDALQAIKTVEAANTIFPRVSFDLIYARSGQKLKDWQEELKQAM 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +A  H+SLYQLTIEKGT FYK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 198 QFANGHISLYQLTIEKGTPFYKLFKEGNLILPHSDEAAEMYEWTNHYLESKKYFRYEISN 257

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +  E LHNL YW Y +Y+GIGPGAHSR+   S  V AI +   PE WL  V      
Sbjct: 258 YAQVEHECLHNLAYWNYNNYLGIGPGAHSRIIDASSSVLAIMMWHKPEKWLDSVNTKNVG 317

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIER 370
           +     L+ ++  +E LMMGLRL +GI++   E          LD+   ++ Q Q  I+ 
Sbjct: 318 IQTNTKLTHQEIIEEMLMMGLRLSKGINISTLEQKLNTKLENILDMNNLKHYQSQDLIKL 377

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
            +   +  T +G+ +   ++  L +
Sbjct: 378 DK--NIYLTDKGLMLHSYIVPRLII 400


>gi|157825359|ref|YP_001493079.1| coproporphyrinogen III oxidase [Rickettsia akari str. Hartford]
 gi|157799317|gb|ABV74571.1| coproporphyrinogen III oxidase [Rickettsia akari str. Hartford]
          Length = 393

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 236/383 (61%), Gaps = 4/383 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           ++ L +Y+HWPFC+ KCPYCDFNSHV    +    +I+S+ TE+++ + +   + I SIF
Sbjct: 12  ADDLSIYIHWPFCLSKCPYCDFNSHVAS-TIDHNQWIKSYETEIEYFKNIIQNKYIKSIF 70

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  + LI++ I     + +  EIT+E NP+S E   F+ ++ AG+NR+S+
Sbjct: 71  FGGGTPSLMNPVLVELIINKINNLAILDNRTEITLETNPTSFETEKFKAFKSAGINRVSI 130

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+A +AI  I  A  IFPR+SFDLIYA   Q +  W+ EL++A+
Sbjct: 131 GVQSLKEDDLKKLGRTHDALQAIKTIEQANGIFPRVSFDLIYARSGQKLKDWQEELKQAM 190

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT FYK+  +G+L++P  + A ++Y  T    ++     YEISN
Sbjct: 191 QLANGHISLYQLTIEKGTPFYKLFNEGNLIVPHSDAAAEMYEWTNHYLASKKYFRYEISN 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH-PESWLKMVRKNGHA 314
           ++    + LHNL YW Y   +GIGPGAHSR+   S  VA  +  H PE WL  V+     
Sbjct: 251 YALANQKCLHNLTYWHYNSCLGIGPGAHSRIIEPSGSVAAIMMWHKPEKWLDSVKTKNVG 310

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM-LAGRNLDIECERNLQRQGFIERVQF 373
           +     L+ ++  +E LMMGLRL +GI++   E  +  + +DI    NL+    ++ ++ 
Sbjct: 311 IQTNAKLTHQEIIEEILMMGLRLSKGINISTLEQKINAKLMDILDMNNLKHYQALDLIKL 370

Query: 374 SR-LRCTQRGMTMLDSVIANLAV 395
            + +  T +G+ +   ++  L +
Sbjct: 371 DKNIYLTDKGLMLHSYIVPRLII 393


>gi|296532220|ref|ZP_06894969.1| possible coproporphyrinogen dehydrogenase [Roseomonas cervicalis
           ATCC 49957]
 gi|296267450|gb|EFH13326.1| possible coproporphyrinogen dehydrogenase [Roseomonas cervicalis
           ATCC 49957]
          Length = 439

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 164/345 (47%), Positives = 216/345 (62%), Gaps = 2/345 (0%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG-PR 69
           + G     + +YVHWPFC+ KCPYCDFNSHVR  +V    +  +   E+    +  G  R
Sbjct: 51  ICGAMPEPIALYVHWPFCLAKCPYCDFNSHVRE-RVDAARYGAALRRELAHEAERLGEKR 109

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            ++SIFFGGGTPSL+ P+ +A ++    + +    ++EIT+EANP+SVE+      R+AG
Sbjct: 110 PLASIFFGGGTPSLMPPEVVADVIAEARRLFEPLPDIEITLEANPTSVEIAKLAALREAG 169

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR SLG+QSL++++L FLGR H+A +A+AA+  AR +FPR+SFDLIYA P Q + +W  
Sbjct: 170 VNRASLGIQSLQDKALGFLGRQHDAKQAVAALEAARALFPRISFDLIYARPGQGLEEWRA 229

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL++AL+ A DHLSLYQLTIE GT F   +  G   LP    A  LY  T       GL 
Sbjct: 230 ELRQALALAADHLSLYQLTIEPGTRFATEYARGAFALPEGEEAAALYYATGEEAGRFGLL 289

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+SN++  GAES HNL YWRYGDY+GIG GAH RV      VA    + PE WL  V 
Sbjct: 290 PYEVSNYARPGAESRHNLAYWRYGDYLGIGAGAHQRVTRDGTVVAARRHRAPEEWLSRVE 349

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
             GHAV  +E L+   +A E L+MGLRL EG+S    +   G  L
Sbjct: 350 AEGHAVTREEHLAPLDRAREALLMGLRLSEGVSPARLQARTGLTL 394


>gi|157803377|ref|YP_001491926.1| coproporphyrinogen III oxidase [Rickettsia canadensis str. McKiel]
 gi|157784640|gb|ABV73141.1| coproporphyrinogen III oxidase [Rickettsia canadensis str. McKiel]
          Length = 386

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/383 (41%), Positives = 233/383 (60%), Gaps = 8/383 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           ++ L +Y+HWPFC+ KCPYCDFNSHV    +  E +++S+  E+++ + +   + I SIF
Sbjct: 5   TDDLSIYIHWPFCLSKCPYCDFNSHVAS-TIDHEQWLKSYEREIEYFKPIIQNKYIKSIF 63

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P  + +I++ I     +    EIT+E NP+S E   F+ ++ AG+NR+S+
Sbjct: 64  FGGGTPSLMDPVIVEVIINKIINIAIIDHQTEITLETNPTSFETEKFKAFKSAGINRVSI 123

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IFPR+SFDLIYA   Q +  W+ EL++A+
Sbjct: 124 GVQSLKEDDLKKLGRTHDCMQAIKTIETANTIFPRVSFDLIYARSGQKLKDWQEELKQAM 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGTLFYK+ +DG L+LP  + A ++Y  T     +     YEISN
Sbjct: 184 QLATSHISLYQLTIEKGTLFYKLFRDGTLILPHSDEAAEMYEWTNHYLESKKYFRYEISN 243

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSR-VKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           ++ +  E LHNL YW Y  Y+GIGPGAHSR ++  S  +AI +   PE WL  V+     
Sbjct: 244 YALVSQECLHNLTYWNYNSYLGIGPGAHSRIIEPSSSVLAIMMWHKPEKWLDSVKIKNVG 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIER 370
           +     L+ ++   E LMMGLRL+ GI++   E          LD+   ++ Q Q  I+ 
Sbjct: 304 IQTNIKLTHQEVIAEMLMMGLRLKSGINLSILEQKLNTKLENILDMNNLKHYQNQDLIKL 363

Query: 371 VQFSRLRCTQRGMTMLDSVIANL 393
            Q   +  T +G+ +   ++  L
Sbjct: 364 DQ--NVYLTDKGLMLHSYIVPRL 384


>gi|149184522|ref|ZP_01862840.1| coproporphyrinogen III oxidase [Erythrobacter sp. SD-21]
 gi|148831842|gb|EDL50275.1| coproporphyrinogen III oxidase [Erythrobacter sp. SD-21]
          Length = 384

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 222/387 (57%), Gaps = 29/387 (7%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT-GPRSISSIFFGGG 79
           +Y+HWPFC+ KCPYCDFNSHVR  +     +  + L +M+     T     + SIFFGGG
Sbjct: 5   LYIHWPFCLAKCPYCDFNSHVRE-RTDMAEWEAALLADMRAEFAATKSEEPLISIFFGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ P  +A +L    + W  S ++EIT+E NPSSVE  NF      G+NR+SLGVQS
Sbjct: 64  TPSLMPPALVASLLREAERLWGFSPDIEITLEGNPSSVEAANFADLANVGINRVSLGVQS 123

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           L    L+FLGR H   EA+ A   A+ +F R+S DLIYA P QT  +W  EL  AL+   
Sbjct: 124 LRGDVLKFLGRLHGVEEALKATETAQRLFDRVSIDLIYARPDQTEDEWRQELSEALALGT 183

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            HLSLYQLTIE  T F    + G     +++ A DL+ LT+ +T+A G+ AYEISNH+  
Sbjct: 184 SHLSLYQLTIEPSTRFATDVRRGVFDPLADDPAADLFALTREMTAAAGVPAYEISNHARP 243

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G ES HNL YWRY DY GIGPGAH R       VA +  K PE++L  V   G  + E  
Sbjct: 244 GEESRHNLTYWRYRDYHGIGPGAHGR----RGGVATTRHKKPENFLAAVTAQGDGIAEHR 299

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE---------- 369
            L   +QA E ++MGLRL EG+ ++D   L GR         ++R   +E          
Sbjct: 300 VLGLREQASEAMLMGLRLTEGVDLQD---LKGRF-------GVERAQLVEPAKLALYGDL 349

Query: 370 ---RVQFSRLRCTQRGMTMLDSVIANL 393
              R++  RL  T  GM +LD+++  +
Sbjct: 350 GLVRMEGERLFVTDAGMPLLDALLGEI 376


>gi|302381544|ref|YP_003817367.1| oxygen-independent coproporphyrinogen III oxidase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192172|gb|ADK99743.1| oxygen-independent coproporphyrinogen III oxidase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 383

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 229/381 (60%), Gaps = 9/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNS-HVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             + VYVHWP+C + CPYCDFN    R ++  Q   +++ LT++     L G R ++SIF
Sbjct: 6   GPVAVYVHWPYCARICPYCDFNVVRDRGWRDEQAVLVEAILTDLSAQAALVGARPLASIF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P ++A +++     +     VEIT+EANP+  E  +F   R AGV+R+SL
Sbjct: 66  FGGGTPSLMRPDDVARVVERARALFPSGEPVEITLEANPTDAEAAHFAALRDAGVDRLSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL++ +L FLGRNH+A+EA  AI  A   F R+S DLIYALP QT+  W   L  A+
Sbjct: 126 GVQSLDDAALAFLGRNHSAAEARRAIETAGATFDRLSIDLIYALPGQTVHAWSDALTEAV 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +   +H+S Y LTIE  T F + ++ G LV P E+ A DLY  TQ++  A G  AYE+SN
Sbjct: 186 AMGFEHVSPYHLTIEAATAFGRAYERGTLVPPDEDRAADLYEATQAVLGAAGFEAYEVSN 245

Query: 256 HS-FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           H+  + A S HNL+ WR  DYIG+GPGAH R+ +   R A   E+    +++ V  +G  
Sbjct: 246 HARGVAARSAHNLHVWRGHDYIGVGPGAHGRLTLDGVRTATVAERRIGPYVEGV-ASGAP 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQ 372
             E   L + + A+E +++GLR  EG+++ D   L+G  L +       L   GF+  ++
Sbjct: 305 WSETARLDARETAEERVLLGLRTVEGVALGD---LSGLGLPVAAGPVAALIEDGFVA-IE 360

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
             RL  T RG  +LD+V+  L
Sbjct: 361 EGRLAATARGRPVLDAVLKAL 381


>gi|86136762|ref|ZP_01055340.1| coproporphyrinogen III oxidase [Roseobacter sp. MED193]
 gi|85826086|gb|EAQ46283.1| coproporphyrinogen III oxidase [Roseobacter sp. MED193]
          Length = 330

 Score =  301 bits (772), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 153/329 (46%), Positives = 215/329 (65%), Gaps = 5/329 (1%)

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R ++S+FFGGGTPSL+ P+ +A +++G  + W  ++++EIT+EANP SVE   F GYR A
Sbjct: 4   RVLNSVFFGGGTPSLMMPETVAAVIEGAREIWPFANDIEITLEANPGSVEAGRFAGYRDA 63

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNRIS+G+Q+L +  LR LGR H+ +EA AA  +ARN F R+SFDLIYA   Q +  W+
Sbjct: 64  GVNRISMGIQALNDVDLRRLGRIHSVAEARAAFDIARNCFDRVSFDLIYARQGQDLAHWK 123

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHG 247
            EL  AL+ A+DHLSLYQLTIE+GT F   +  G L  LP+++ A D+Y  TQ I +AHG
Sbjct: 124 SELTEALTMAIDHLSLYQLTIEEGTAFGDRYARGKLRDLPTDDSAADMYQATQEICAAHG 183

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKM 307
           + AYEISNH+  G ES HN  YWRYGDY+GIGPGAH RV +   R A    + P +WLK 
Sbjct: 184 MPAYEISNHARPGEESRHNQIYWRYGDYVGIGPGAHGRVTLNGQRYATETHRAPGAWLKA 243

Query: 308 VRK-NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQG 366
           V + +G ++ +   L  E  A E++MM +RL EG+ +  +  L+G+ L  +   +L   G
Sbjct: 244 VSEGSGESLCQA--LPREDTAIEYMMMSMRLAEGMDITRYAALSGQELPQDRIADLVNLG 301

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            +       +R T +G  +L++V+  L V
Sbjct: 302 MVT-TSDQVIRATDQGRAVLNAVLRELLV 329


>gi|315497097|ref|YP_004085901.1| oxygen-independent coproporphyrinogen iii oxidase [Asticcacaulis
           excentricus CB 48]
 gi|315415109|gb|ADU11750.1| oxygen-independent coproporphyrinogen III oxidase [Asticcacaulis
           excentricus CB 48]
          Length = 380

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 231/369 (62%), Gaps = 9/369 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSI 74
           S  + +Y+HWP+C + CPYCDFN    R +   +N   ++   +++      GPR + S+
Sbjct: 6   SAPVALYIHWPYCSRICPYCDFNVTRDRGQADTQNALFEAIRADLRMQASWLGPRRLVSV 65

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL++P  +A +++     + V++++EIT+EANP+  E+  ++ ++ AG+NR+S
Sbjct: 66  FFGGGTPSLMKPDWVAAVINEAKTLFPVTNDIEITLEANPTDAEIARYRAFQAAGINRLS 125

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QSL + +LRFLGRNH+A EA+  +  A ++F R+S DLIYALP Q++  WE EL+RA
Sbjct: 126 IGIQSLNDAALRFLGRNHSAREALMGLETALSVFDRVSLDLIYALPDQSLENWEDELRRA 185

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
               V+H+S YQLTIE  T F +  + G L +P        Y+ TQS+ +  G  AYE+S
Sbjct: 186 AHLGVEHISPYQLTIESETAFGRAARRGQLRIPDPERGEAFYDQTQSVLTELGYEAYEVS 245

Query: 255 NHSF-LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           NH+    A S HN+N W   DY+GIGPGAH R+     R A   E   ++++  VR+ GH
Sbjct: 246 NHARGKEARSKHNINVWEGVDYVGIGPGAHGRLTFDKARHATVAEPDLKAYIARVRETGH 305

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
           +V  +E LS E+ ++E LM+GLRL EG+ +   E +AG  L+   E  L   GF+E  + 
Sbjct: 306 SVT-REPLSPEEASEEALMLGLRLIEGVRL---ERIAGLPLNKSDE--LIAGGFLEATR- 358

Query: 374 SRLRCTQRG 382
            RLR T +G
Sbjct: 359 ERLRATPKG 367


>gi|254295451|ref|YP_003061474.1| oxygen-independent coproporphyrinogen III oxidase [Hirschia baltica
           ATCC 49814]
 gi|254043982|gb|ACT60777.1| oxygen-independent coproporphyrinogen III oxidase [Hirschia baltica
           ATCC 49814]
          Length = 383

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 157/378 (41%), Positives = 225/378 (59%), Gaps = 6/378 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+Y+HWP+C K CPYCDFN +  + +   +  + +   +++  R+ TG R + ++F GG
Sbjct: 10  FGIYIHWPYCAKICPYCDFNVYAAKDR-NIDPLLLAIREDLKGWREKTGSRHVDTVFLGG 68

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ I  +L  IA+ W +  + EIT+EANP   ++N F G   AGVNR+SLGVQ
Sbjct: 69  GTPSLLPPEAIRQLLADIAELWPLRDDAEITLEANPD--DMNRFAGIADAGVNRLSLGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           SL++ +L FLGRNH+A  A+ AI   R  F  +S D IYALP Q+  +W+ EL   +   
Sbjct: 127 SLDDAALTFLGRNHSAKIALEAIGEGRRCFSSLSLDFIYALPNQSKEKWQAELSDIIDLG 186

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS- 257
            DHLSLY+LTIE+ T F K    GD    +E+VA DLY +TQ    A G  AYEISNH+ 
Sbjct: 187 ADHLSLYELTIEQRTAFGKAVSRGDWTPANEDVAADLYEVTQLEMEAAGYSAYEISNHAK 246

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
            +  ++ HN+ YW+ GD++G+GPGAH RV +   R+    EK P+ ++  V K G    +
Sbjct: 247 SVQHQAKHNIVYWKSGDWLGVGPGAHGRVTLDGKRLETISEKRPDKYISKVEKTGVG-AD 305

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
              LS E  A E +MMGLR+ +GI   D+E ++GR  D     +    G IE +  S L+
Sbjct: 306 YNPLSIEDIAAERVMMGLRMTQGILRSDFEKISGRCFDETAIASFISDGLIE-LDGSILK 364

Query: 378 CTQRGMTMLDSVIANLAV 395
            T  G  + D +   L +
Sbjct: 365 LTAEGCLLADYISQKLVL 382


>gi|16124400|ref|NP_418964.1| oxygen-independent coproporphyrinogen III oxidase [Caulobacter
           crescentus CB15]
 gi|221233083|ref|YP_002515519.1| oxygen-independent coproporphyrinogen-III oxidase [Caulobacter
           crescentus NA1000]
 gi|13421256|gb|AAK22132.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Caulobacter crescentus CB15]
 gi|220962255|gb|ACL93611.1| oxygen-independent coproporphyrinogen-III oxidase [Caulobacter
           crescentus NA1000]
          Length = 384

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 230/387 (59%), Gaps = 5/387 (1%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-QENFIQSFLTEMQWMRQLTGPR 69
           MT   + ++G+YVHWP+C + CPYCDFN    R +   Q     + + +++  R LTG R
Sbjct: 1   MTDPRAEAVGIYVHWPYCARICPYCDFNVVRDRGRTDEQRALADAIVADLEAQRALTGER 60

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + SIFFGGGTPSL++P  +A +++   + W+ + ++EI++EANP+  E + F     AG
Sbjct: 61  RLLSIFFGGGTPSLMDPAQVARVIETAKRLWSPADDLEISLEANPTDAETDRFAALAAAG 120

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           V R+SLGVQ+L++ SL+ LGRNH+A  A  AI  A   FPR+S DLIYA P QT   W  
Sbjct: 121 VQRLSLGVQALDDASLKALGRNHDAGAARRAIAAAARAFPRLSIDLIYARPGQTDAAWRA 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL  A++   +H+S YQLTIE GT F +    G LV P E++A  L+  TQ I  A G  
Sbjct: 181 ELSEAIALGPEHVSPYQLTIEPGTAFDRAVGRGTLVTPDEDLAATLFETTQEIFEAAGFD 240

Query: 250 AYEISNHS-FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
           AYE+SNH+    A + HNL YWR  DY+G+GPGAH R+ +   R A +  +  + ++  V
Sbjct: 241 AYEVSNHARGEAARARHNLVYWRGVDYVGVGPGAHGRLALPEGRAATTAHRAIKDYIAAV 300

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
             +G    + E L+ E  A E L++G+R+  G+   +  +L G + D+   R+L   G +
Sbjct: 301 GDHGVG-FQSEILTPEDAALERLVLGMRIDAGVGFDEVAVL-GLDPDVAKVRDLVETGLL 358

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
              + +RLR T+ G  +LD +   LA 
Sbjct: 359 VEDR-ARLRATRAGRLVLDRLTGALAT 384


>gi|167644145|ref|YP_001681808.1| oxygen-independent coproporphyrinogen III oxidase [Caulobacter sp.
           K31]
 gi|167346575|gb|ABZ69310.1| oxygen-independent coproporphyrinogen III oxidase [Caulobacter sp.
           K31]
          Length = 387

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 155/379 (40%), Positives = 234/379 (61%), Gaps = 5/379 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG-QENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           LGVYVHWP+C + CPYCDFN    R +   Q     + + +++  R LTGPR++ SIFFG
Sbjct: 12  LGVYVHWPYCARICPYCDFNVVRDRGRTDEQAALANAIVADLRAQRDLTGPRTLLSIFFG 71

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A +++     W+  +++EI++EANP+  E + F     AGV R+SLGV
Sbjct: 72  GGTPSLMDPGEVARVIETAKALWSPVADLEISLEANPTDAEADRFAALASAGVARLSLGV 131

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ +L  LGRNH+A  A  A+ +A   FPR+S DLIYA P QT+  W+ EL   L+Y
Sbjct: 132 QALDDAALALLGRNHDAGSARRAMAVAAKAFPRLSADLIYARPGQTVEAWKAELSALLAY 191

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H+S YQLTIE GT F +    G LV+P E++A  L+  TQ++  A G  AYE+SNH+
Sbjct: 192 GPEHVSPYQLTIEHGTAFDRAVGRGKLVVPDEDLAAALFETTQAVLEAAGFDAYEVSNHA 251

Query: 258 -FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
               A S HNL YWR  DY+G+GPGAH R+ +   ++A +  +    +++ V + G    
Sbjct: 252 RGEAARSRHNLVYWRGHDYVGVGPGAHGRLSLTEGKLATTAHRKIVDYVRAVAETGVG-F 310

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           E+E L++ + A+E L++GLR+ +G+S  +  +L G + D    ++L     +     +RL
Sbjct: 311 ERETLTATEAAEERLLLGLRIDDGVSFAEIAVL-GLSPDTPKVKSLVEARLLVD-DPARL 368

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T+ G  +LD +   LA 
Sbjct: 369 RATRSGRLVLDRLTGTLAT 387


>gi|254511341|ref|ZP_05123408.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacteraceae bacterium KLH11]
 gi|221535052|gb|EEE38040.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacteraceae bacterium KLH11]
          Length = 336

 Score =  298 bits (764), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 207/329 (62%), Gaps = 3/329 (0%)

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
           T  R +++IFFGGGTPSL+ P+ +A I+D     W  ++++EIT+EANP SVE   F  Y
Sbjct: 8   TPDRVLNTIFFGGGTPSLMAPETVAAIIDEARALWHPANDMEITLEANPGSVEAGRFAAY 67

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
             AGVNRIS+GVQ+L +  LR LGR H  +EA AA  +A + F R+SFDLIYA   QT+ 
Sbjct: 68  GDAGVNRISMGVQALNDDDLRRLGRIHTVAEARAAFDIAHSCFDRVSFDLIYARQHQTLD 127

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITS 244
            W  EL  AL+ AVDHLSLYQLTIE GT F   +  G L  LP ++ A D+Y  TQ I  
Sbjct: 128 TWRAELTEALAMAVDHLSLYQLTIEDGTAFGDRYALGKLRGLPEDDSAADMYLATQEICD 187

Query: 245 AHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESW 304
           AHGL AYE+SNH+  GAES HNL YWRYGDY+GIGPGAH R+ +  H+ A      P +W
Sbjct: 188 AHGLPAYEVSNHARPGAESQHNLIYWRYGDYVGIGPGAHGRLTLNGHKYATETYLSPNTW 247

Query: 305 LKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR 364
           L  V + G     +  L+ + Q  E+LMM +RL EG+ +  + +L+GR L      +L  
Sbjct: 248 LTAVAQ-GQGESSRTRLNRQDQGAEYLMMCMRLDEGLDIDRYMILSGRELPQRNLNSLVD 306

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANL 393
            G I  +  +RLR T  G  +L++VI  L
Sbjct: 307 LGMIT-LDENRLRATSNGRAVLNAVIREL 334


>gi|163742616|ref|ZP_02150002.1| coproporphyrinogen III oxidase [Phaeobacter gallaeciensis 2.10]
 gi|161384201|gb|EDQ08584.1| coproporphyrinogen III oxidase [Phaeobacter gallaeciensis 2.10]
          Length = 337

 Score =  298 bits (764), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 213/328 (64%), Gaps = 3/328 (0%)

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R +++IFFGGGTPSL+ P  +A I++   + W  S+++EI++EANP+SVE   F GYR A
Sbjct: 11  RVLNTIFFGGGTPSLMHPDTVAAIIETAREIWPFSNDIEISLEANPTSVEAGRFTGYRDA 70

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNRIS+G+Q+L +  L  LGR H+ SEA  A  +ARN F R+SFDLIYA   QT+  W+
Sbjct: 71  GVNRISMGIQALNDGDLHRLGRMHSVSEAQKAFDVARNCFDRVSFDLIYARQGQTLVGWQ 130

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHG 247
            EL +ALS A+DHLSLYQLTIE+GT F   +  G L  LPS++ A D+Y  TQ I   HG
Sbjct: 131 QELDQALSMAIDHLSLYQLTIEEGTAFGDRYARGKLRDLPSDDNAADMYLATQEICDKHG 190

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKM 307
           L AYE+SNH+  GAES HNL YWRYGDY+GIGPGAH R+ +   R A      P +WL  
Sbjct: 191 LPAYEVSNHARPGAESRHNLIYWRYGDYLGIGPGAHGRLTLDGTRYATETYLQPGAWLAA 250

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGF 367
             ++      +  L+ E  + E+LMMG+RL EG+ +  +  ++GR L  E   +L   G 
Sbjct: 251 A-EDHTGECSRIPLTPEDASAEYLMMGMRLVEGLDLDRFCAISGRTLSSERISHLCEIGM 309

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLAV 395
           +E +   R++ T  G  +L++V+ +L V
Sbjct: 310 VE-LSDKRIQATDAGRAVLNAVLRDLLV 336


>gi|84684652|ref|ZP_01012553.1| coproporphyrinogen III oxidase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667631|gb|EAQ14100.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2654]
          Length = 348

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 217/342 (63%), Gaps = 5/342 (1%)

Query: 54  SFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEAN 113
           ++L E+    + T  R +SS++FGGGTPSL++P  +  +LD +A +WT ++++EIT+EAN
Sbjct: 7   AYLAELARYARETPNRVLSSVYFGGGTPSLMDPAVVGAVLDAVAGHWTPANDIEITLEAN 66

Query: 114 PSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSF 173
           PSSVE   F GY  AGVNR+S+G Q+L +  L+ LGR H+   A+AA+ +AR+ F R++F
Sbjct: 67  PSSVEAERFAGYAAAGVNRVSMGFQALNDGDLKALGRLHDVETALAALDVARSTFDRINF 126

Query: 174 DLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVA 232
           DLIY    Q++  W  ELQRA+ +  DHLSLYQLTIE GT F      G L  LP E+++
Sbjct: 127 DLIYGRQDQSLEDWTAELQRAVGFEPDHLSLYQLTIEDGTAFGDRFARGKLRGLPDEDLS 186

Query: 233 VDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHR 292
            D+Y  TQ I    GL AYE+SNH+  G ES HNL YW  GDYIGIGPGAH R+ +G  R
Sbjct: 187 ADMYFATQDICEDAGLLAYEVSNHAKPGQESRHNLIYWSAGDYIGIGPGAHGRLSLGGRR 246

Query: 293 VAISIEKHPESWL-KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            +   E  P  WL + ++ NG A   +E LS   QA E+LMMGLR   G+ +  +E ++G
Sbjct: 247 WSTWTELSPSKWLDQALKHNGEA--GREALSRADQAGEYLMMGLRTTRGLDLDRYEAISG 304

Query: 352 RNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANL 393
             LD    ++L + G++  +    L  T+ G  +L++VI  L
Sbjct: 305 VPLDEMVLQDLVKNGYLN-LNNRYLAPTRSGRAVLNAVIREL 345


>gi|254421054|ref|ZP_05034778.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brevundimonas sp. BAL3]
 gi|196187231|gb|EDX82207.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brevundimonas sp. BAL3]
          Length = 390

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 161/381 (42%), Positives = 225/381 (59%), Gaps = 9/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-QENFIQSFLTEMQWMRQLTGPRSISSIF 75
           + +G+YVHWP+C + CPYCDFN    R +V  Q   +++ L +M+  R LTG R ++SIF
Sbjct: 13  SDVGLYVHWPYCSRICPYCDFNVVRDRGRVEEQAALVEAILADMRAQRALTGSRRLASIF 72

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+  A I+      +  +  +EI++EANP+  E   F     AGVNR+S+
Sbjct: 73  FGGGTPSLMAPEAAARIIAQAYDLFPPAGAIEISLEANPTDAEAARFAALAGAGVNRLSM 132

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++ +LRFLGR+H+A+EA  A+ LA   F R+S DLIYA P QT   W  EL  AL
Sbjct: 133 GVQALDDAALRFLGRDHSAAEARRAVDLAGRAFSRLSIDLIYARPGQTPADWATELGAAL 192

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
               +H+S YQLT+E  T F +    G L+ P E+ A  LY  TQ++  A G  AYE+SN
Sbjct: 193 DMGFEHVSPYQLTLEPTTAFGRALARGTLIPPDEDQAAALYETTQTVLEAAGFDAYEVSN 252

Query: 256 HS-FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           H+  + A S HNL+ WR GDY+G+GPGAH R+ +   R A    +    ++  V   G  
Sbjct: 253 HARGVSARSAHNLHVWRGGDYLGLGPGAHGRLTLDGTRTATVAHRRIADYVAGV-GAGSP 311

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQ 372
            +E E L +   A+E L++GLR  EG  V    +LA   LD +     +L   GF+ R+ 
Sbjct: 312 WMETERLDAAGAAEEKLLLGLRTVEGAPVG---LLADLGLDADAAPTADLITDGFL-RLS 367

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
             RL  T RG  +LD V+  L
Sbjct: 368 GGRLVATPRGRPVLDGVLKAL 388


>gi|218670664|ref|ZP_03520335.1| coproporphyrinogen III oxidase [Rhizobium etli GR56]
          Length = 231

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 127/212 (59%), Positives = 162/212 (76%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL E   +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFLKETAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +A ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMQPETVAAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P QT+  WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIVLARDIFPRMSFDLIYARPDQTVEDWERE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDG 222
           L+ A++YAVDHLSLYQLTIE+GT   +  + G
Sbjct: 196 LKHAIAYAVDHLSLYQLTIEEGTPLLRPAQGG 227


>gi|115933434|ref|XP_798402.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115960126|ref|XP_001188042.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 440

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/400 (36%), Positives = 231/400 (57%), Gaps = 31/400 (7%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN +V    + Q       + E Q + +L+G + ++SIFFGGGT
Sbjct: 35  LYVHWPYCQKRCTYCNFNKYVTP-TIDQNRIRACLVREAQTLIKLSGVKQVNSIFFGGGT 93

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL EP+ +  +++ + +   + ++VEI++EANP+SVE+   + ++ AGVNR+SLG+Q+L
Sbjct: 94  PSLAEPRVLEGVIEAVKELVAMPTDVEISMEANPTSVEMKKLEDFKSAGVNRLSLGIQAL 153

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           +   L+ LGR H   +++  IH AR +FP R+S D+I+  P QT+  WE EL++ L    
Sbjct: 154 DSNDLKTLGREHTVGQSLTCIHEARKLFPDRLSIDIIFGRPSQTLNSWEAELEQILQVCD 213

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS-F 258
            H+SLYQLT+E GTL YK  + G L +P  ++  D+Y       +  G H YE+SN +  
Sbjct: 214 SHISLYQLTLEPGTLLYKFDQQGVLPMPDADLIADMYETAVERLAQAGFHRYEVSNFART 273

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEK---------------HPES 303
           + AES+HN  YW    YIG+GPGAH R    + + A + +                 P++
Sbjct: 274 VRAESIHNKAYWEGKQYIGVGPGAHGRFVPITEQFADNADPSGKRGYSQEARIQTLEPDT 333

Query: 304 WLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL- 362
           W+  V K G A  ++  LS+     E L+ GLR R GIS + W+ L+  +    C R++ 
Sbjct: 334 WMLEVEKYGDATRKRIPLSNVDVLRELLLTGLRTRPGISDQTWQQLSPGD----CLRDVF 389

Query: 363 --------QRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
                    R+  +  +  + LRCT RG+ +LDS++ +L 
Sbjct: 390 GSSDFIKSARESGLMELDDAGLRCTHRGLNVLDSLLPDLT 429


>gi|261215309|ref|ZP_05929590.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
 gi|260916916|gb|EEX83777.1| coproporphyrinogen III oxidase [Brucella abortus bv. 3 str. Tulya]
          Length = 245

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 125/217 (57%), Positives = 162/217 (74%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLP 227
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTP 236


>gi|329847437|ref|ZP_08262465.1| radical SAM superfamily protein [Asticcacaulis biprosthecum C19]
 gi|328842500|gb|EGF92069.1| radical SAM superfamily protein [Asticcacaulis biprosthecum C19]
          Length = 378

 Score =  285 bits (730), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 228/367 (62%), Gaps = 11/367 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           + +YVHWP+C + CPYCDFN    R +  Q +   S L++++    L GPR++ S+FFGG
Sbjct: 7   IALYVHWPYCSRICPYCDFNVTRDRGQASQRSLFDSILSDLKSQSALLGPRTLVSLFFGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P   A ++    + +  + ++EIT+EANP+  E+  ++ +R AG+NR+SLGVQ
Sbjct: 67  GTPSLLPPDWTAELIATAKQLFPSTDDIEITLEANPTDAEIARYRAFRDAGINRLSLGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           SL++++L+FLGRNH+A EAI  I  A+++F R+S DLIYA P+QT   W  EL RA + +
Sbjct: 127 SLDDEALKFLGRNHSAREAITGIETAQSVFGRVSLDLIYARPEQTTHDWREELTRAAALS 186

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           ++H+S YQLTIE+ T F +  + G    P +++A   Y  TQ         AYE+SNH+ 
Sbjct: 187 IEHISPYQLTIEQTTAFGRAVRRGRWSPPDQDLAEAFYFETQDTLERLNFDAYEVSNHAR 246

Query: 259 -LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--NGHAV 315
            + A+++HN++ WR  DYIG+GPGAH R+ +   R A +     +++   V     GH  
Sbjct: 247 GINAQAMHNVHIWRGVDYIGVGPGAHGRLTIDGQRHATTALSELKAYTARVADIGVGH-- 304

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
            E E L+  +  +E  M+GLR+ EG+++  +++L   +L ++    L   GF+E +  + 
Sbjct: 305 -ESETLTPLEAEEEAAMLGLRMAEGVALSRFKLL---DLPVKAA-PLIDGGFME-LTPTH 358

Query: 376 LRCTQRG 382
           LR T +G
Sbjct: 359 LRATPKG 365


>gi|114797411|ref|YP_761982.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Hyphomonas neptunium ATCC 15444]
 gi|114737585|gb|ABI75710.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Hyphomonas neptunium ATCC 15444]
          Length = 390

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 143/378 (37%), Positives = 221/378 (58%), Gaps = 4/378 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQLTGPRSISSIFFG 77
            G+Y+HWP+C + CPYCDFN +  + +   +  + +   +++   R+L    ++ +++FG
Sbjct: 14  FGLYIHWPYCTRVCPYCDFNVYAAKDRA-TDPLVTAIADDIRVHRRKLPEHGALDTVYFG 72

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTP+L+ P+ +A IL   ++ + +    EIT+EANP+ V   +    R+AGV R+S+GV
Sbjct: 73  GGTPALLRPEQVAEILKAASETFGIKDGAEITLEANPNDVLKADLLALRRAGVTRLSIGV 132

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS+ + +L FLGR+H A     A+  A  +F  +S DLIYA P Q+   WE EL  AL+ 
Sbjct: 133 QSMRDSALAFLGRDHTAEAGGEAVKRALKVFDTISMDLIYARPGQSPANWEAELADALAL 192

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLSLY+LT E  T F K  + G++V   ++   DLY LTQ +T   G+ AYE+SNH+
Sbjct: 193 GAPHLSLYELTFEPATAFGKAAQRGEIVPMPDDAQADLYELTQQMTRDAGMPAYEVSNHA 252

Query: 258 FLGA-ESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
              A +S HNL YWR GD+IG GPGAH RV V  +R A   E+ PE ++  ++       
Sbjct: 253 ASPAHQSRHNLIYWRGGDWIGAGPGAHGRVSVAGNRYATEAERRPEGYMAGMQMLQEGWA 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           +   L     A E L MGLR  EG+ ++  E+++G+ +  E       QG++ ++Q S L
Sbjct: 313 DAAKLPPLDIAREILAMGLRAAEGVDLRRVEIVSGKKVSREKIGVFTEQGWV-KLQGSEL 371

Query: 377 RCTQRGMTMLDSVIANLA 394
             T+ G  + D++ + LA
Sbjct: 372 SLTESGRLLADALTSQLA 389


>gi|224075262|ref|XP_002191317.1| PREDICTED: similar to Radical S-adenosyl methionine domain
           containing 1 [Taeniopygia guttata]
          Length = 455

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 224/385 (58%), Gaps = 15/385 (3%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C+K+C YC FN++V    V +       + E Q + +L+   S++S+FFGGGT
Sbjct: 47  LYVHWPYCLKRCSYCRFNTYVV-PAVDEAAVRACLVREAQALLRLSQVHSVTSVFFGGGT 105

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A    +    E+T+EANPSS   +   G+R AGVNRIS+GVQ+L
Sbjct: 106 PSLASPSTVAAVLEAVAGAAHLPPAAEVTLEANPSSTSASRLAGFRAAGVNRISIGVQAL 165

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H A+EA  A+  AR +FP R S DL++ LP Q+   W   L+ AL    
Sbjct: 166 DDAELRLLGREHTAAEARKAVEAARELFPGRTSIDLLFGLPGQSRDAWAQRLEAALGLCD 225

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DH+SLYQLT+E+GT      + G L  P +++  D+Y   +S+  A G   YE+SN +  
Sbjct: 226 DHISLYQLTLERGTALAAQVRSGALPAPPQDLLADMYQTARSVLVASGFRHYEVSNFARK 285

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHS----RVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           GA S HNL+YW+   YIG+GPGAH     R + G  R A      P +W++ V+  GH  
Sbjct: 286 GALSTHNLSYWQGDQYIGVGPGAHGRFVPRAEGGCSREARVQTLEPVAWMREVQSQGHGT 345

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC-------ERNLQRQGFI 368
             +  LS  +Q +E L + LR  EGI+ + W   +   L ++         R LQ++G++
Sbjct: 346 RSRVVLSPLEQLEELLSLALRTDEGITHERWGHFS-PQLSLQAVFGQPGEARALQQEGWL 404

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANL 393
             +    LRCT  G+ +LDS++ +L
Sbjct: 405 V-LDSGGLRCTWAGLAVLDSLLPDL 428


>gi|83945044|ref|ZP_00957410.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Oceanicaulis alexandrii HTCC2633]
 gi|83851826|gb|EAP89681.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Oceanicaulis alexandrii HTCC2633]
          Length = 386

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 221/380 (58%), Gaps = 12/380 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           LG+YVHWP+C + CPYCDFN + +      E  + + L ++   R   G R + S+ FGG
Sbjct: 8   LGLYVHWPYCARICPYCDFNVY-KAAHAQPEALLDAMLRDLAHWRARLGARPVHSVHFGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP  IA IL+     + ++   EI +EANP  +E   F+G   AGV R+SLGVQ
Sbjct: 67  GTPSLMEPSAIAAILEQADALFGLAPGAEIGLEANP--MEHERFEGIATAGVERLSLGVQ 124

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L++ SL+ LGR+H+A   + A+  A+++F  +S DLIYA   QT   W  EL+ AL + 
Sbjct: 125 ALDDDSLKALGRDHDARTGLQALECAQSLFKHVSLDLIYARENQTPEGWRAELETALGFG 184

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             H+SLYQLTIE GT F +  K G L  P ++ A D+Y LTQ + ++ GL +YEISNH+ 
Sbjct: 185 TGHMSLYQLTIEPGTAFARKLKRGALTPPPDDAAADMYALTQDVCASAGLPSYEISNHAR 244

Query: 259 LGAE-SLHNLNYWRYGDYIGIGPGAHSRV--KVGSHRVAISIEKHPESWLKMV-RKNGHA 314
             A+ S+HN  YW   D+IGIGPGAHSRV       R   +  + PE +++ V   +GH 
Sbjct: 245 SAADQSVHNRLYWEGEDWIGIGPGAHSRVGAHASGGRGGAAAHRRPEHYMEGVLSGDGH- 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLR-EGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
             E+E L +E +  E L+MG+RL   G+ V     L G + D +    +  QG I +   
Sbjct: 304 --ERETLDAEAEFIERLLMGIRLTGSGLDVARLHALTGLSPDAQGLARMTAQGLI-KAGD 360

Query: 374 SRLRCTQRGMTMLDSVIANL 393
           S L  T+RG    D V   L
Sbjct: 361 SALVLTERGRAFADHVAETL 380


>gi|163737988|ref|ZP_02145404.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Phaeobacter gallaeciensis BS107]
 gi|161388604|gb|EDQ12957.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Phaeobacter gallaeciensis BS107]
          Length = 312

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 3/313 (0%)

Query: 84  IEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQ 143
           + P  +A I++   + W  S+++EI++EANP+SVE   F GYR AGVNRIS+G+Q+L + 
Sbjct: 1   MHPDTVATIIETAREIWPFSNDIEISLEANPTSVEAGRFTGYRDAGVNRISMGIQALNDG 60

Query: 144 SLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
            L  LGR H+ SEA  A  +AR  F R+SFDLIYA   QT+  W+ EL +ALS A+DHLS
Sbjct: 61  DLHRLGRMHSVSEAQNAFDVARKCFDRVSFDLIYARQGQTLVGWQQELDQALSMAIDHLS 120

Query: 204 LYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAE 262
           LYQLTIE+GT F   +  G L  LPS++ A D+Y  TQ I   HGL AYE+SNH+  GAE
Sbjct: 121 LYQLTIEEGTAFGDRYARGKLRDLPSDDNAADMYLTTQEICDKHGLPAYEVSNHARPGAE 180

Query: 263 SLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLS 322
           S HNL YWRYGDY+GIGPGAH R+ +   R A      P +WL    +N      +  L+
Sbjct: 181 SRHNLIYWRYGDYLGIGPGAHGRLTLDGTRYATETYLQPGAWLAAA-ENHTGECSRIPLT 239

Query: 323 SEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRG 382
            E  + E+LMMG+RL EG+ +  +  ++GR L  E   NL+  G +E +  +R++ T  G
Sbjct: 240 PEDASAEYLMMGMRLVEGLDLDRFRAISGRTLSSERISNLREIGMVE-LSDNRIQATDAG 298

Query: 383 MTMLDSVIANLAV 395
             +L++V+ +L V
Sbjct: 299 RAVLNAVLRDLLV 311


>gi|329896511|ref|ZP_08271569.1| Coproporphyrinogen III oxidase, oxygen-independent [gamma
           proteobacterium IMCC3088]
 gi|328921728|gb|EGG29101.1| Coproporphyrinogen III oxidase, oxygen-independent [gamma
           proteobacterium IMCC3088]
          Length = 380

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/379 (40%), Positives = 219/379 (57%), Gaps = 13/379 (3%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
           G+Y+H+P+C +KCPYCDFNSHV    + +   + + + +     ++ G R I S+F GGG
Sbjct: 8   GLYIHFPWCERKCPYCDFNSHVSGQALPEAEMVTALINDYTSDLEIYGARPIDSLFIGGG 67

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSLI  Q+IA +LDGI +   +S   EIT+EANP S E   F GYR AGVNR+S+G+QS
Sbjct: 68  TPSLISAQSIARLLDGIDRLTPLSDTTEITMEANPGSSEQEKFAGYRAAGVNRLSIGIQS 127

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + LR LGR H+  EA  AI  A+   F R++ DL+Y LP QT+ Q   ++++ LSY 
Sbjct: 128 FNSEHLRRLGRIHSRDEADHAIKAAQAAGFERINIDLMYGLPDQTLKQALHDVEQGLSYN 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLS YQLTIE  T+FYK        LP ++   D+ +  +   +  GL  YE+S  + 
Sbjct: 188 TGHLSWYQLTIEPNTVFYKQRPP----LPDDDAIADIADEGEHFMTQSGLKRYEVSAFAG 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G E  HN+NYWR+GDY GIG GAH ++    H +  + ++ P+S+L+   +     VE 
Sbjct: 244 TGQECRHNVNYWRFGDYFGIGAGAHGKISFNDHIIRTAKQRMPDSYLQASDRASRLAVES 303

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE----RNLQRQGFIERVQFS 374
             L   Q   EF++  LRLREG+ +  ++   G  L  EC     R LQ QG +      
Sbjct: 304 A-LDQAQLISEFMLNALRLREGVEIALFQRSTG--LAPECMHHTWRRLQAQGLMVEGD-D 359

Query: 375 RLRCTQRGMTMLDSVIANL 393
           RL+ T+ G   L++VI + 
Sbjct: 360 RLQTTELGWRFLNTVIESF 378


>gi|197106936|ref|YP_002132313.1| oxygen-independent coproporphyrinogen III oxidase [Phenylobacterium
           zucineum HLK1]
 gi|196480356|gb|ACG79884.1| oxygen-independent coproporphyrinogen III oxidase [Phenylobacterium
           zucineum HLK1]
          Length = 380

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 151/379 (39%), Positives = 220/379 (58%), Gaps = 12/379 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQS-FLTEMQWMRQLTGPRSISSIF 75
             +GVYVHWP+C + CPYCDFN +  R +  +   + S  + +++    LTGPR + S+F
Sbjct: 10  GPVGVYVHWPYCARICPYCDFNVYRARGREAEARALASAIIADLRAQAALTGPRELVSVF 69

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P     I+    + W+ ++++E+++EANP+  E + F  +  AGVNR+SL
Sbjct: 70  FGGGTPSLMDPAWAGEIVAEAKRLWSPAADLEVSLEANPTDAEADRFAAFADAGVNRLSL 129

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L++++L+ LGRNH A E   A   A   FPR+S DLIYA P QT   W  EL  AL
Sbjct: 130 GLQALDDEALKLLGRNHGAEEGRRAARAAARAFPRLSVDLIYARPGQTPQAWAGELAAAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
               +H+S YQLTIE GT F +  + G +V P+E  A +L+  TQ++  A G  AYE+SN
Sbjct: 190 DLGPEHVSPYQLTIEAGTAFDRAVRRGTIVPPAEEPAAELFETTQAVLEAAGFDAYEVSN 249

Query: 256 HS-FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           H+    A S HNL YW+  DY+G+GPGAH R+     R+A      P  +++       A
Sbjct: 250 HARGEAARSRHNLVYWQGLDYVGVGPGAHGRITTPEGRLATFAAPRPADYIE------GA 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFS 374
              +E L+  + A+E L+ GLR+ EG+   +   LA     I    +L   G +     S
Sbjct: 304 GGSRERLTPVEAAEERLLGGLRIAEGVGRDEIAALALPEGRIA---HLVELGLLAD-DPS 359

Query: 375 RLRCTQRGMTMLDSVIANL 393
           RLR T  G  +LD+V   L
Sbjct: 360 RLRATAEGRRLLDAVTRAL 378


>gi|196016273|ref|XP_002117990.1| hypothetical protein TRIADDRAFT_13916 [Trichoplax adhaerens]
 gi|190579463|gb|EDV19558.1| hypothetical protein TRIADDRAFT_13916 [Trichoplax adhaerens]
          Length = 343

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 212/339 (62%), Gaps = 5/339 (1%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           VY+HWP+C K C YC+FN  V++  V  +   +  +  ++ + QL   +++ SI+FGGGT
Sbjct: 1   VYIHWPYCKKHCHYCNFNKVVQQL-VDHDRMTECMIRAVKGLLQLGHVKTVKSIYFGGGT 59

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL +P NI  ++  I++  T+  ++EIT+EANP+S E+     +++AG+NR+SLG+Q+L
Sbjct: 60  PSLCKPDNIQRMISAISQCATLGDDIEITMEANPTSTEMEKMGHFKQAGINRLSLGIQAL 119

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            ++ L+ LGR+H+A++A  AI +A+  FP R S DLI+A P QT+ +W  EL++A+S   
Sbjct: 120 NDKDLQILGRDHDAAQAKQAIDIAKAHFPKRTSIDLIFARPNQTIPEWSTELEKAISMCD 179

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           +H+SLYQLT+E+GT  +K  +   L LP E++   +Y    +    +G   YE+SN +  
Sbjct: 180 NHVSLYQLTLERGTKLHKQVQQQSLHLPDEDIIAQMYENAINTMRRYGYQRYEVSNFAKQ 239

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGS---HRVAISIEKHPESWLKMVRKNGHAVV 316
           GA S HNL+YW   DYIG+GPGAH R+ + S    R A+     P  W+ MV +    + 
Sbjct: 240 GAISQHNLSYWTSNDYIGVGPGAHGRLIIPSLEYQRYAMIQCLSPNHWMTMVEQGKLGIQ 299

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
           + +  S  ++  E +++G+R   GIS K W+ +A   L+
Sbjct: 300 KMQKQSEMERLTELILLGMRTPAGISRKRWDSIASPKLE 338


>gi|327265063|ref|XP_003217328.1| PREDICTED: MYCBP-associated protein-like [Anolis carolinensis]
          Length = 1025

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 137/336 (40%), Positives = 206/336 (61%), Gaps = 6/336 (1%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +Y+HWP+C K+C YC+FN ++ R  + +       + E + + Q +  + I+S++FGGG
Sbjct: 94  ALYLHWPYCEKRCSYCNFNKYIPR-NIDESRMRNCLIQEARTLIQFSQVQRITSVYFGGG 152

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL  P  IA +LD I+++  V+   EIT+EANP+S +      ++KAGVNR+S+G+QS
Sbjct: 153 TPSLASPLTIAAVLDAISRDVFVAEGTEITLEANPTSADALCLAEFQKAGVNRLSVGIQS 212

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYA 198
           L +  L+ LGRNH+A EA+  +  A+ +FP R+S DLI+ LP QT   W  +L+  L+  
Sbjct: 213 LNDAELQLLGRNHSAYEALRTLEEAKKLFPGRISVDLIFGLPDQTTASWVQDLEALLAMC 272

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DH+SLYQLT+E+GT  +K    G L LP  ++  ++Y   ++I    G H YE+SN + 
Sbjct: 273 DDHISLYQLTLERGTSLFKQVHQGFLPLPDPDIVSEMYECARNILQNAGFHQYEVSNFAR 332

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSR-VKVGS---HRVAISIEKHPESWLKMVRKNGHA 314
            GA S HNL+YWR   YIG+GPGAH R V  G+   +R A      P+ W+K V   GH 
Sbjct: 333 NGALSTHNLSYWRGSQYIGVGPGAHGRFVPWGNGKVYREARIQTLEPDIWMKEVLAFGHG 392

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA 350
             ++  L+  +  +E LM+GLR+  GI+ + W   A
Sbjct: 393 TRKQTPLTRLEILEEVLMLGLRMDVGITHQHWLQFA 428


>gi|303258093|ref|ZP_07344101.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderiales bacterium 1_1_47]
 gi|302859112|gb|EFL82195.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderiales bacterium 1_1_47]
          Length = 379

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 135/375 (36%), Positives = 209/375 (55%), Gaps = 6/375 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+HWP+C+KKCPYCDFNSH  R    +  +  + +  ++          + SIFFG
Sbjct: 5   PLSLYIHWPWCLKKCPYCDFNSHGLRGPAPEALYEAAIIEGLKEQGARVQRGKLKSIFFG 64

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ I  I++    N     N+EIT+EANP + E   F+ +R+AGVNR+S+G+
Sbjct: 65  GGTPSLMAPETIGRIIEAADNNIPFHENIEITLEANPGTFEEQKFKDFREAGVNRLSIGI 124

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS ++  LR LGR HN+ EA  A   A  IF   + DL++ LP QT+ + + EL+ A S+
Sbjct: 125 QSFDDAKLRALGRVHNSQEARRAAESAGKIFENFNLDLMFGLPGQTIQELDEELETAFSF 184

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLT+E  T F K    G   +P ++V  D+ +L +  T+A G   YE+S ++
Sbjct: 185 GSTHLSCYQLTLEPNTYFAKFPPKG---IPDDDVLSDMSDLVRDKTAARGFDHYEVSAYA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G    HNLNYW +GDY  +GPGAH ++ +          + P  WL   +++   + E
Sbjct: 242 KGGYRCRHNLNYWEFGDYFAVGPGAHGKITIQGRPERFYNYRDPARWLLSFKEHQTQIAE 301

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFSR 375
           ++ +  E    EF++  LRLREG+    +    G + D+       L+ +G +      R
Sbjct: 302 RKLIDPEDLPFEFMLNALRLREGVPFDFYTERTGLDFDVIESIWTELREKGLVCD-HLKR 360

Query: 376 LRCTQRGMTMLDSVI 390
           ++ T++G   L+ V+
Sbjct: 361 IKTTEKGWLFLNEVL 375


>gi|254437746|ref|ZP_05051240.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Octadecabacter antarcticus 307]
 gi|198253192|gb|EDY77506.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Octadecabacter antarcticus 307]
          Length = 350

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 151/355 (42%), Positives = 222/355 (62%), Gaps = 18/355 (5%)

Query: 46  VGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSN 105
           V Q  +  +F  E+  + +LT  R ++S+FFGGGTPSL++ + +  IL  + K W ++++
Sbjct: 4   VDQTRWAAAFEKEIDRVAELTSDRVLNSVFFGGGTPSLMDVETVDRILARVQKRWRLAND 63

Query: 106 VEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR 165
           +E+T+EANP+S+E   F GYR  GVNR+S+GVQ+L +  LR LGR H+A EA+AA+ +AR
Sbjct: 64  LEVTLEANPTSIEAQRFTGYRDVGVNRVSVGVQALNDTDLRALGRLHSADEALAAVEIAR 123

Query: 166 NIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV 225
             F R+SFDLIYA   QT+ +W+ EL RAL    DHLSLYQLT+E GT F    K G L 
Sbjct: 124 TTFDRVSFDLIYARQNQTVGEWQSELTRALELEPDHLSLYQLTVEDGTSFGDRFKRGLLR 183

Query: 226 -LPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHS 284
            LP+E++  DL+++TQ+     GL AYE+SNH+  G ES HNL YWR GD+ GIGPGAH 
Sbjct: 184 GLPNEDLGADLWDVTQNACVKAGLPAYEVSNHAKRGQESRHNLIYWRSGDWAGIGPGAHG 243

Query: 285 RVKVGSHRVAISIEKHPESWLKMVRKN------GHAVVEKEFLSSEQQADEFLMMGLRLR 338
           R+ +   R      K P  W+  V         G A+V+ + L      +E ++MGLR+ 
Sbjct: 244 RLTLDGIRHETVCVKSPGGWIAQVESGALGLDVGTALVKADIL------EERVIMGLRVV 297

Query: 339 EGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANL 393
           +GI +   E +A +   I    +L   G ++ ++ S+L  T +G  +L++VI++L
Sbjct: 298 DGIEMPA-EWIANKLNKIN---DLVDLGHLKNIK-SKLNVTVQGRPVLNAVISHL 347


>gi|304320168|ref|YP_003853811.1| coproporphyrinogen III oxidase [Parvularcula bermudensis HTCC2503]
 gi|303299071|gb|ADM08670.1| coproporphyrinogen III oxidase [Parvularcula bermudensis HTCC2503]
          Length = 376

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 147/375 (39%), Positives = 212/375 (56%), Gaps = 12/375 (3%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
           G+Y+HWPFC + CPYCDF    R   V ++ +I +FL ++       G R I S++FGGG
Sbjct: 6   GLYLHWPFCDRICPYCDFVV-ARGRDVDEKAWISAFLADLDDSAARWGRRQIVSVYFGGG 64

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ P  +  +L GIA  + ++S+ E+TIE NP+++E    + YR  G+NR+S+GVQS
Sbjct: 65  TPSLLSPHGLNRLLGGIADRYDLASSAEVTIEVNPTALEAQRLRAYRALGINRVSIGVQS 124

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            +++ LRFLGRNH+   A   I  A  +F R++ D IYALP +T+  W   L+  LS  V
Sbjct: 125 FDDEHLRFLGRNHDGGTARGVIDQAAALFDRVTADFIYALPGETIEDWTRRLRAILSLPV 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            HLSLYQLTIE+GT F      G     S+ +A DLY  T   T A G+ AYEIS+H+  
Sbjct: 185 SHLSLYQLTIEQGTAFGLQVDKGRWTPASDAMAADLYQATLEETMAAGMPAYEISSHARP 244

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G E++HN  YW  GD+IGIGPGAH R+     R+A +      ++      +    VE+ 
Sbjct: 245 GHEAVHNRLYWMEGDWIGIGPGAHGRITHQGQRIATAPRVPIRAYCSTPPAD---RVERA 301

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGF-IERVQFSRLRC 378
            L+  +   E L  GLR  +G++  D   L    L+     +  R+G+ I R    R+  
Sbjct: 302 PLTPSEMRVERLAGGLRTLDGVATSDLSFLPPERLE-----DFLREGWLIPRAD--RMTI 354

Query: 379 TQRGMTMLDSVIANL 393
            +    + D +IA L
Sbjct: 355 PRTHWILADGLIARL 369


>gi|156254826|gb|ABU62824.1| radical S-adenosyl methionine domain containing 1 [Danio rerio]
          Length = 444

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 142/390 (36%), Positives = 218/390 (55%), Gaps = 25/390 (6%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C+K+C YC+FN ++ R +   +   +    E + + +L+    I+S+FFGGGT
Sbjct: 46  LYVHWPYCLKRCSYCNFNKYILRSE-NHDTMTECLQKETETLLKLSQVSRITSVFFGGGT 104

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL +   IA +L+ + KN  +S   E+T+E NP+       + +  AGVNR S+GVQSL
Sbjct: 105 PSLAQSSTIAAVLETVTKNSNLSDLAEVTLEVNPTPAGKARLKDFTLAGVNRFSIGVQSL 164

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
               LR LGR+H+   A+  +  AR + P R+S D+++ALP Q+++ W+ +L+  L    
Sbjct: 165 NADHLRILGRDHSVQHALQTVSKARKLCPGRVSVDIMFALPGQSVSCWQKQLEELLYVCD 224

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DH+SLYQLT+E+GT  +K  + G L +P + V   +Y     +    G H YE+SN +  
Sbjct: 225 DHISLYQLTLERGTQLFKQVESGKLSVPGDEVTAVMYKTACRVLEESGFHQYEVSNFARN 284

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV----KVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            A S HN+ YWR   YIG+GPGAH R       G  R A +    P+ W+K V+  G   
Sbjct: 285 NAVSEHNMGYWRGHQYIGVGPGAHGRFVPHGDGGVQREARTQTLEPDVWIKEVQSRGQGT 344

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ----RQGFIERV 371
             +  L   Q  +E L+MGLR+ EGI+ + WE+ +        E NLQ    +   I+ +
Sbjct: 345 RRRITLHHLQLLEEVLVMGLRMNEGITHQHWELFSP-------EANLQQVFGKSANIQEL 397

Query: 372 QFSR--------LRCTQRGMTMLDSVIANL 393
           Q  R        LRC+  G+ +LDS++  +
Sbjct: 398 QGGRFLILDDRGLRCSWEGLVLLDSILPTI 427


>gi|134133302|ref|NP_001077026.1| radical S-adenosyl methionine domain-containing protein 1,
           mitochondrial precursor [Danio rerio]
 gi|187611409|sp|A4IGH2|RSAD1_DANRE RecName: Full=Radical S-adenosyl methionine domain-containing
           protein 1, mitochondrial; AltName:
           Full=Oxygen-independent coproporphyrinogen-III
           oxidase-like protein RSAD1; Flags: Precursor
 gi|134026346|gb|AAI35100.1| Rsad1 protein [Danio rerio]
          Length = 444

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 143/390 (36%), Positives = 219/390 (56%), Gaps = 25/390 (6%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C+K+C YC+FN ++ R +   +   +    E + + +L+    I+S+FFGGGT
Sbjct: 46  LYVHWPYCLKRCSYCNFNKYISRSE-NHDTMTECLQKETETLLKLSQVSRITSVFFGGGT 104

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL +P  IA +L+ + KN  +S   E+T+E NP+       + +  AGVNR S+GVQSL
Sbjct: 105 PSLAQPSTIAAVLETVTKNSNLSDLAEVTLEVNPTPAGKARLKDFTLAGVNRFSIGVQSL 164

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
               LR LGR+H+   A+  +  AR + P R+S D+++ALP Q+++ W+ +L+  L    
Sbjct: 165 NADHLRILGRDHSVQHALQTVSEARKLCPGRVSVDIMFALPGQSVSCWQKQLEELLYVCD 224

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DH+SLYQLT+E+GT  +K  + G L +P + V   +Y     +    G H YE+SN +  
Sbjct: 225 DHISLYQLTLERGTQLFKQVESGKLSVPGDEVTAIMYKTACRVLEESGFHQYEVSNFARN 284

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV----KVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            A S HN+ YWR   YIG+GPGAH R       G  R A +    P+ W+K V+  G   
Sbjct: 285 NAVSEHNMGYWRGHQYIGVGPGAHGRFVPHGDGGVQREARTQTLEPDVWIKEVQSRGRGT 344

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ----RQGFIERV 371
             +  L   Q  +E L+MGLR+ EGI+ + WE+ +        E NLQ    +   I+ +
Sbjct: 345 RRRITLHHLQLLEEVLVMGLRMNEGITHQHWELFSP-------EANLQQVFGKSANIQEL 397

Query: 372 QFSR--------LRCTQRGMTMLDSVIANL 393
           Q  R        LRC+  G+ +LDS++  +
Sbjct: 398 QGGRFLILDDRGLRCSWEGLVLLDSILPTI 427


>gi|156395073|ref|XP_001636936.1| predicted protein [Nematostella vectensis]
 gi|156224044|gb|EDO44873.1| predicted protein [Nematostella vectensis]
          Length = 394

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 141/391 (36%), Positives = 229/391 (58%), Gaps = 26/391 (6%)

Query: 25  WPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLI 84
           WP+C   C +C+FN +VR + +  E   +  + E + + +++G ++I+S++FGGGTPSL 
Sbjct: 1   WPYCKSLCSFCNFNKYVREF-IDHERMKKCLVKECKSLLEISGAKTINSVYFGGGTPSLA 59

Query: 85  EPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQS 144
           +P   + IL+ + +   ++ N E+T+EANP+S E +  + ++ AG+NR+SLGVQSL E  
Sbjct: 60  KPSTFSAILECLQQKGVLNPNAEVTLEANPTSAESHKLRDFKTAGINRLSLGVQSLSEDE 119

Query: 145 LRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
           L  LGR  +  E++ ++ +A+ +FP R+S DL++  PKQT  +WE EL+  L    +H+S
Sbjct: 120 LAVLGRQGSCLESLKSLDMAKVLFPGRVSVDLMFGRPKQTAPEWERELEEILPLCDNHIS 179

Query: 204 LYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAES 263
           +YQLT+ +GT  ++  ++G LV+P  +   DLY  T  +    G + YE+SN +  G ES
Sbjct: 180 IYQLTLHRGTSLFRQVQEGKLVVPDSDQMADLYLTTVDVLEKAGFYQYEVSNFAKPGCES 239

Query: 264 LHNLNYWRYGDYIGIGPGAHSRVKVGS------HRVAISIEKHPESWLKMVRKNGHAVVE 317
            HNL+YWR   YIGIGPGAH R    S       RVA      P SW+K V + GH   +
Sbjct: 240 QHNLSYWRGVPYIGIGPGAHGRFYEMSDKDSKMKRVAWVQTLEPNSWMKEVEEFGHGTRK 299

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDW-------------EMLAGRNLDIECERNLQR 364
           K F S+    +E +M+GLR  EGI  + +             E+  G + D+   R+   
Sbjct: 300 KVFQSNAVILEEIIMLGLRTSEGIPNERFNHYITATSSGSLREIFEGCS-DV---RDFMA 355

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           +G ++ +    LR T  G+ ++D++ A++A+
Sbjct: 356 EGLLQ-LDERGLRATPSGLAVVDTLTASIAL 385


>gi|114571550|ref|YP_758230.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Maricaulis maris MCS10]
 gi|114342012|gb|ABI67292.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Maricaulis maris MCS10]
          Length = 389

 Score =  268 bits (686), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 151/388 (38%), Positives = 216/388 (55%), Gaps = 14/388 (3%)

Query: 11  MTGQG----SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT 66
           MTG G     N+LG+Y+HWP+C + CPYCDFN  V R K   E  + + L +M   R  T
Sbjct: 1   MTGTGDRQLGNALGLYLHWPYCARICPYCDFN--VYRPKGDDEALLSAILADMADWRDKT 58

Query: 67  GPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYR 126
           G R ++S+ FGGGTPSL++P  IA ++D     W      EI +EANP+  +   F    
Sbjct: 59  GGRRLASLHFGGGTPSLMKPDWIARVIDAADSLWGFEDGAEIGLEANPA--DRARFAAIG 116

Query: 127 KAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQ 186
           K GV R+SLGVQS +++ L  LGR+H+ ++A  AI  A + F R+S D+IYA   QT   
Sbjct: 117 KVGVARLSLGVQSFDDRVLAALGRDHDGAQARQAIEAALSAFERVSVDMIYAQSGQTNDA 176

Query: 187 WEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAH 246
           W+ EL  AL+    H+S YQLTIE GT F K  + G+ +    + A  LY  TQ++ ++ 
Sbjct: 177 WKRELGEALTSGAGHVSAYQLTIEPGTAFGKRSERGETLAVDGDGAAVLYEATQTLCASQ 236

Query: 247 GLHAYEISNHSFLGAE-SLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPES 303
           G  AYE+SNH+   A+ S+HN  YW  GD+IG+GPGAH R+   +   RVA +  + P  
Sbjct: 237 GFPAYEVSNHARSPADQSVHNRIYWEGGDWIGVGPGAHGRLGQSTLDGRVATTACRRPID 296

Query: 304 WLKMVRKNGHAVVEK--EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERN 361
           ++  V   G  V     E L+      E   +GLR+ +G+ +       G  L+ E    
Sbjct: 297 YITAVNTTGSGVGADGTERLAPGDDLVERAFLGLRVTDGLDLDHLHRTTGVALNAEAIDR 356

Query: 362 LQRQGFIERVQFSRLRCTQRGMTMLDSV 389
           +   GF++R    RLR T++G  + D V
Sbjct: 357 MIGDGFLQRAGV-RLRLTEQGRLLADRV 383


>gi|91787237|ref|YP_548189.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas sp. JS666]
 gi|91696462|gb|ABE43291.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas sp. JS666]
          Length = 394

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/375 (36%), Positives = 225/375 (60%), Gaps = 12/375 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+C+KKCPYCDFNSH    ++ ++ ++ + + +++    L   R++ SIF GG
Sbjct: 21  LSLYVHLPWCLKKCPYCDFNSHEVSGEMPEQRYLDALIADLEAALPLVWGRTVHSIFIGG 80

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL  PQ I  +L  I     + ++ EIT+EANP + E + F+ +R AGV R+S+GVQ
Sbjct: 81  GTPSLFSPQAIDRLLGDIRARLRLEADCEITLEANPGTFEKDRFKAFRSAGVTRLSVGVQ 140

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S +++ L+ LGR H+ ++AIAA+  A   F   + D++YALP QT+     ++++AL+  
Sbjct: 141 SFDDRHLKALGRVHDRAQAIAAVEEAAQAFDTFNLDIMYALPGQTLDNLAQDMRQALALQ 200

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             H+S+Y LTIE  T F K        +P E++A  + +    +T   GL  YE+S ++ 
Sbjct: 201 PPHISIYHLTIEPNTYFAKFPP----AIPEEDMAYAMLDKITEMTEGAGLQRYEVSAYAR 256

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVVE 317
            G +  HNLNYW++GDY+GIG GAH ++   +HRV   +  + P+ +++     G AV +
Sbjct: 257 AGHQCFHNLNYWQFGDYLGIGAGAHGKLSF-AHRVVRQVRYRDPKLYMEKALA-GDAVTQ 314

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFS 374
           +  +S  +   EF++  LRLREG  ++D+    G  L    ++ L   +R+G +ER  F 
Sbjct: 315 ETEVSRTELPFEFMLNALRLREGFKLQDFCDKTGLPL-TAIQQGLEEGERKGLLER-DFV 372

Query: 375 RLRCTQRGMTMLDSV 389
           R++ T+RG   L+ +
Sbjct: 373 RVKPTERGFDFLNDL 387


>gi|319786146|ref|YP_004145621.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317464658|gb|ADV26390.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 384

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/337 (38%), Positives = 207/337 (61%), Gaps = 7/337 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  R ++  ++++ + + +++    L   R++ S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHGARGELPFDDYVAALVRDLEHDLPLVWGRTVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     I  IL   +     + + EIT+EANP + E + F+GYR AGVNRIS G+
Sbjct: 68  GGTPSLFPAAAIEAILSAASARLRFAPDAEITLEANPGTAEHDRFEGYRAAGVNRISFGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++  L+ LGR H++ EA AA+ LA++  F  ++ DL+YALP Q +   E +L+RA +
Sbjct: 128 QSFDDGCLQRLGRIHDSREAEAAVKLAQDAGFDNLNLDLMYALPGQDLAMAERDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  T+FY     G   +P +++A D+    Q++ +  G   YE S +
Sbjct: 188 LQPAHISHYQLTLEPNTVFYARPPQG---IPDDDLAWDIQEHCQALLAGAGYGHYETSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS--IEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWRYGDY+GIG GAH ++ +G+ +  +     KHP +W+     +  A
Sbjct: 245 ARPGRQCAHNLNYWRYGDYLGIGAGAHGKITLGAEQAILRRWKHKHPATWMAAAGTD-QA 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +   + ++  Q+  E+++  LRL EG ++ D+E+  G
Sbjct: 304 IGGNDRIAPAQRPFEYMLNALRLHEGFALADFEVRTG 340


>gi|89900421|ref|YP_522892.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodoferax ferrireducens T118]
 gi|89345158|gb|ABD69361.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodoferax ferrireducens T118]
          Length = 394

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 206/328 (62%), Gaps = 8/328 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSH-VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           L +YVH P+C+KKCPYCDFNSH +R  ++ ++ ++ + + +++    LT  R++ SIF G
Sbjct: 18  LSLYVHLPWCLKKCPYCDFNSHEMRAAELPEQRYLAALMADLEAALPLTWGRTVHSIFIG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I  +L GI     + +  EIT+EANP S E + F+ +R AGV R+S+GV
Sbjct: 78  GGTPSLFSPEAIDHLLSGIRARLRLEAGCEITLEANPGSFEKDRFRAFRGAGVTRLSVGV 137

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L+ LGR H++++A+AA+  A   F   + DL+YALP QT+   + ++ RAL++
Sbjct: 138 QSFNDSFLKTLGRVHDSAQALAAVEEAAQAFDTFNLDLMYALPGQTLADVKQDMARALTF 197

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  H+S+YQLTIE  T F K        LP ++ A D+ +L   +T + GL  YE+S ++
Sbjct: 198 SPPHISIYQLTIEPNTFFAKYPPP----LPEDDTAYDMLDLITDMTGSAGLQRYEVSAYA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G    HNLNYW++GDY+G+G GAHS++   +HRV   +  + P  +++     GH + 
Sbjct: 254 APGHRCFHNLNYWQFGDYLGLGAGAHSKLSF-AHRVVRQVRFREPGRYMEQALA-GHCLA 311

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVK 344
           + E +S      EF++  LRL++G +++
Sbjct: 312 QDEEVSRADLPFEFMLNALRLKDGFALQ 339


>gi|319778260|ref|YP_004129173.1| Radical SAM family enzyme,coproporphyrinogen III oxidase like
           protein [Taylorella equigenitalis MCE9]
 gi|317108284|gb|ADU91030.1| Radical SAM family enzyme,coproporphyrinogen III oxidase like
           protein [Taylorella equigenitalis MCE9]
          Length = 394

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/341 (37%), Positives = 205/341 (60%), Gaps = 6/341 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSH-VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           L +Y+H P+C++KCPYCDFNSH     ++ +E ++++   ++ +       RSI S+F G
Sbjct: 17  LSIYIHTPWCIRKCPYCDFNSHETTEIELPEEQYLKALEEDLIYNLPHIWGRSIISVFIG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPS++  + I  IL  +     +SS +EIT+EANP++ E   F  YR +G+NR+S+G+
Sbjct: 77  GGTPSILSTKTIDRILQILRNLLNISSEIEITLEANPATFESEKFAAYRSSGINRLSIGI 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS   ++L+ LGR H++  AI A  +A+  F   + D++YALP Q++ + E ++  AL  
Sbjct: 137 QSFNNKNLQALGRVHDSQSAINACEIAKKFFDNFNLDIMYALPDQSLKECEEDIILALQL 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLSLYQLT+E  TLF K       +LPSE+  +D+  +   +T+  G   YEIS ++
Sbjct: 197 ESKHLSLYQLTLEPNTLFSKFPPK---ILPSEDEIIDMEEMIHELTALRGFKRYEISAYA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK--MVRKNGHAV 315
             G + +HN NYW +GDY+GIGPGAHS++      +    EKHP  W+K  M  + G  +
Sbjct: 254 LDGWQCIHNRNYWEFGDYVGIGPGAHSKISFPDKIIREVREKHPIKWIKKCMSDQKGAQI 313

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI 356
           +E   L  E+   EF++  LRL++G+    +E   G ++ +
Sbjct: 314 IEHRELKVEELPFEFMLNALRLKDGVPTNYFEERCGVSMAV 354


>gi|319942265|ref|ZP_08016580.1| coproporphyrinogen oxidase [Sutterella wadsworthensis 3_1_45B]
 gi|319804138|gb|EFW01038.1| coproporphyrinogen oxidase [Sutterella wadsworthensis 3_1_45B]
          Length = 401

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 145/386 (37%), Positives = 214/386 (55%), Gaps = 20/386 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG-----QENFIQSFLTEMQ-WMRQLT--GPRS 70
           L +Y+HWP+CV+KCPYCDFNSH            +  +    L +++ W RQ      R 
Sbjct: 16  LSIYLHWPWCVRKCPYCDFNSHRLPASTADRLAFESAYAAGVLQDLEAWCRQAPEIADRP 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           I SIF GGGTPSL+  + +  +L GI   + ++ + EIT+EANP + E   F+ +R AGV
Sbjct: 76  IVSIFVGGGTPSLMSGETVERLLTGIRSRFRLTEDCEITMEANPGTAESEKFKAFRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+GVQS  ++ LR LGR H A +A AAI +AR  F   + DL+YALP +++   +ME
Sbjct: 136 NRLSIGVQSFSDEKLRRLGRIHTADDARAAIDMARRSFENFNLDLMYALPGESIADLQME 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L  ALS    HLS YQLTIE GT F K   +    LP  +   ++ ++ ++I +  G   
Sbjct: 196 LAEALSSGATHLSCYQLTIEPGTAFEKRLPED---LPDLDETAEMGDVVEAILAQAGYTR 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV----GSHRVAISIEKHPESWLK 306
           YE+S ++  G +  HNLNYW +GDY+  GPGAH ++ V    G   +  +   +P  WL+
Sbjct: 253 YEVSGYAQPGRQCRHNLNYWMFGDYLAAGPGAHGKLSVVNAEGFSILREARRVNPRKWLE 312

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQ 363
            +   G    E  F+  E +  EF++  LRL  G+    +   +G  L+    + ER L+
Sbjct: 313 ALEATGSGAEESHFVPPEDRPFEFMLNALRLLNGVPASLYAERSGLPLESILPQLER-LR 371

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSV 389
           R G +      R+  T+RG+  L  V
Sbjct: 372 RDGLLS-ADPDRIAPTRRGLDFLSDV 396


>gi|301620523|ref|XP_002939612.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial-like [Xenopus (Silurana) tropicalis]
          Length = 438

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/336 (41%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLT-EMQWMRQLTGPRSISSIFFGG 78
            +YVHWP+C K+C YC+FN ++ R     E  I+S L  E + + +L+    I+S+FFGG
Sbjct: 40  ALYVHWPYCEKRCTYCNFNKYIPRSD--NEAAIRSCLVQEARTLIRLSQVHRITSVFFGG 97

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL     IA +L+ +++   +  + EIT+EANP+S E +  Q ++KAGVNR+S+GVQ
Sbjct: 98  GTPSLASHGTIAAVLEAVSQTALLPQDAEITLEANPTSAERSRLQQFQKAGVNRLSVGVQ 157

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSY 197
           SL++Q L  LGR H+ SEA   +  A N+FP R S D+I+ LP Q++  W   L++ L  
Sbjct: 158 SLDDQELLLLGRTHSTSEAQKTLEEACNLFPGRTSVDIIFGLPGQSLASWHRTLRQLLDI 217

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             DH+SLYQLT+E+GT  +KM +DG L  P   VA  +Y   +   S  G   YE+SN +
Sbjct: 218 CDDHVSLYQLTLERGTSLFKMVQDGRLSTPDMEVASQMYEDARRTLSESGFRQYEVSNFA 277

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRV----KVGSHRVAISIEKHPESWLKMVRKNGH 313
             GA S HN++YW    YIGIGPGAHSR       G  R A      PE W+K V   GH
Sbjct: 278 RNGALSAHNMSYWLGKQYIGIGPGAHSRFVPRGSGGQQRQARIQTLEPEPWMKEVMHYGH 337

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEML 349
              +   L+      E L+ GLR   GI+ + W+ +
Sbjct: 338 GTRKVTELNDLDVLSETLVQGLRTDIGITHERWQQI 373


>gi|188990326|ref|YP_001902336.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732086|emb|CAP50278.1| putative coproporphyrinogen dehydrogenase [Xanthomonas campestris
           pv. campestris]
          Length = 385

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 141/379 (37%), Positives = 217/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  ++++ + + ++     L   R + S+FFG
Sbjct: 8   PLALYVHLPWCVRKCPYCDFNSHAAKGALPFDDYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   A     + N+EIT+E NP + E   F GYR AGVNR+S GV
Sbjct: 68  GGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFDGYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++ +L+ LGR H+++EA  AI LA++      + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QSFDDAALQRLGRIHDSAEAERAIKLAQDAGCDNFNIDLMYALPEQTLAQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +A G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPQG---IPDDDDAWDMQEHCQRLLAAAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS--IEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+ +  +     KHP+S+L        A
Sbjct: 245 ARPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEQQVLRRWKHKHPQSYLASAGSTA-A 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERV 371
           +   E + + +   E+++  LRL EG  + D+E   G   + L     R + +   +E  
Sbjct: 304 IGGDEHVPAARLPFEYMLNLLRLHEGFRLSDFEACTGLPAQVLQAPLARAMAQGWLVE-- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QHGRIVPTELGRRFTNDVV 380


>gi|120612224|ref|YP_971902.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Acidovorax citrulli AAC00-1]
 gi|120590688|gb|ABM34128.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Acidovorax citrulli AAC00-1]
          Length = 390

 Score =  263 bits (672), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 221/377 (58%), Gaps = 13/377 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG---QENFIQSFLTEMQWMRQLTGPRSISSIF 75
           L +YVH P+C+KKCPYCDFNSH  R   G   ++ ++ + + +++    L   R++ S+F
Sbjct: 14  LSLYVHLPWCLKKCPYCDFNSHEARGGAGALQEQRYLDALMADLEAALPLVWGRTVHSVF 73

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  PQ I  ++ G+     + ++ EIT+EANP + E + F+ YR AGV R+S+
Sbjct: 74  IGGGTPSLFSPQAIDQLIGGVRARLRLEADAEITLEANPGTFEKDRFRAYRAAGVTRLSV 133

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS +++ L+ LGR H+ ++A+AA+  A   F   + D++YALP Q++   E ++  AL
Sbjct: 134 GVQSFDDRFLQALGRVHDRAQALAAVQEAAQAFDTFNLDIMYALPGQSLEDLERDVALAL 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S    HLS+Y LTIE  T F +       V+P +++A  + +   ++T A GL  YEIS 
Sbjct: 194 SLQPPHLSIYHLTIEPNTYFARFPP----VVPEDDLAYAMLDRITAMTEAAGLRRYEISA 249

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
           +S  G + +HN NYW++GDY+GIG GAH ++   +HRV   +  + P+ +++     G+A
Sbjct: 250 YSRPGHQCVHNTNYWQFGDYLGIGAGAHGKLSF-AHRVVRQVRFRDPQRYMEQALA-GNA 307

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
           V +   +       EF++  LRLREG +++D+    G  L           R+G I R  
Sbjct: 308 VAQDHEVRRADLPFEFMLNALRLREGFALQDFMDRTGLPLSAIAGALDEAGRKGLIVR-D 366

Query: 373 FSRLRCTQRGMTMLDSV 389
            +R+R T+RG   L  +
Sbjct: 367 AARVRPTERGFDFLSDL 383


>gi|229525146|ref|ZP_04414551.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae bv. albensis VL426]
 gi|229338727|gb|EEO03744.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae bv. albensis VL426]
          Length = 391

 Score =  263 bits (672), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+AK       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAKRIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S LG +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKLGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLATLNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|253995544|ref|YP_003047608.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           mobilis JLW8]
 gi|253982223|gb|ACT47081.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           mobilis JLW8]
          Length = 385

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 135/367 (36%), Positives = 213/367 (58%), Gaps = 15/367 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQ---ENFIQSFLTEMQWMRQLTGPRSISSIF 75
           L +Y+H P+CV+KCPYCDFNSH  RYK G+     ++++ + +++        R I SIF
Sbjct: 10  LALYIHIPWCVQKCPYCDFNSHESRYKNGELPEAAYVEALIKDLELSTPKVWGRKIKSIF 69

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL  P+ I  IL  +     +  + EIT+EANP +V++ NF GY++AGVNR+SL
Sbjct: 70  FGGGTPSLFSPEAIDTILSQVRALTPLEYDAEITLEANPGTVDIANFAGYKQAGVNRLSL 129

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS     L+ LGR H+  +AI A  LA   F R++ D++Y LP+Q++     + ++A+
Sbjct: 130 GIQSFNAGYLKALGRIHDDKQAIKAAELALATFDRVNLDVMYGLPQQSLADALADAKQAV 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
               DHLS Y LT+E  T FY    +    LP ++ + ++    ++  + HG   YE S 
Sbjct: 190 QLNPDHLSFYHLTLEPNTPFYHTPPN----LPDDDTSAEMQIEIENFLAQHGYEHYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            +  G+++ HNLNYW++GDY+GIG GAHS++         +  KHP+++++     G+AV
Sbjct: 246 FAKTGSQARHNLNYWQFGDYLGIGAGAHSKLSYHDKITRETRPKHPKAYMEKALA-GNAV 304

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
             +  +S +    EF+M  LRL +G+ +  ++   G NL       +  Q  I+  Q  +
Sbjct: 305 ERESIVSQDALGFEFMMNALRLIDGVPLTLFQQHTGLNL-------MTLQPAIKAAQQKK 357

Query: 376 LRCTQRG 382
           L  T+ G
Sbjct: 358 LLTTENG 364


>gi|311267550|ref|XP_003131622.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial-like [Sus scrofa]
          Length = 442

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 141/393 (35%), Positives = 220/393 (55%), Gaps = 19/393 (4%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           GS    +YVHWP+C K+C YC+FN ++ R  V +    +  +TE Q + +L+G + + S+
Sbjct: 36  GSQRAALYVHWPYCEKRCSYCNFNKYIPR-GVDEAAMRRCLVTEAQTLLRLSGVQRVESV 94

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL  P+ +A +L+ +A+   +  + E+T+EANP+S   +    +R AGVNR+S
Sbjct: 95  FFGGGTPSLASPRTVAAVLEAVAQATHLPVDSEVTLEANPTSAPGSRLAAFRAAGVNRLS 154

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQR 193
           +G+QSL++  L+ LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +LQ 
Sbjct: 155 IGLQSLDDAELQLLGRTHSASDALRTLAEARRLFPGRVSVDLLLGLPAQQVGPWLRQLQE 214

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            L    DH+SLYQLT+E+GT  +   + G L  P   +A ++Y   +++    G   YE+
Sbjct: 215 LLRRCDDHVSLYQLTLERGTALFAQVQQGALPAPDPELAAEMYQQGRAVLREAGFRQYEV 274

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVR 309
           SN +  GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K V 
Sbjct: 275 SNFARNGALSTHNWTYWQCGQYLGVGPGAHGRFIPQGAGGHTREARIQTLEPDNWMKEVM 334

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECER 360
             GH    +  L   +  +E L MGLR   G++ + W+            G + +++   
Sbjct: 335 LFGHGTRRRIRLGELELLEEVLAMGLRTDVGLTHQHWQQFEHQLTLWDVFGASEEVKVLL 394

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANL 393
                    R     LRC+  G+ +LDS++  L
Sbjct: 395 EQCLLLLDHRG----LRCSWEGLAVLDSLLPIL 423


>gi|121590701|ref|ZP_01678033.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 2740-80]
 gi|121547432|gb|EAX57541.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 2740-80]
          Length = 391

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+AK       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAKRIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAALLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S LG +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKLGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|301776703|ref|XP_002923785.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial-like [Ailuropoda melanoleuca]
          Length = 415

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 131/338 (38%), Positives = 198/338 (58%), Gaps = 6/338 (1%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           G +   +YVHWP+C K+C YC+FN ++ R  V +       +TE Q + +L+G + + S+
Sbjct: 9   GGSRAALYVHWPYCEKRCSYCNFNKYIPR-GVEEAAMRSCLVTEAQTLLRLSGVQRVESV 67

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL  P  +A +L+ + +   + ++ E+T+EANP+S   +    +  AGVNR+S
Sbjct: 68  FFGGGTPSLASPNTVAAVLEAVDQISHLPADSEVTLEANPTSASGSKLAAFGAAGVNRLS 127

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQR 193
           +G+QSL++  LR LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +LQ 
Sbjct: 128 IGLQSLDDTELRLLGRTHSASDALQTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQT 187

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            L    DHLSLYQLT+E+GT  +   + G L  P   +  ++Y   +++    G   YE+
Sbjct: 188 LLGCCDDHLSLYQLTLERGTALFTQVQRGTLPAPDPELTAEMYQEGRAVLREAGFRQYEV 247

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVR 309
           SN +  GA S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V 
Sbjct: 248 SNFARNGALSTHNWTYWQCGQYLGIGPGAHGRFVLQGAGGHTREARIQTLEPDNWMKEVM 307

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWE 347
             GH+   +  L   +  +E L MGLR   GI+ + W+
Sbjct: 308 LFGHSTRRRVPLGQLELLEEVLAMGLRTDVGITHQHWQ 345


>gi|121603727|ref|YP_981056.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas naphthalenivorans CJ2]
 gi|120592696|gb|ABM36135.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas naphthalenivorans CJ2]
          Length = 396

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 139/376 (36%), Positives = 219/376 (58%), Gaps = 12/376 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+C+KKCPYCDFNSH    ++ ++ +I + + +++    L   R++ SIF G
Sbjct: 22  PLSLYVHLPWCIKKCPYCDFNSHEAPGELPEQRYIDALVADLEASLPLVWGRTVHSIFIG 81

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  PQ I  +L  I     + ++ EIT+EANP + E + F+ +  AGVNR+S+GV
Sbjct: 82  GGTPSLFSPQAIDRLLGDIRARLRLEADCEITLEANPGTFEKDRFRAFCSAGVNRLSIGV 141

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS ++  L+ LGR H+ ++AIAA+  A   F   + D++YALP QT+     ++++AL+ 
Sbjct: 142 QSFDDVHLKALGRVHDRAQAIAAVEEAAQAFDTFNLDIMYALPGQTLENQAQDMRQALAM 201

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S+Y LTIE  T F K       ++P E+ A  + +    +T   GL  YE+S ++
Sbjct: 202 QPPHISIYHLTIEPNTYFAKFPP----LIPEEDTAYAMLDQITEMTEGAGLQRYEVSAYA 257

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAVV 316
             G    HNLNYW++GDY+GIG GAHS++   +HRV   +    E  L M +   G+AV 
Sbjct: 258 RPGHRCFHNLNYWQFGDYLGIGAGAHSKLSF-AHRVVRQVRAR-EPRLYMDKALAGNAVA 315

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQF 373
           ++  +S      EF++  LRL++G  ++D+    G       ++ L   +R+G IER  F
Sbjct: 316 QETEVSRADLPFEFMLNALRLKDGFKLQDFAEKTGLPF-TAIQKGLEEAERKGLIER-DF 373

Query: 374 SRLRCTQRGMTMLDSV 389
              + T+RG   L+ +
Sbjct: 374 VHAKPTERGFDFLNDL 389


>gi|261380182|ref|ZP_05984755.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria subflava NJ9703]
 gi|284797029|gb|EFC52376.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria subflava NJ9703]
          Length = 391

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 135/374 (36%), Positives = 206/374 (55%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +E +I + LT++Q        R I +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEEAYIDALLTDLQLELPNIWGRPIETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            V H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 197 GVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  VE
Sbjct: 254 KPGMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLAAMQGNPHEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
            + ++SE    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 HKTVASEDLPFEFMMNALRLTDGVPAAMLQERTGVPTAKIMAQIETARQKGLLESDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEQGRLFLNDLL 387


>gi|289668017|ref|ZP_06489092.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 385

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/379 (37%), Positives = 220/379 (58%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E+++ +   ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEDYVDALTRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+TQ E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLTQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+++L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQTYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   + +   R L  QG++ R 
Sbjct: 304 IGGDEIVPRERLPFEYMLNLLRLHEGFRLSDFEASTGLAASVIAVPLARALA-QGWMTR- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QGERVVPTELGRRFTNDVV 380


>gi|148683981|gb|EDL15928.1| radical S-adenosyl methionine domain containing 1, isoform CRA_a
           [Mus musculus]
          Length = 442

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/339 (38%), Positives = 200/339 (58%), Gaps = 6/339 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S    +YVHWP+C K+C YC+FN ++ R  V +       +TE + + +L+G + + S+F
Sbjct: 37  STRAALYVHWPYCEKRCSYCNFNKYIPR-GVEEGTVRNCLVTEARTLLRLSGVQRVESVF 95

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL  P  +A +L+ +A+   + ++ E+T+EANP+S        +  AGVNR+S+
Sbjct: 96  FGGGTPSLASPHTVAAVLEAVAQEVYLPADSEVTLEANPTSAPGPRLAAFGAAGVNRLSI 155

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           G+QSL++  L+ LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +LQ+ 
Sbjct: 156 GLQSLDDAELQLLGRTHSASDALRTLAEARLLFPGRVSVDLMLGLPAQKVEPWLQQLQKL 215

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L +  DHLSLYQLT+E+GT  +   + G L  P  ++A ++Y   +++    G   YE+S
Sbjct: 216 LYHCDDHLSLYQLTLERGTSLFAQVQQGTLPAPDPDLAAEMYQEGRTVLRDAGFRQYEVS 275

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRK 310
           N +  GA S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V  
Sbjct: 276 NFARNGALSTHNWTYWQCGQYLGIGPGAHGRFVPQGTGGHTREARIQTLEPDNWMKEVTL 335

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEML 349
            GH   +   L   +  +E L MGLR   G++ + W+  
Sbjct: 336 FGHGTRKCVRLGKLELLEEVLAMGLRTDVGVTHQHWQQF 374


>gi|71480062|ref|NP_001013399.1| radical S-adenosyl methionine domain-containing protein 1,
           mitochondrial precursor [Mus musculus]
 gi|81862486|sp|Q5SUV1|RSAD1_MOUSE RecName: Full=Radical S-adenosyl methionine domain-containing
           protein 1, mitochondrial; AltName:
           Full=Oxygen-independent coproporphyrinogen-III
           oxidase-like protein RSAD1; Flags: Precursor
 gi|56206623|emb|CAI25588.1| radical S-adenosyl methionine domain containing 1 [Mus musculus]
 gi|187951397|gb|AAI39277.1| Radical S-adenosyl methionine domain containing 1 [Mus musculus]
 gi|223460753|gb|AAI39275.1| Radical S-adenosyl methionine domain containing 1 [Mus musculus]
          Length = 442

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/339 (38%), Positives = 200/339 (58%), Gaps = 6/339 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S    +YVHWP+C K+C YC+FN ++ R  V +       +TE + + +L+G + + S+F
Sbjct: 37  STRAALYVHWPYCEKRCSYCNFNKYIPR-GVEEGTVRNCLVTEARTLLRLSGVQRVESVF 95

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL  P  +A +L+ +A+   + ++ E+T+EANP+S        +  AGVNR+S+
Sbjct: 96  FGGGTPSLASPHTVAAVLEAVAQEVYLPADSEVTLEANPTSAPGPRLAAFGAAGVNRLSI 155

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           G+QSL++  L+ LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +LQ+ 
Sbjct: 156 GLQSLDDAELQLLGRTHSASDALRTLAEARLLFPGRVSVDLMLGLPAQKVEPWLQQLQKL 215

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L +  DHLSLYQLT+E+GT  +   + G L  P  ++A ++Y   +++    G   YE+S
Sbjct: 216 LYHCDDHLSLYQLTLERGTSLFAQVQQGTLPAPDPDLAAEMYQEGRTVLRDAGFRQYEVS 275

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRK 310
           N +  GA S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V  
Sbjct: 276 NFARNGALSTHNWTYWQCGQYLGIGPGAHGRFVPQGTGGHTREARIQTLEPDNWMKEVTL 335

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEML 349
            GH   +   L   +  +E L MGLR   G++ + W+  
Sbjct: 336 FGHGTRKCVRLGKLELLEEVLAMGLRTDVGVTHQHWQQF 374


>gi|78049073|ref|YP_365248.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927892|ref|ZP_08189116.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas perforans
           91-118]
 gi|78037503|emb|CAJ25248.1| putative oxygen-independent coproporhyriogen III oxigenase
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325541732|gb|EGD13250.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas perforans
           91-118]
          Length = 385

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 144/379 (37%), Positives = 219/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDLALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+S+L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAQEHVLRRWKHKHPQSYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   +D    R +  QG++ R 
Sbjct: 304 IGGDEIVPGERLPFEYMLNLLRLHEGFRLSDFEASTGLAACVIDAPLARAVA-QGWMRR- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QDGRVVPTELGRRFTNDVV 380


>gi|21232683|ref|NP_638600.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767295|ref|YP_242057.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21114492|gb|AAM42524.1| oxidoreductase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572627|gb|AAY48037.1| oxidoreductase [Xanthomonas campestris pv. campestris str. 8004]
          Length = 385

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 140/379 (36%), Positives = 216/379 (56%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +     ++++ + + ++     L   R + S+FFG
Sbjct: 8   PLALYVHLPWCVRKCPYCDFNSHAAKGAPPFDDYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   A     + N+EIT+E NP + E   F GYR AGVNR+S GV
Sbjct: 68  GGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFDGYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QSFDDAALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLAQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +A G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPQG---IPDDDDAWDMQEHCQRLLAAAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS--IEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+ +  +     KHP+S+L         
Sbjct: 245 ARPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEQQVLRRWKHKHPQSYLASAGSAAAI 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERV 371
             + E + + +   E+++  LRL EG  + D+E   G   + L     R + +   +E  
Sbjct: 305 GGD-EHVPAARLPFEYMLNLLRLHEGFRLSDFEACTGLPAQVLQAPLARAMAQGWLVE-- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QHGRIVPTELGRRFTNDVV 380


>gi|15640482|ref|NP_230109.1| coproporphyrinogen III oxidase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|153823174|ref|ZP_01975841.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae B33]
 gi|229509071|ref|ZP_04398559.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae B33]
 gi|229519739|ref|ZP_04409182.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae RC9]
 gi|229606251|ref|YP_002876899.1| coproporphyrinogen III oxidase [Vibrio cholerae MJ-1236]
 gi|254850686|ref|ZP_05240036.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
 gi|9654880|gb|AAF93628.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|126519300|gb|EAZ76523.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae B33]
 gi|229344428|gb|EEO09403.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae RC9]
 gi|229353996|gb|EEO18930.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae B33]
 gi|229368906|gb|ACQ59329.1| coproporphyrinogen III oxidase oxygen-independent-like radical SAM
           family enzyme [Vibrio cholerae MJ-1236]
 gi|254846391|gb|EET24805.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
          Length = 391

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 197/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
           SL +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   SLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|326318284|ref|YP_004235956.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323375120|gb|ADX47389.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 416

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 219/378 (57%), Gaps = 13/378 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG---QENFIQSFLTEMQWMRQLTGPRSISSI 74
            L +YVH P+C+KKCPYCDFNSH  R   G   ++ ++ + + +++    L   R++ S+
Sbjct: 39  PLSLYVHLPWCLKKCPYCDFNSHEARGGAGALQEQRYLDALMADLEAALPLVWGRTVHSV 98

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL  P+ I  ++ G+     + ++ EIT+EANP + E + F+ YR AGV R+S
Sbjct: 99  FIGGGTPSLFSPEAIDRLISGVRARLRLEADAEITLEANPGTFEKDRFRAYRTAGVTRLS 158

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQS +++ L+ LGR H+ ++A+AA+  A   F   + D++YALP Q++   E ++  A
Sbjct: 159 VGVQSFDDRFLQALGRVHDRAQALAAVQEAAQAFDTFNLDIMYALPGQSLEDLEQDVALA 218

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           LS    HLS+Y LTIE  T F K       V+P +++A  + +    +T   GL  YEIS
Sbjct: 219 LSLQPPHLSIYHLTIEPNTYFAKFPP----VVPEDDLAYAMLDRITEMTETAGLRRYEIS 274

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGH 313
            ++  G + +HN NYW++GDY+GIG GAH ++   +HRV   +  + P+ +++     G+
Sbjct: 275 AYARPGHQCVHNTNYWQFGDYLGIGAGAHGKLSF-AHRVVRQVRFRDPQRYMEQALA-GN 332

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
           AV +   +       EF++  LRLREG +++D+    G  L           R+G I R 
Sbjct: 333 AVAQDHEVRRADLPFEFMLNALRLREGFALQDFADRTGLPLSAIAGALDEAGRKGLIVR- 391

Query: 372 QFSRLRCTQRGMTMLDSV 389
             +R+R T+RG   L  +
Sbjct: 392 DAARVRPTERGFDFLSDL 409


>gi|300690922|ref|YP_003751917.1| coproporphyrinogen dehydrogenase [Ralstonia solanacearum PSI07]
 gi|299077982|emb|CBJ50623.1| Coproporphyrinogen dehydrogenase [Ralstonia solanacearum PSI07]
          Length = 424

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/384 (37%), Positives = 220/384 (57%), Gaps = 14/384 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + +E F+ +   +++    +   R + +
Sbjct: 40  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEPGIPEERFLAAIRQDLEAALPMVWGRRVHT 99

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+    +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 100 IFIGGGTPSLLSAHGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 159

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  LR LGR H+A+EA AAI LAR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 160 SIGIQSFNDAHLRALGRIHSAAEARAAIDLARAHFDNINLDLMFALPGQTLAECEADVEA 219

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +  G   YE+
Sbjct: 220 ALSFDTSHVSLYHLTLEPNTYFAKHPP----ALPDDDTAFAMQDWIHARLAGAGYEHYEV 275

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  KHPE++L+     G
Sbjct: 276 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVIREMRHKHPETYLRQAETAG 334

Query: 313 HA--VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGF 367
            A  V E+  + +     EF++  LRL +G  V  ++   G   R+++ E +   QR G 
Sbjct: 335 GAAMVQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLRSIERELDAAEQR-GL 393

Query: 368 IERVQFSRLRCTQRGMTMLDSVIA 391
           + R   + +R T+ G   L+ + A
Sbjct: 394 LARDHVA-IRPTELGQRFLNDLQA 416


>gi|229519841|ref|ZP_04409275.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae TM 11079-80]
 gi|229343129|gb|EEO08113.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae TM 11079-80]
          Length = 391

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/348 (40%), Positives = 197/348 (56%), Gaps = 11/348 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSI 71
           S  L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR +
Sbjct: 4   SPPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLL 63

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV 
Sbjct: 64  HSIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVT 123

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEME 190
           RIS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +
Sbjct: 124 RISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKISLNSFNLDLMHGLPDQTPEQALAD 183

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   
Sbjct: 184 LDQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQ 239

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR 309
           YEIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  + 
Sbjct: 240 YEISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALN 299

Query: 310 KNGHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
               A ++ E L ++Q    EF M   RL E     D+ +  G  +D+
Sbjct: 300 NLAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTVTTGLTIDV 347


>gi|328867221|gb|EGG15604.1| hypothetical protein DFA_10446 [Dictyostelium fasciculatum]
          Length = 470

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 156/413 (37%), Positives = 228/413 (55%), Gaps = 45/413 (10%)

Query: 9   NNMTG--QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT 66
           NN  G  Q  + + +Y+HWP+C K C YC FN ++    V      QS +TE+  + +L 
Sbjct: 45  NNEDGISQREHPISIYIHWPYCSKICGYCSFNKYLDGPHVDHSRMKQSMITELSNLIKLY 104

Query: 67  GPRS----------ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSN---VEITIEAN 113
            P S          + SI+FGGGTPSL     ++ I++ + + +  ++N   +EI +EAN
Sbjct: 105 YPSSSSINNNIQYKLKSIYFGGGTPSLATIDTLSSIVETVYQYFPTTTNRKDLEINLEAN 164

Query: 114 PSSVEVNNFQGYRK-AGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMS 172
           P +++ N  +  +   GVNR+SLGVQ+L ++ L+FLGR HN  +AI +I +  +IF R+S
Sbjct: 165 PDAMDKNYLKDLKDIVGVNRLSLGVQALNDEDLKFLGRTHNTKQAIESIEICNSIFDRVS 224

Query: 173 FDLIYALPKQ-TMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYK---MHKDGDLVLPS 228
           FD+IYA   Q ++ QW  EL+ A+  +  HLSLY LT E GT F+K    H+   ++ P+
Sbjct: 225 FDMIYARRGQHSVEQWRQELKLAVQLSKGHLSLYNLTFEDGTAFFKRLRKHRSNHIIKPT 284

Query: 229 ENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV 288
            +     Y      T   G++ YEISN S  G  S HNLNYWR GDYIGIGPGA SRV V
Sbjct: 285 NDQCSLHYMAAIEETEKVGMNQYEISNFSIPGHHSQHNLNYWRGGDYIGIGPGACSRVSV 344

Query: 289 ------------GSHRVAISIEKHPESWLKMVRKNGHAVVEKE--FLSSEQQADEFLMMG 334
                          +VA+    HP++W+  V  NGH + E E   LS + + +E L+MG
Sbjct: 345 FNNNNQQDNTNLKPEKVALKTIIHPKTWMDRVEANGHGLFEAETTTLSFKDRINELLLMG 404

Query: 335 LRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLD 387
           LR +EG+S   +  L+   LD E          ++ +  SRL+    GM +LD
Sbjct: 405 LRTKEGVSRSTFRYLS-HGLDFE--------QVLDPIVLSRLQSI--GMIVLD 446


>gi|289662150|ref|ZP_06483731.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 385

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/379 (37%), Positives = 220/379 (58%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E+++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEDYVDALIRDLDADLPLAWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+++L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQTYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   + +   R L  QG++ R 
Sbjct: 304 IGGDEIVPRERLPFEYMLNLLRLHEGFRLSDFEASTGLAASVIAVPLARALA-QGWMTR- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QGERVVPTELGRRFTNDVV 380


>gi|229512517|ref|ZP_04401988.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae TMA 21]
 gi|229350410|gb|EEO15359.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae TMA 21]
          Length = 391

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 197/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+      ++EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIVFKPDIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|187929361|ref|YP_001899848.1| coproporphyrinogen III oxidase [Ralstonia pickettii 12J]
 gi|309781784|ref|ZP_07676517.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia sp.
           5_7_47FAA]
 gi|187726251|gb|ACD27416.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia
           pickettii 12J]
 gi|308919425|gb|EFP65089.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia sp.
           5_7_47FAA]
          Length = 422

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/382 (37%), Positives = 222/382 (58%), Gaps = 14/382 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH    + + +E F+ +   +++    +   R + +
Sbjct: 38  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEQGIPEERFLAAVRQDLEAALPMVWGRHVHT 97

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 98  IFIGGGTPSLLSAQGLDRLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 157

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 158 SIGIQSFNDAYLQALGRIHSAAEARAAIDMARAHFDNINLDLMFALPGQTLAECEADVEA 217

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+  +H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 218 ALSFDTNHVSLYHLTLEPNTYFAKYPP----ALPDDDAAFAMQDWIHARLAAAGYEHYEV 273

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  KHP+++L+     G
Sbjct: 274 SAYAKAGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVIREMRHKHPDTYLRQAETAG 332

Query: 313 HAVV--EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGF 367
            A V  E+  + +     EF++  LRL +G  V  ++   G  L    ER L   +++G 
Sbjct: 333 GAAVMQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLR-SIERQLDAAEQRGL 391

Query: 368 IERVQFSRLRCTQRGMTMLDSV 389
           + R   + +R T+ G   L+ +
Sbjct: 392 LTRDHVA-IRPTELGQRFLNDL 412


>gi|163856586|ref|YP_001630884.1| coproporphyrinogen III oxidase [Bordetella petrii DSM 12804]
 gi|163260314|emb|CAP42616.1| putative porphyrin oxidoreductase [Bordetella petrii]
          Length = 405

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 220/375 (58%), Gaps = 10/375 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L VYVH P+CV+KCPYCDFNSH    ++ +  ++ +   +++        R + S+F GG
Sbjct: 32  LSVYVHVPWCVRKCPYCDFNSHAAPAELPERAYLDALRADLEQALPSVWGRQVVSVFLGG 91

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +  +L  +     V  + EIT+EANP + E   F+ Y  +GVNR+SLG+Q
Sbjct: 92  GTPSLLSAAGLDELLAMLRACLNVLPDAEITMEANPGTAEAGRFRDYAASGVNRLSLGIQ 151

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S ++  L+ LGR H+AS+A AAI +A+    R++ DL++ALP Q MT    ++++ALS+ 
Sbjct: 152 SFDDAQLKKLGRIHDASQARAAIEMAQRAVDRVNLDLMFALPGQDMTACLDDVRQALSFG 211

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++   A GL  YE+S ++ 
Sbjct: 212 TEHLSLYHLTLEPNTVFAKYPPE----LPDDDASAAMQDAVEAALQAAGLLRYEVSAYAR 267

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL-KMVRKNGHAVVE 317
            GA   HNLNYW +GDY+G+GPGAH ++      V  +  ++P+SW+   + ++G  + E
Sbjct: 268 PGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRIVREARLRNPDSWMAAAIARDGSHIAE 327

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQFS 374
              +  ++   EF++  LRL++G++   ++   G +L     + LQ   ++G ++    +
Sbjct: 328 ARTVGPDELPFEFMLNALRLKDGVAASSFQERTGLSL-AAIAQPLQAATKRGLLD-PDPT 385

Query: 375 RLRCTQRGMTMLDSV 389
           RLR T  G   L+ +
Sbjct: 386 RLRATPLGWRFLNDL 400


>gi|258620718|ref|ZP_05715753.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM573]
 gi|258586916|gb|EEW11630.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM573]
          Length = 394

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 197/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLTSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +++
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEV 347


>gi|294667392|ref|ZP_06732610.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292602833|gb|EFF46266.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 385

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/379 (37%), Positives = 219/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEEYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPAHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQGLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+S+L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   ++    R +  QG++ R 
Sbjct: 304 IGGDEIVPGERLPFEYMLNLLRLHEGFRLSDFEASTGLAACAIEAPLARAVA-QGWM-RQ 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QDGRVVPTELGRRFTNDVV 380


>gi|294627119|ref|ZP_06705707.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598552|gb|EFF42701.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 385

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/379 (37%), Positives = 219/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEEYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPAHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQGLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+S+L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+ + E+++  LRL EG  + D+E    LA   +     R +  QG++ R 
Sbjct: 304 IGGDEIVPGERLSFEYMLNLLRLHEGFRLSDFEASTGLAACAIKAPLARAVA-QGWM-RQ 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QDGRVVPTELGRRFTNDVV 380


>gi|153826545|ref|ZP_01979212.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae MZO-2]
 gi|149739637|gb|EDM53851.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae MZO-2]
          Length = 391

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKSGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|153828432|ref|ZP_01981099.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae 623-39]
 gi|148876141|gb|EDL74276.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae 623-39]
          Length = 391

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|258625603|ref|ZP_05720485.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM603]
 gi|258582105|gb|EEW06972.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM603]
          Length = 394

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 197/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +++
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEV 347


>gi|319638392|ref|ZP_07993154.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria mucosa
           C102]
 gi|317400141|gb|EFV80800.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria mucosa
           C102]
          Length = 391

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 132/374 (35%), Positives = 206/374 (55%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +E +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHTPWCIKKCPYCDFNSHSLKNGLPEEAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLARLGRVHNGKEALTAIDTALKLFEKVNIDLMYALPNQTVQTALNDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            V H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 197 GVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLAAMQSNPHEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNVLRLTDGVPAATLQERTGVPTAKIMTQIETARQKGLLESDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEQGRLFLNDLL 387


>gi|229530297|ref|ZP_04419685.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae 12129(1)]
 gi|229332070|gb|EEN97558.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae 12129(1)]
 gi|327483309|gb|AEA77716.1| Radical SAM family enzyme, oxygen-independent [Vibrio cholerae
           LMA3894-4]
          Length = 391

 Score =  259 bits (662), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIVFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|121728584|ref|ZP_01681605.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V52]
 gi|153819142|ref|ZP_01971809.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae NCTC 8457]
 gi|227080665|ref|YP_002809216.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae M66-2]
 gi|229507093|ref|ZP_04396599.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae BX 330286]
 gi|298501014|ref|ZP_07010815.1| oxygen-independent coproporphyrinogen III oxidase [Vibrio cholerae
           MAK 757]
 gi|121629140|gb|EAX61583.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V52]
 gi|126510287|gb|EAZ72881.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae NCTC 8457]
 gi|227008553|gb|ACP04765.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae M66-2]
 gi|229355838|gb|EEO20758.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae BX 330286]
 gi|297540262|gb|EFH76322.1| oxygen-independent coproporphyrinogen III oxidase [Vibrio cholerae
           MAK 757]
          Length = 391

 Score =  259 bits (662), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAKLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|254291166|ref|ZP_04961962.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae AM-19226]
 gi|150422860|gb|EDN14811.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae AM-19226]
          Length = 391

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLTRLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|148980494|ref|ZP_01816091.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
 gi|145961219|gb|EDK26533.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
          Length = 395

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 144/385 (37%), Positives = 214/385 (55%), Gaps = 20/385 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++       QL G PR + S
Sbjct: 10  ALSLYVHIPWCVQKCPYCDFNSHALKTEIPEKEYIDALLEDLDTDIEKYQLNGMPRPLHS 69

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAG+ RI
Sbjct: 70  IFFGGGTPSLFSPEGIGRLLQGIEQRIPFKPEIEITMEANPGTIEAERFAGYQKAGITRI 129

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L 
Sbjct: 130 SVGVQSFEQEKLERLGRIHGQDEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADLD 189

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++ L     +  G   YE
Sbjct: 190 KAIELDPPHLSWYQLTIEPNTMFYYKTP----TLPDDDDLWDIFELGHKKLADAGYVQYE 245

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   +  
Sbjct: 246 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQNM 305

Query: 312 GHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-----IECERNLQRQ 365
               +  EF +++E +  EF M   RL E    +D+    G   D     IE  + L   
Sbjct: 306 VKPYISDEFEVANEDRPFEFFMNRFRLMEACPKQDFIDTTGLGFDAVQPTIEWAKEL--- 362

Query: 366 GFIERVQFSRLRCTQRGMTMLDSVI 390
           G++     +  + T++G   L+ ++
Sbjct: 363 GYLNETD-THWQITEKGKLFLNDLL 386


>gi|147675539|ref|YP_001215981.1| coproporphyrinogen III oxidase [Vibrio cholerae O395]
 gi|146317422|gb|ABQ21961.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae O395]
 gi|227012308|gb|ACP08518.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae O395]
          Length = 391

 Score =  259 bits (661), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 195/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|126343210|ref|XP_001376343.1| PREDICTED: similar to Radical S-adenosyl methionine domain
           containing 1 [Monodelphis domestica]
          Length = 537

 Score =  259 bits (661), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 145/389 (37%), Positives = 223/389 (57%), Gaps = 19/389 (4%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           GS S  +YVHWP+C K+C YC+FN ++ R ++ ++      + E   + +L+G + I+S+
Sbjct: 113 GSRSAALYVHWPYCEKRCYYCNFNKYIPR-RLDEDAMRTCLVQEATTLLKLSGVQRINSV 171

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL  P  +A +L+ IA+N  + +  E+T+EANP+S + +    ++ AG+NRIS
Sbjct: 172 FFGGGTPSLASPYTVASVLEAIAQNTHLPAKAEVTLEANPTSSKASRLAAFQVAGINRIS 231

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQR 193
           +G+QSL++  L+ LGR H+ASEA+  +  AR ++P R S DL++ LP Q +  W  +LQ 
Sbjct: 232 IGIQSLDDTELQLLGRTHSASEALGTLEEARRLYPGRTSVDLMFGLPGQQVEPWLGQLQE 291

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            LS   DH+SLYQLT+E+GT  +   + G L  P    A  +Y   + +    G   YE+
Sbjct: 292 LLSRCDDHVSLYQLTLERGTTLFAQVQRGTLPSPDPETAAQMYQDGREVLREAGFRQYEV 351

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV----KVGSHRVAISIEKHPESWLKMVR 309
           SN +   A S HN  YW+ G YIG+GPGAH R       GS R A      P++W+K V 
Sbjct: 352 SNFARNEALSSHNWTYWQGGQYIGVGPGAHGRFVPQGDGGSLREARIQTLEPDNWMKEVS 411

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECER 360
             GH   ++  L   +  +E L +GLR   GI+ + W             G + ++   R
Sbjct: 412 VFGHGTRKRVPLGELELLEEVLALGLRTDIGITHQHWLQFEPHLSLWEVFGESEEV---R 468

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSV 389
            LQ QG +  +    LRC+ +G+ +LD++
Sbjct: 469 ELQSQGLL-LLDPRGLRCSWKGLAVLDTI 496


>gi|145589265|ref|YP_001155862.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047671|gb|ABP34298.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 392

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 133/394 (33%), Positives = 220/394 (55%), Gaps = 23/394 (5%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSH-VRRYKVGQENF-----IQSFLTEMQWM 62
           N +T      L +Y+H+P+C KKCPYCDFNSH ++  K     F     I++ + +++  
Sbjct: 3   NPVTLSALPPLALYIHFPWCEKKCPYCDFNSHQIKDAKSSTNGFDEPRYIKALIADLETE 62

Query: 63  RQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNF 122
                 R + S+F GGGTPSL+ P+ +  +L  +     +  + EIT+EANP SVE   F
Sbjct: 63  LPNIWGRQVHSVFIGGGTPSLLSPEGMDQLLSAVRARINLEPDAEITMEANPGSVEAEKF 122

Query: 123 QGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQ 182
             + K+G+NR+SLG+QS +++ L+ LGR HN +EA  A+ +A + F  ++ DL+Y LP Q
Sbjct: 123 AAFAKSGINRVSLGIQSFQDEQLKALGRIHNGAEAKRAVQIALDHFKSVNIDLMYGLPNQ 182

Query: 183 TMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI 242
            +   + +++ ALS+   HLSLY LT+E  T F          LP+E V   +++    +
Sbjct: 183 NLDSAKTDIETALSFNTPHLSLYNLTLEPNTYFANFPPK----LPNEEVIDAMFDQNVDL 238

Query: 243 TSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPE 302
            S  G   YEIS ++    E  HNLNYWR+GDYIGIG GAH ++   +       E+HPE
Sbjct: 239 LSKAGYRRYEISAYAKKDQECKHNLNYWRFGDYIGIGAGAHGKISYPNKITRQVRERHPE 298

Query: 303 SWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-------RNLD 355
           ++++++   G+A++E   + ++    EF++  LRL +G+    +    G       + L+
Sbjct: 299 TYMQLMESKGNALIESREIEAKDLPFEFMLNTLRLSDGVDTNTYSERTGLPLSTISKGLN 358

Query: 356 IECERNLQRQGFIERVQFSRLRCTQRGMTMLDSV 389
             C++ L  +        S+L+ T +G+  L+++
Sbjct: 359 EACKKGLLDE------NPSKLKATDQGLRYLNNL 386


>gi|21244125|ref|NP_643707.1| coproporphyrinogen III oxidase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21109754|gb|AAM38243.1| oxidoreductase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 385

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 142/379 (37%), Positives = 219/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEAYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPAHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQGLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G  +H +     KHP+S+L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEAHVLRRWKHKHPQSYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   ++    R + + G++ R 
Sbjct: 304 IGGDEIVPGERLPFEYMLNLLRLHEGFRLSDFEASTGLAACAIEAPLARAVAK-GWM-RQ 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QDGRVVPTELGRRFTNDVV 380


>gi|254226316|ref|ZP_04919907.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V51]
 gi|125621178|gb|EAZ49521.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V51]
          Length = 391

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 195/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAECIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|241767031|ref|ZP_04764816.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           delafieldii 2AN]
 gi|241362434|gb|EER58378.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           delafieldii 2AN]
          Length = 418

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/381 (36%), Positives = 217/381 (56%), Gaps = 13/381 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-----FIQSFLTEMQWMRQLTGPRSIS 72
            L +YVH P+C+KKCPYCDFNSH  R   G +      ++ + + +++    L   RS+ 
Sbjct: 39  PLALYVHLPWCLKKCPYCDFNSHEWRSAGGAQELPEARYLDALVADLEAALPLVWGRSVH 98

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSL  PQ+I  ++  I     ++++ EIT+EANP + E + F+ +R AGV R
Sbjct: 99  SIFIGGGTPSLFSPQSIDRLIGDIRARLPLAADCEITLEANPGTFEKDRFRAFRAAGVTR 158

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +S+GVQS  ++ L+ LGR H+ ++A+AA+  A + F   + D++YALP QT+ + E ++ 
Sbjct: 159 LSVGVQSFNDRHLQALGRVHDRAQALAAVQEAASAFDTFNLDIMYALPGQTLQELEQDMA 218

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            AL+ A  HLS+Y LTIE  T F K        +P ++ A  + +    +T   GL  YE
Sbjct: 219 TALALAPPHLSVYHLTIEPNTYFAKYPP----AIPEDDQAYAMLDRITEMTGQAGLARYE 274

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           IS ++  G    HN NYW++GDY+G+G GAHS++      V  +  + P  ++      G
Sbjct: 275 ISAYARPGHACFHNTNYWQFGDYLGLGAGAHSKLSFAHRVVRQARFRDPRLYMDNALA-G 333

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIER 370
            AV   E +       EF++  LRLREG +++D+    G++L          +R+G I R
Sbjct: 334 RAVALDEDVRRADLPFEFMLNALRLREGFALQDFVERTGQSLTAIAGALDEAERKGLITR 393

Query: 371 VQFSRLRCTQRGMTMLDSVIA 391
               R+R T+RG+  L+ + A
Sbjct: 394 -DLGRVRPTERGVDFLNDLQA 413


>gi|297580594|ref|ZP_06942520.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535010|gb|EFH73845.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 391

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 194/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S    +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPSYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSELLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|121611071|ref|YP_998878.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Verminephrobacter eiseniae EF01-2]
 gi|121555711|gb|ABM59860.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Verminephrobacter eiseniae EF01-2]
          Length = 416

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 215/383 (56%), Gaps = 18/383 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRY--------KVGQENFIQSFLTEMQWMRQLTGPR 69
            L +YVH P+C++KCPYCDFNSH  R          + ++ ++ + + +++    L   R
Sbjct: 31  PLSLYVHLPWCLRKCPYCDFNSHALRAGNAGSAAEPLPEQRYLAALMADLEAALPLVWGR 90

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + S+F GGGTPSL  P  I  ++  I     +    EIT+EANP S E   F+ +R AG
Sbjct: 91  MVRSVFIGGGTPSLFSPAAIDQLIGAIRARLPLVPACEITLEANPGSFEKERFRAFRAAG 150

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           V R+S+GVQS  ++ L  LGR H+ ++A+AA+  A   F   + D++YALP QT+ + E 
Sbjct: 151 VTRLSVGVQSFADRHLAALGRVHDRAQALAAVQEAAQAFETFNLDIMYALPGQTLQELEQ 210

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L++AL+    H+S+YQLTIE  T F K        LP +++A  + +    +T   GL 
Sbjct: 211 DLRQALALEPPHISVYQLTIEPNTRFAKFPP----ALPEDDLAYAMLDRITQLTGQAGLA 266

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMV 308
            YEIS ++  G +  HN NYW++GDY+GIG GAHS++   +HRV   +  + P  +++  
Sbjct: 267 RYEISAYARPGQQCAHNTNYWQFGDYLGIGAGAHSKLSF-AHRVVRQVRLREPGRYMEQA 325

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQG 366
              G A+ + E +       EF++  LRL +G + +D+    G  L    E   + +RQG
Sbjct: 326 LA-GRALAQDEEVRRADLPFEFMLNALRLCDGFAPQDFMARTGLPLSAIAEGLASAERQG 384

Query: 367 FIERVQFSRLRCTQRGMTMLDSV 389
            IER    R+R T RG+  L+ +
Sbjct: 385 LIER-SMERIRATPRGLDFLNDL 406


>gi|262403919|ref|ZP_06080476.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC586]
 gi|262349881|gb|EEY99017.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC586]
          Length = 391

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/346 (39%), Positives = 197/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM----QWMRQLTGPRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++    +  +    PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKDDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +++
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEV 347


>gi|302877639|ref|YP_003846203.1| oxygen-independent coproporphyrinogen III oxidase [Gallionella
           capsiferriformans ES-2]
 gi|302580428|gb|ADL54439.1| oxygen-independent coproporphyrinogen III oxidase [Gallionella
           capsiferriformans ES-2]
          Length = 394

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 140/376 (37%), Positives = 219/376 (58%), Gaps = 12/376 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQLTGPRSISSIFFG 77
           L +Y+H P+CVKKCPYCDFNSH  R    ++ ++ + + +++  + Q+ G R + ++FFG
Sbjct: 19  LSLYIHVPWCVKKCPYCDFNSHEARGGFSEKEYVDALIRDLEMALPQIWG-RKVYTVFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + I  IL  +     +S + EIT+EANP +VE   F  +R AGVNR+S+G+
Sbjct: 78  GGTPSLLSGEAITEILRQVRMLLPLSGDAEITLEANPGTVEAAKFAAFRDAGVNRLSMGI 137

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L+ LGR H A EA AAI +A+  F  ++ DL+YALPKQT+ Q   ++Q AL++
Sbjct: 138 QSFNDTHLQALGRIHTADEAKAAIDIAQLHFDNINLDLMYALPKQTLDQALQDVQTALTF 197

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS Y LT+E  TLFY+        LP ++ + D+    +++ + +G   YE S  +
Sbjct: 198 KPQHLSAYHLTLEPNTLFYRNPPS----LPDDDASADMQQAIEALLAENGYQHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
                S HNLNYW++GDY+GIG GAHS++      V  +  K P+++++ V        E
Sbjct: 254 QPNRRSRHNLNYWKFGDYLGIGAGAHSKLSFPDKIVREARYKQPQAYMQQVALGAPVQTE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFS 374
            E +S ++   EF+M  LRL EG     +      +L I  +R L   +++G + R    
Sbjct: 314 HE-VSRDEIPFEFMMNALRLNEGFDAALFCERTSLSL-ISIQRELLDAEKRGLLSR-DIQ 370

Query: 375 RLRCTQRGMTMLDSVI 390
           R+  T +G   L+ ++
Sbjct: 371 RIAPTLQGQRFLNDLL 386


>gi|166713275|ref|ZP_02244482.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 385

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 140/379 (36%), Positives = 221/379 (58%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   +     + N+E+T+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPEAIDRFLQAASARLRFAPNLEMTLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H++++A  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSADAERAIKLAQDAGYDNFNIDLMYALPEQTLLQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLANAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+S+L        +
Sbjct: 245 ARPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   +++   R L  QG++ R 
Sbjct: 304 IGGDEIVPRERLPFEYMLNLLRLHEGFRLNDFEASTGLAASVIEVPLARALA-QGWMSR- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q +R+  T+ G    + V+
Sbjct: 362 QDARVVPTELGRRFTNDVV 380


>gi|241758876|ref|ZP_04756989.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           flavescens SK114]
 gi|241321084|gb|EER57297.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           flavescens SK114]
          Length = 391

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 190/334 (56%), Gaps = 3/334 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +E +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEEAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAKSIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            V H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGELEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  VE
Sbjct: 254 KANMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRSRHPNDYLAAMQSNPHEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           ++ +++E    EF+M  LRL +G+     +   G
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPASTLQERTG 347


>gi|34496382|ref|NP_900597.1| coproporphyrinogen III oxidase [Chromobacterium violaceum ATCC
           12472]
 gi|34102235|gb|AAQ58601.1| probable porphyrin oxidoreductase [Chromobacterium violaceum ATCC
           12472]
          Length = 396

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 139/375 (37%), Positives = 210/375 (56%), Gaps = 9/375 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH+P+C++KCPYCDFNSH  +    +  ++ + L ++++       R ++SIF GG
Sbjct: 19  LALYVHFPWCIRKCPYCDFNSHEPKNGFDEMAYVDALLRDLEYSLPEVWGRPLTSIFMGG 78

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL  PQ +  +L G+     +  + EIT+EANP + E+  F+GYR+AG+NR+S+G+Q
Sbjct: 79  GTPSLFSPQAMDALLAGVRARMKLHPDAEITMEANPGTFEIERFRGYREAGINRLSIGIQ 138

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S   + L+ LGR H+  EA  A+ +A   F  ++ DL+YALP QT+ +   +L  ALSY 
Sbjct: 139 SFNPKHLKALGRIHDGDEAKRAVEIALTHFDNVNLDLMYALPGQTLDEALSDLNTALSYG 198

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + HLS Y LTIE  TLF          LP + V+ D+    +S   A G   YE S  + 
Sbjct: 199 ITHLSAYHLTIEPNTLFAAQTPQN---LPDDEVSADMQEAIESCLEAAGFDHYETSAFAK 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G  S HNLNYW++GDY+GIG GAH ++   +  V     K P ++LK V   G  +   
Sbjct: 256 PGRHSRHNLNYWQFGDYVGIGAGAHGKISSHAGIVRQMRHKQPAAYLKAV-AAGAPLQSS 314

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSR 375
           + ++      EF+M  LRL  G   + ++   G  L +   R L   Q QG ++    + 
Sbjct: 315 QKVARADLPFEFMMNLLRLTSGFESRLFQERTGLPLAL-IRRQLDAAQAQGLLD-TDGAI 372

Query: 376 LRCTQRGMTMLDSVI 390
           LR T +G   L+ ++
Sbjct: 373 LRPTLKGQRFLNDLL 387


>gi|153216271|ref|ZP_01950364.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 1587]
 gi|124114360|gb|EAY33180.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 1587]
          Length = 391

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 195/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGEPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GY  AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYSTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|262191066|ref|ZP_06049273.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio cholerae
           CT 5369-93]
 gi|262033042|gb|EEY51573.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio cholerae
           CT 5369-93]
          Length = 391

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 194/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S    +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPSYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +D+
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 347


>gi|229593141|ref|YP_002875260.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens SBW25]
 gi|229365007|emb|CAY53156.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 379

 Score =  256 bits (655), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 215/377 (57%), Gaps = 14/377 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++         R +SSIFFGG
Sbjct: 7   LALYIHIPWCVRKCPYCDFNSHTASKVLPEEEYVDALLADLDQDLHAVYGRELSSIFFGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL     +  +L G+      +S++EIT+EANP + E   F  YRK G+NR+S+G+Q
Sbjct: 67  GTPSLFSAAALGRLLKGVEARIPFASDIEITLEANPGTFEQEKFVAYRKLGINRLSIGIQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S ++Q L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A++ 
Sbjct: 127 SFQQQKLEALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPDQSLEDALSDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLT+E  T+F+         LP ++   D+    Q++ + HG   YE+S ++
Sbjct: 187 KPTHLSWYQLTLEPNTVFWNQPP----ALPEDDTLWDIQEAGQALLAEHGYAQYEVSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L   +       
Sbjct: 243 QPGRPARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVRTWKTRAPKDYLNPAKSFQAGAK 302

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERVQF 373
           E   L++E+   EFLM  LRL EG+  K +     LA  +LD E  R  ++ G ++ V+ 
Sbjct: 303 E---LTNEELPFEFLMNALRLTEGVEAKLYAERTGLALSSLD-EGRREAEQSGLMQ-VEP 357

Query: 374 SRLRCTQRGMTMLDSVI 390
           SRL  T RG   L+ ++
Sbjct: 358 SRLAATDRGQLFLNDLL 374


>gi|258544888|ref|ZP_05705122.1| oxygen-independent coproporphyrinogen III oxidase [Cardiobacterium
           hominis ATCC 15826]
 gi|258519808|gb|EEV88667.1| oxygen-independent coproporphyrinogen III oxidase [Cardiobacterium
           hominis ATCC 15826]
          Length = 376

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 144/375 (38%), Positives = 205/375 (54%), Gaps = 14/375 (3%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +Y+H P+CV+KCPYCDFNSH  R  + +  +++  L ++        PR I SIF GGGT
Sbjct: 7   LYIHIPWCVRKCPYCDFNSHALRGAIDEAGYVRHLLADLA---HDLDPRPIESIFIGGGT 63

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL     IA +LDGI +   +    EIT+EANP + E   F  YR AGVNR+S+GVQS 
Sbjct: 64  PSLFSAAAIAALLDGINRQSPLPDTCEITLEANPGTFEQAKFADYRAAGVNRLSIGVQSF 123

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           +   L  LGR HN  EAI A+ +A    F R++ DL++ALP Q +     +L++A + A 
Sbjct: 124 DAAQLHALGRIHNRDEAIRAVAIAEKAGFQRINLDLMFALPGQDVAGALADLRQATALAP 183

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           +H+S YQLT+E  T FY         LP  +  +D+Y    +  SAHG   YE S     
Sbjct: 184 EHISWYQLTLEPNTAFYANPP----ALPDSDTQIDIYEAGSAHLSAHGYRQYETSAWR-A 238

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           GA   HNLNYW+YGDY+GIG GAH +          S  + P ++ K      +   ++ 
Sbjct: 239 GAPCRHNLNYWQYGDYLGIGAGAHGKQTRDGVISRSSKYRAPGAYQKAAGNGENPYRDQR 298

Query: 320 F-LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           F +  ++Q  E +M  LRL++GI        +   LD +    L R   QG I+     R
Sbjct: 299 FTVPRDEQPFEIMMNALRLKDGIPTAYLHERSALTLD-DLRPTLARLIAQGLIDPAIEQR 357

Query: 376 LRCTQRGMTMLDSVI 390
           L+ T+RG  +L++V+
Sbjct: 358 LKTTERGFALLNNVL 372


>gi|70733131|ref|YP_262904.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens Pf-5]
 gi|68347430|gb|AAY95036.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas fluorescens Pf-5]
          Length = 400

 Score =  256 bits (654), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 138/377 (36%), Positives = 215/377 (57%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++         R +SSIFFG
Sbjct: 27  PLALYIHIPWCVRKCPYCDFNSHAASPTLPEEEYVDALLADLDQDLHAVHGRELSSIFFG 86

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL   Q +  +L G+ +    + ++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 87  GGTPSLFSAQALGRLLKGVEQRIRFAPDIEITLEANPGTFEQEKFTAYRALGINRLSIGI 146

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +EQ L+ LGR HN  EAI A  +AR   F   + DL++ LP Q++     +L++A++
Sbjct: 147 QSFQEQKLKALGRIHNGDEAIRAAGMARQAGFDNFNLDLMHGLPDQSLDDALGDLRQAIA 206

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+        VLP ++   D+    Q++ + HG   YE+S +
Sbjct: 207 MKPTHLSWYQLTLEPNTVFWNQPP----VLPEDDTLWDIQEAGQALLAEHGYAQYEVSAY 262

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L   ++     
Sbjct: 263 AQPGRAARHNLNYWSFGDFIGIGAGAHGKLSHPDGRILRTWKTRLPKDYLNPAKQ--FKA 320

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            EK  L +E+   EFLM  LRL +G+    +    G +L    E  R  ++ G ++ V+ 
Sbjct: 321 GEKA-LGNEELPFEFLMNALRLTDGVDAALFAQRTGLDLVSLAEGRRQAEQSGLLQ-VEP 378

Query: 374 SRLRCTQRGMTMLDSVI 390
           SRL  T RG   L+ ++
Sbjct: 379 SRLAATARGQLFLNDLL 395


>gi|225075212|ref|ZP_03718411.1| hypothetical protein NEIFLAOT_00212 [Neisseria flavescens
           NRL30031/H210]
 gi|224953387|gb|EEG34596.1| hypothetical protein NEIFLAOT_00212 [Neisseria flavescens
           NRL30031/H210]
          Length = 391

 Score =  256 bits (654), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 130/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +E +I +  T++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEEAYIDALFTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            V H+S Y LT+E  T F      G   LP +  A+D+ +             YE S  +
Sbjct: 197 GVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGADFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  VE
Sbjct: 254 KPGMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLAAMQSNPHEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ ++++    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAKDLPFEFMMNALRLTDGVPAAMLQERTGVPTAKIMAQIETARQKGLLESDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEQGRLFLNDLL 387


>gi|262164092|ref|ZP_06031831.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio mimicus
           VM223]
 gi|262027620|gb|EEY46286.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio mimicus
           VM223]
          Length = 394

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 195/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G A+      ++EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGFAERIAFKPDIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +++
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEV 347


>gi|58580763|ref|YP_199779.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622694|ref|YP_450066.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578266|ref|YP_001915195.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425357|gb|AAW74394.1| oxidoreductase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366634|dbj|BAE67792.1| oxidoreductase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188522718|gb|ACD60663.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 385

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 140/379 (36%), Positives = 219/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P  I   L   +     + N+E+T+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPPDAIDRFLQAASARLRFAPNLEMTLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H++++A  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSADAERAIKLAQDAGYDNFNIDLMYALPEQTLLQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLANAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+S+L        +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLASA-GTAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---LAGRNLDIECERNLQRQGFIERV 371
           +   E +  E+   E+++  LRL EG  + D+E    LA   +++   R L  QG++ R 
Sbjct: 304 IGGDEIVPRERLPFEYMLNLLRLHEGFRLSDFEASTGLAASVIEVPLARALA-QGWMTR- 361

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           Q  R+  T+ G    + V+
Sbjct: 362 QDGRVVPTELGRRFTNDVV 380


>gi|330826507|ref|YP_004389810.1| oxygen-independent coproporphyrinogen III oxidase [Alicycliphilus
           denitrificans K601]
 gi|329311879|gb|AEB86294.1| oxygen-independent coproporphyrinogen III oxidase [Alicycliphilus
           denitrificans K601]
          Length = 410

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 137/382 (35%), Positives = 221/382 (57%), Gaps = 18/382 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQE-----NFIQSFLTEMQWMRQLTGPRSIS 72
            L +YVH P+C++KCPYCDFNSH   +  G E      +  + + +++    L   R++ 
Sbjct: 34  PLSLYVHLPWCLRKCPYCDFNSH---HAPGGEPLPEARYTAALVADLEAALPLVWGRTVQ 90

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           +IF GGGTPSL  PQ+I  +L  I     + ++ E+T+EANP + E   F+ YR AGV R
Sbjct: 91  TIFIGGGTPSLFAPQSIDRLLSDIRARLRLEADCEVTLEANPGTFEKERFRAYRDAGVTR 150

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +S+GVQS  ++ L+ LGR H+ ++A+AA+  A   F   + D++YALP QT  + E +++
Sbjct: 151 LSIGVQSFNDRHLQALGRVHDRAQALAAVEEAAQAFETFNLDIMYALPGQTPAEQEQDMR 210

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +AL+ A  H+S+Y LTIE  T F K        LP ++ A  + +    +T+A GL  YE
Sbjct: 211 QALALAPPHISIYHLTIEPNTYFAKYPPR----LPEDDQAYAMLDRITELTAAAGLSRYE 266

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           +S ++  G + LHN NYW++GDY+GIG GAHS++   +HR+   +  + P+ ++     +
Sbjct: 267 VSAYAREGHQCLHNRNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRLRDPQLYMAGA-LS 324

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIE 369
           G A+ + E +       EF++  LRLREG +++D+    G+ L    +  +  + +G I 
Sbjct: 325 GRAIAQDEDVRRADLPFEFMLNALRLREGFALQDFTERTGQPLTAIAQGLQQAEARGLIA 384

Query: 370 RVQFSRLRCTQRGMTMLDSVIA 391
           R     +R T+RG   L  + A
Sbjct: 385 R-DMGHVRPTERGFDFLSDLQA 405


>gi|171463500|ref|YP_001797613.1| oxygen-independent coproporphyrinogen III oxidase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193038|gb|ACB43999.1| oxygen-independent coproporphyrinogen III oxidase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 393

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 135/391 (34%), Positives = 220/391 (56%), Gaps = 10/391 (2%)

Query: 4   LSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSH-VRRYKVG--QENFIQSFLTEMQ 60
           L++  N +T      L +Y+H+P+C KKCPYCDFNSH +++ K G  +  +I++ + +++
Sbjct: 2   LNSNSNKVTLSALPPLALYIHFPWCEKKCPYCDFNSHQIKKDKSGFDEARYIKALIADLE 61

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
                T  R + SIF GGGTPSL+  + +  +L  I     +    EIT+EANP SVE  
Sbjct: 62  TELPNTWGRQVHSIFIGGGTPSLLSAEGMDQLLCAIRARINLEPAAEITMEANPGSVEAE 121

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
            F G+ +AG+NR+SLG+QS +++ L+ LGR HN  EA  AI +A   F  ++ DL+Y LP
Sbjct: 122 KFAGFAEAGINRVSLGIQSFQDEQLKALGRIHNGEEAKCAIQIALRHFKSVNLDLMYGLP 181

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            QT+   + +++ ALS+   HLS Y LT+E  T F          LPSE+    +     
Sbjct: 182 NQTLELAKADIETALSFKTHHLSFYNLTLEPNTYFASFPPK----LPSEDEIDAIQEQNL 237

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            + +  G   YE+S ++    E  HNLNYWR+GDYIGIG GAH +V           E+ 
Sbjct: 238 DLLTKAGYQHYEVSAYAHKNQECKHNLNYWRFGDYIGIGAGAHGKVSYPDRITRQVRERQ 297

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE- 359
           PE+++  +   G+A++E   ++++    EF++  LRL++G+    +    G  L++  + 
Sbjct: 298 PEAYMTAMESKGNALIENREIAAKDLPFEFMLNALRLKDGVDTSTFSERTGLPLNVISKG 357

Query: 360 -RNLQRQGFIERVQFSRLRCTQRGMTMLDSV 389
                ++G ++    +RL+ T  G+  L+++
Sbjct: 358 LGEASKKGLLDE-NPNRLKATAMGIRYLNNL 387


>gi|325922289|ref|ZP_08184070.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas gardneri
           ATCC 19865]
 gi|325547242|gb|EGD18315.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas gardneri
           ATCC 19865]
          Length = 385

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 132/337 (39%), Positives = 199/337 (59%), Gaps = 7/337 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDNDLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  PQ I   L   A     + N+EIT+E NP + E   F GY  AGVNR+S GV
Sbjct: 68  GGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFDGYLAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLAQAERDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  T+F+     G   +P ++ A D+    Q + +  G   YE+S +
Sbjct: 188 LQPTHMSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+S+L     N  +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEQHVLRRWKHKHPQSYLASA-GNAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +   E +   +   E+++  LRL EG  + D+E   G
Sbjct: 304 IGGDEVVPRARLPFEYMLNVLRLHEGFRLSDFEASTG 340


>gi|291612876|ref|YP_003523033.1| oxygen-independent coproporphyrinogen III oxidase [Sideroxydans
           lithotrophicus ES-1]
 gi|291582988|gb|ADE10646.1| oxygen-independent coproporphyrinogen III oxidase [Sideroxydans
           lithotrophicus ES-1]
          Length = 399

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 128/329 (38%), Positives = 203/329 (61%), Gaps = 5/329 (1%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
           Q    L +Y+H P+CV+KCPYCDFNSH  R  + ++ ++ + + +++    L   R + +
Sbjct: 19  QALPPLSLYIHIPWCVRKCPYCDFNSHAARGAIPEKQYVAALVRDLEMALPLIWGRKVYT 78

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +FFGGGTPSL+  + +A IL  +     +  N EIT+EANP +VE + F  +R+AGVNR+
Sbjct: 79  VFFGGGTPSLLSGEVLAEILRQVRMLLPLDINAEITLEANPGTVEADKFARFREAGVNRL 138

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLG+QS  +  L+ LGR H+++EA +AI +A+  F  ++ DL+YALP+QT+ +   ++Q 
Sbjct: 139 SLGIQSFNDTHLQALGRIHSSAEARSAIGIAQQHFDNINLDLMYALPQQTLEEALQDVQT 198

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL Y   HLS Y LT+E  TLF   H+     LP ++ + D+    +++ + HG   YE 
Sbjct: 199 ALQYRPQHLSCYHLTLEPNTLF--AHQPPP--LPDDDASSDMQLAIEALLATHGYQHYET 254

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S  +  G  S HNLNYW++GDY+GIG GAHS++      +  +  K P+++++ V + G 
Sbjct: 255 SAFAQPGRRSRHNLNYWQFGDYLGIGAGAHSKLSFHDKVLRQARYKQPQAYMEAVAR-GE 313

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGIS 342
            V ++  ++  + A EF+M  LRL EG  
Sbjct: 314 PVQDEHEVAHAELAFEFMMNALRLNEGFD 342


>gi|73542165|ref|YP_296685.1| coproporphyrinogen III oxidase [Ralstonia eutropha JMP134]
 gi|72119578|gb|AAZ61841.1| coproporphyrinogen III oxidase, anaerobic [Ralstonia eutropha
           JMP134]
          Length = 413

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 217/383 (56%), Gaps = 15/383 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-----QENFIQSFLTEMQWMRQLTGPR 69
           GS  L +YVH P+CV+KCPYCDFNSH    K G     ++ ++ +   +++    L   R
Sbjct: 31  GSPPLSLYVHVPWCVRKCPYCDFNSHAVPGKDGSHDIPEDAYLDALRADLEQSLPLVWGR 90

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + ++F GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  YR +G
Sbjct: 91  PVHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEANPGTFEAERFASYRASG 150

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR+S+G+QS  +  L+ LGR H   EA AAI +A+  F  ++ DL+YALP QT+ Q   
Sbjct: 151 VNRLSIGIQSFNDSHLQALGRIHGEREARAAIDIAQRSFDNVNLDLMYALPGQTLEQCRS 210

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+ ALSY   HLSLY LT+E  TLF K        LP +++A ++ +L ++ T+  G  
Sbjct: 211 DLESALSYGTTHLSLYHLTLEPNTLFAKFPP----ALPDDDLAYEMQDLIEARTTEAGYR 266

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE S ++    E+ HNLNYWR+GDY+GIG GAH ++   +  +     KHP +++    
Sbjct: 267 HYETSAYARAHREARHNLNYWRFGDYLGIGAGAHGKLSFPNRILRQMRHKHPATYMAQAM 326

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQG 366
             G+AV E   + +++   EF++  LRL +G+    +  + G  L     R L   +++G
Sbjct: 327 A-GNAVQEAREVGADELPFEFMLNALRLTDGVPASSFHDMTGLPLHA-ISRQLAAAEKKG 384

Query: 367 FIERVQFSRLRCTQRGMTMLDSV 389
            ++    + +R T+ G   L+ +
Sbjct: 385 LLD-ADPTVIRPTELGRRFLNDL 406


>gi|332289357|ref|YP_004420209.1| coproporphyrinogen III oxidase [Gallibacterium anatis UMN179]
 gi|330432253|gb|AEC17312.1| coproporphyrinogen III oxidase [Gallibacterium anatis UMN179]
          Length = 378

 Score =  255 bits (652), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 138/377 (36%), Positives = 211/377 (55%), Gaps = 16/377 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH ++  + Q+ +IQ  L ++         R + SIF GG
Sbjct: 6   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPQQQYIQHLLADLDQQLDFVQQRQLHSIFIGG 65

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL   ++IA +L  IA+    S N+EIT+EANP + E   F GYR+AGV R+S+GVQ
Sbjct: 66  GTPSLFSAESIAFLLAQIAQRIPFSQNIEITLEANPGTAEAERFLGYRQAGVTRLSMGVQ 125

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S  +Q L+ LGR HN++EA  A+  A+   F R + DL++ LP Q++     +L +A++ 
Sbjct: 126 SFHDQQLQLLGRIHNSNEAKKAVDFAKAAGFERFNLDLMHGLPNQSVDSALSDLAQAIAL 185

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A  HLS YQLTIE  TLF          LP ++    ++        A G   YE S ++
Sbjct: 186 APPHLSWYQLTIEPNTLFASKPPR----LPDDDDLWQIFEAGHQKLLAAGYQQYETSAYA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+ IG GAH +V     ++   S  KHP+ +L+     G    
Sbjct: 242 KPGFQCEHNLNYWRFGDYLAIGCGAHGKVSFSDGQILRYSQTKHPKGYLQ-----GQYRY 296

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQF 373
           ++ ++  + +  EF M   RL E +   D+E   G  L++   + +  L++   +ER + 
Sbjct: 297 QQHYVEWQDRPFEFFMNRFRLLEAVPKADFERFTGLGLNVIEKQIDEALKQDYIVERTE- 355

Query: 374 SRLRCTQRGMTMLDSVI 390
              + T+ G   L+ ++
Sbjct: 356 -SWQITEHGKLFLNDLL 371


>gi|260775572|ref|ZP_05884469.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608753|gb|EEX34918.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 392

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/336 (40%), Positives = 196/336 (58%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  +  + ++ +I + L    T+++  +    PR++ S
Sbjct: 8   ALSLYVHIPWCVQKCPYCDFNSHALKADIPEQEYIAALLEDLDTDIERYQLKANPRALHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  Q I+ +L GI K       +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 68  IFIGGGTPSLISAQGISDLLAGIEKRIAFKDEIEITMEANPGTIEAERFAGYRKAGVTRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP QT+ Q  M+L+
Sbjct: 128 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHKIGLNSFNLDLMHGLPDQTVEQALMDLE 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+F+        VLP ++   D++ L     +  G   YE
Sbjct: 188 KAIELNPPHLSWYQLTIEPNTMFHYKPP----VLPDDDDLWDIFELGHQKLAEAGYVQYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S    +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   +  
Sbjct: 244 ISGYSKPEYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQNM 303

Query: 312 GHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDW 346
               ++ E  ++SE +  EF M   RL E    +D+
Sbjct: 304 VKPYLDSEADVASEDRPFEFFMNRFRLMEACPKQDF 339


>gi|331084368|ref|ZP_08333472.1| oxygen-independent coproporphyrinogen III oxidase [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|330401632|gb|EGG81213.1| oxygen-independent coproporphyrinogen III oxidase [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 381

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 132/350 (37%), Positives = 209/350 (59%), Gaps = 6/350 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
              LG+Y+H PFCVKKC YCDF S     +  Q+ ++ + L+E++  R+      +S+IF
Sbjct: 2   KKDLGLYIHIPFCVKKCEYCDFLSWNAEEEERQQ-YVAALLSEIESYREFAKGYRVSTIF 60

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPS++ P+ +  IL  I + + +    EITIE NP +V+    Q Y++ GVNR+S+
Sbjct: 61  IGGGTPSVLLPKQMEDILQKIYEIFELERRAEITIEVNPGTVDEEKLQCYKENGVNRLSM 120

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRA 194
           G+QS++++ LR LGR H   E + +  LAR   F  +S DLI ++P QT+ +W+ EL+ A
Sbjct: 121 GLQSVKDEKLRLLGRIHTYQEFVESYELARKAGFDNISIDLISSVPGQTLQEWKEELETA 180

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
            +   +H+S+YQL IE+GT FY+ + +   +LP E  + ++Y  T       G   YEIS
Sbjct: 181 AAQNPEHISVYQLIIEEGTPFYEKYAEHPELLPDEETSREIYLWTGKFLKEAGYEQYEIS 240

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N++  G ES HNL YW  GDY+G+G GA S V+     + +S  K   ++L+   K    
Sbjct: 241 NYAKPGKESRHNLKYWERGDYLGLGLGAASMVR----NIRMSNTKDMRTYLERCDKPKTM 296

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR 364
             + +FL   +Q +EF+ +GLR   G+S K+++ + GR +D+  E+ L +
Sbjct: 297 REDVQFLEEPRQMEEFMFLGLRKTRGVSKKEFKRIFGREMDMVYEKALHK 346


>gi|315181251|gb|ADT88165.1| hypothetical oxygen-independent coproporphyrinogen III oxidase
           [Vibrio furnissii NCTC 11218]
          Length = 390

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 211/388 (54%), Gaps = 26/388 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  +  + +  +I + L ++       QL G PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKADIPETEYIDALLEDLDTDIERYQLAGDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P  I  +L GI        ++EIT+EANP ++E   F GYR+ GV RI
Sbjct: 66  IFIGGGTPSLISPDGIGRLLRGIEARIAFKPDIEITMEANPGTIEAERFAGYRQVGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT+ Q   +L+
Sbjct: 126 SIGVQSFEPEKLTRLGRIHGRDEAVKAAQLAHQIGLNSFNLDLMHGLPDQTLEQALADLE 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            A+  A  HLS YQLTIE  TLFY         LP ++   D++ L     +A G   YE
Sbjct: 186 SAIELAPPHLSWYQLTIEPNTLFYFKPP----TLPDDDALWDIFELGHQKLTAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   +  
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN- 300

Query: 312 GHAVVEKEFLSSEQQ-AD-----EFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR- 364
               + K +L SEQ  AD     EF M   RL E     D+    G  + +  +  L R 
Sbjct: 301 ----LAKPYLDSEQLVADVDRPFEFFMNRFRLIEPCPKADFSATTGLPISV-IQPTLDRA 355

Query: 365 --QGFIERVQFSRLRCTQRGMTMLDSVI 390
             Q F+   + +  + T++G   L+ ++
Sbjct: 356 IEQEFLSETE-THWQITEKGKLFLNDLL 382


>gi|296476503|gb|DAA18618.1| radical S-adenosyl methionine domain-containing protein 1,
           mitochondrial precursor [Bos taurus]
          Length = 442

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 199/340 (58%), Gaps = 6/340 (1%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           GS    +YVHWP+C K+C YC+FN ++ R  V +    +  + E Q + +L+G R + S+
Sbjct: 36  GSQRAALYVHWPYCEKRCSYCNFNKYIPR-GVDEAALRRCLVIEAQTLLRLSGVRRVESV 94

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL  P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S
Sbjct: 95  FFGGGTPSLASPHTVAAVLEAVAQAAHLPADSEVTLEANPTSASGSRLAAFGAAGVNRLS 154

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQR 193
           +G+QSL++  L+ LGR H+A +A+  +  A+ +FP R+S DL+  LP Q +  W  +LQ 
Sbjct: 155 IGLQSLDDTELQLLGRTHSARDALQTLAEAQRLFPGRVSVDLMLGLPAQQVGPWLRQLQG 214

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            L    DH+SLYQL++E+GT  +   + G L  P   +A ++Y   +++    G   YE+
Sbjct: 215 LLRCCDDHVSLYQLSLERGTTLFTQVQQGALPAPDPELAAEMYQEGRAVLREAGFRQYEV 274

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVR 309
           SN +  GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P+SW+K V 
Sbjct: 275 SNFARNGALSTHNWTYWQCGQYLGVGPGAHGRFIPQGAGGHTREARIQTLEPDSWMKEVM 334

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEML 349
             GH    +  LS  +  +E L MGLR   GI+ + W+  
Sbjct: 335 LFGHGTRRRVPLSELELLEEVLAMGLRTDVGITHQHWQQF 374


>gi|269960450|ref|ZP_06174823.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           harveyi 1DA3]
 gi|269834877|gb|EEZ88963.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           harveyi 1DA3]
          Length = 390

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 193/336 (57%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T+++  R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQRKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++  G  R+  + + KHP  +L   +  
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFGDGRIVRTTKVKHPRGYLMAYQNM 301

Query: 312 GHAVVEKE-FLSSEQQADEFLMMGLRLREGISVKDW 346
               ++ E  ++ E +  EF M   RL E    +D+
Sbjct: 302 VKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDY 337


>gi|254230231|ref|ZP_04923623.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           sp. Ex25]
 gi|262393223|ref|YP_003285077.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           Ex25]
 gi|151937263|gb|EDN56129.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           sp. Ex25]
 gi|262336817|gb|ACY50612.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           Ex25]
          Length = 392

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 196/347 (56%), Gaps = 17/347 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T+++  R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAGRFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++ L     +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFELGHQKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWL----KM 307
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L     M
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNM 301

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V+   H    +  ++ E +  EF M   RL E    +D+    G  L
Sbjct: 302 VKPYLHT---EHVVADEDRPFEFFMNRFRLMEACPKQDYVDTTGLPL 345


>gi|148224309|ref|NP_001091605.1| radical S-adenosyl methionine domain-containing protein 1,
           mitochondrial precursor [Bos taurus]
 gi|187611408|sp|A5D7B1|RSAD1_BOVIN RecName: Full=Radical S-adenosyl methionine domain-containing
           protein 1, mitochondrial; AltName:
           Full=Oxygen-independent coproporphyrinogen-III
           oxidase-like protein RSAD1; Flags: Precursor
 gi|146186779|gb|AAI40492.1| RSAD1 protein [Bos taurus]
          Length = 442

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 199/340 (58%), Gaps = 6/340 (1%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           GS    +YVHWP+C K+C YC+FN ++ R  V +    +  + E Q + +L+G R + S+
Sbjct: 36  GSQRAALYVHWPYCEKRCSYCNFNKYIPR-GVDEAALRRCLVIEAQTLLRLSGVRRVESV 94

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL  P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S
Sbjct: 95  FFGGGTPSLASPHTVAAVLEAVAQAAHLPADSEVTLEANPTSASGSRLAAFGAAGVNRLS 154

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQR 193
           +G+QSL++  L+ LGR H+A +A+  +  A+ +FP R+S DL+  LP Q +  W  +LQ 
Sbjct: 155 IGLQSLDDTELQLLGRTHSARDALQTLAEAQRLFPGRVSVDLMLGLPAQQVGPWLRQLQG 214

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            L    DH+SLYQL++E+GT  +   + G L  P   +A ++Y   +++    G   YE+
Sbjct: 215 LLRCCDDHVSLYQLSLERGTTLFTQVQQGALPAPDPELAAEMYQEGRAVLREAGFRQYEV 274

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVR 309
           SN +  GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P+SW+K V 
Sbjct: 275 SNFARNGALSTHNWTYWQCGQYLGVGPGAHGRFIPQGAGGHTREARIQTLEPDSWMKEVM 334

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEML 349
             GH    +  LS  +  +E L MGLR   GI+ + W+  
Sbjct: 335 LFGHGTRRRVPLSELELLEEVLAMGLRTDVGITHQHWQQF 374


>gi|299529925|ref|ZP_07043353.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Comamonas testosteroni S44]
 gi|298722097|gb|EFI63026.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Comamonas testosteroni S44]
          Length = 409

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 220/376 (58%), Gaps = 12/376 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           L +YVH P+C+KKCPYCDFNSH   +   + ++ +I + + +++    L   R++ S+F 
Sbjct: 36  LSLYVHLPWCLKKCPYCDFNSHAWAKGDALPEDRYIDALMADLESALPLIWGRTVHSVFM 95

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P++I  ++ G+     +  + EIT+EANP + E + F+ +R AGVNR+S+G
Sbjct: 96  GGGTPSLFSPESIDKLIAGLRARLRMEPDCEITMEANPGTFEKDRFKAFRAAGVNRLSIG 155

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS +++ L+ +GR H+A++A AA+  A + F   + DL+YALP Q+M   + ++  ALS
Sbjct: 156 VQSFDDRYLQAVGRVHDAAQAQAAVREAADNFETFNIDLMYALPGQSMVDLQRDVDTALS 215

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLS+Y LTIE  T F K       V+P ++ A ++ +L  + T A G+  YE+S +
Sbjct: 216 FAPPHLSIYHLTIEPNTYFAKYPP----VVPEDDTAYEMLDLITASTRAAGMQRYEVSAY 271

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HN NYW++GDY+GIG GAHS++   +HR+   +  + P  ++ M    G  +
Sbjct: 272 AKDGHQCFHNSNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRFRDPARYIDMALA-GTPL 329

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQF 373
            +   +       E+++  LRLR G +++++    G  +    +     Q +G I R   
Sbjct: 330 AQDNEVKRADLPFEYMLNALRLRGGFALQEFMERTGLPMSAIAKGLDQAQAKGLISR-DL 388

Query: 374 SRLRCTQRGMTMLDSV 389
            R+  T+RG   L  +
Sbjct: 389 GRVVPTERGFDFLSDL 404


>gi|156975839|ref|YP_001446746.1| coproporphyrinogen III oxidase [Vibrio harveyi ATCC BAA-1116]
 gi|156527433|gb|ABU72519.1| hypothetical protein VIBHAR_03584 [Vibrio harveyi ATCC BAA-1116]
          Length = 390

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 192/336 (57%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T+++  R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   +  
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLMAYQNM 301

Query: 312 GHAVVEKE-FLSSEQQADEFLMMGLRLREGISVKDW 346
               ++ E  ++ E +  EF M   RL E    +D+
Sbjct: 302 VKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDY 337


>gi|153835258|ref|ZP_01987925.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           harveyi HY01]
 gi|148868233|gb|EDL67373.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           harveyi HY01]
          Length = 390

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 192/336 (57%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T+++  R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   +  
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLMAYQNM 301

Query: 312 GHAVVEKE-FLSSEQQADEFLMMGLRLREGISVKDW 346
               ++ E  ++ E +  EF M   RL E    +D+
Sbjct: 302 VKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDY 337


>gi|91228693|ref|ZP_01262607.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
 gi|91187764|gb|EAS74082.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
          Length = 392

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 196/347 (56%), Gaps = 17/347 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T+++  R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAQLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++ L     +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFELGHQKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWL----KM 307
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L     M
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNM 301

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V+   H    +  ++ E +  EF M   RL E    +D+    G  L
Sbjct: 302 VKPYLHT---EHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPL 345


>gi|260590052|ref|ZP_05855965.1| putative oxygen-independent coproporphyrinogen III oxidase [Blautia
           hansenii DSM 20583]
 gi|260539564|gb|EEX20133.1| putative oxygen-independent coproporphyrinogen III oxidase [Blautia
           hansenii DSM 20583]
          Length = 381

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 210/353 (59%), Gaps = 12/353 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQE---NFIQSFLTEMQWMRQLTGPRSIS 72
              LG+Y+H PFCVKKC YCDF S    +  G+E    ++ + L+E++  R+      +S
Sbjct: 2   KKDLGLYIHIPFCVKKCEYCDFLS----WNAGEEERQQYVAALLSEIESYREFAKGYRVS 57

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           +IF GGGTPS++ P+ +  IL  I + + +    EIT+E NP +V+    Q Y++ GVNR
Sbjct: 58  TIFIGGGTPSVLLPKQMEDILQKIYEIFELERRPEITVEVNPGTVDEEKLQCYKENGVNR 117

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMEL 191
           +S+G+QS++++ LR LGR H   E + +  LAR   F  +S DLI ++P QT+ +W+ EL
Sbjct: 118 LSMGLQSVKDEKLRLLGRIHTYQEFVESYELARKAGFDNISIDLISSVPGQTLQEWKEEL 177

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           + A +   +H+S+YQL IE+GT FY+ + +   +LP E  + ++Y  T       G   Y
Sbjct: 178 ETAAAQNPEHISVYQLIIEEGTPFYEKYAEHPELLPDEETSREIYLWTGKFLKEAGYGQY 237

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISN++  G ES HNL YW  GDY+G+G GA S V+     + +S  K   ++L+   K 
Sbjct: 238 EISNYAKPGKESRHNLKYWERGDYLGLGLGAASMVR----NIRMSNTKDMRTYLERCDKP 293

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR 364
                + +FL   +Q +EF+ +GLR   G+S K+++ + GR +D+  E+ L +
Sbjct: 294 KTMREDVQFLEEPRQMEEFMFLGLRKTRGVSKKEFKRIFGREMDMVYEKALHK 346


>gi|261210032|ref|ZP_05924330.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC341]
 gi|260840797|gb|EEX67339.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC341]
          Length = 391

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/346 (39%), Positives = 196/346 (56%), Gaps = 11/346 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM----QWMRQLTGPRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L ++    +  +    PR + S
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKDDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L G+A+  T    +EIT+EANP ++E   F GYR AGV RI
Sbjct: 66  IFIGGGTPSLISAEGIARLLQGVAERITFKPGIEITMEANPGTIEAQRFAGYRTAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L 
Sbjct: 126 SIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP E+   D++ L     +  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLNDAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +   
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFTDGRIVRTTKTKHPRGYLAALNNL 301

Query: 312 GHAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
             A ++ E L ++Q    EF M   RL E     D+    G  +++
Sbjct: 302 AKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEV 347


>gi|300311451|ref|YP_003775543.1| anaerobic coproporphyrinogen III oxidase oxidoreductase
           [Herbaspirillum seropedicae SmR1]
 gi|300074236|gb|ADJ63635.1| anaerobic coproporphyrinogen III oxidase oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 414

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 134/375 (35%), Positives = 218/375 (58%), Gaps = 10/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH+P+CV+KCPYCDFNSH  +    ++ ++ +   +++    L   R I SIF G
Sbjct: 40  PLSLYVHFPWCVRKCPYCDFNSHEVKDGFPEQEYLDALRLDLEQALPLIWGRKIYSIFIG 99

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +L  +     + +++EIT+EANP + E + F+ YR +G+NR+S+G+
Sbjct: 100 GGTPSLLSAAGLDRLLSDLRTLLPLDADIEITMEANPGTFEADKFRSYRDSGINRLSIGI 159

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS     L+ LGR H+  +A  A+ +A   F   + DL+YALP+QT+ Q   ++Q A+ +
Sbjct: 160 QSFNSAHLQALGRIHDGGQAHQAVEIAHANFDNFNLDLMYALPQQTLEQARTDIQTAIDF 219

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A  HLSLY LT+E  TLF K        +P E+ + D+ ++   +T+  G   YE+S ++
Sbjct: 220 APPHLSLYHLTLEPNTLFAKFPP----AVPDEDTSADMQDMIGELTTQAGYGNYEVSAYA 275

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G  + HNLNYW++GDY+GIG GAHS++    HR+   +  KHP+++L+ ++   H   
Sbjct: 276 QPGRRARHNLNYWQFGDYLGIGAGAHSKLSF-PHRIVRQMRYKHPQAYLQHIKAGTHIQE 334

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNL-QRQGFIERVQFS 374
           E E +  +    EF++  LRL EG     +    G  L+ I  + +L +R+G + R   +
Sbjct: 335 EAE-IGRDALGFEFMLNALRLTEGFPPNLFAERTGLALNQIGKQLDLAERKGMLYR-DHA 392

Query: 375 RLRCTQRGMTMLDSV 389
            +R T  G   L+ +
Sbjct: 393 LIRPTPLGRRFLNDL 407


>gi|319795586|ref|YP_004157226.1| oxygen-independent coproporphyrinogen iii oxidase [Variovorax
           paradoxus EPS]
 gi|315598049|gb|ADU39115.1| oxygen-independent coproporphyrinogen III oxidase [Variovorax
           paradoxus EPS]
          Length = 420

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 218/383 (56%), Gaps = 19/383 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYK-------VGQENFIQSFLTEMQWMRQLTGPRS 70
            L +Y+H P+C++KCPYCDFNSH  R         + +  +I + + ++     L   R+
Sbjct: 37  PLSLYIHLPWCLRKCPYCDFNSHEWRATSAADAEGIPEAAYIDALVADLDAALPLIWGRT 96

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + +IF GGGTPSL  PQ I  +L  +     ++ + EIT+EANP + E N F+ YR AGV
Sbjct: 97  VHTIFIGGGTPSLFSPQAIDRLLGDVRARLKLAPDCEITLEANPGTFERNRFRAYRSAGV 156

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
            R+S+GVQS  ++ L  LGR H+ ++AIAA+  A + F   + DL+YALP QT+   E +
Sbjct: 157 TRLSVGVQSFNDEHLTALGRVHDRAQAIAAVEEAASAFDTFNLDLMYALPGQTLEHLEAD 216

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L +AL+ A  H+S+Y LTIE  T F K        LP +++A  + +     T   G+  
Sbjct: 217 LSQALALAPPHISVYHLTIEPNTWFAKFPP----TLPEDDIAYAMLDRITERTGEQGMSR 272

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR 309
           YE+S ++  G +  HNLNYW++GDY+GIG GAHS++   +HR+   +  + P  +++  R
Sbjct: 273 YEVSAYAREGHQCAHNLNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRYREPRLYMENAR 331

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQG 366
             G AV + + +S      EF++  LRL+ G ++  +    G  +    +R L   +R+G
Sbjct: 332 A-GAAVSQSDEVSLADLPFEFMLNALRLKAGFTLPQFSERTGLAM-TSIQRGLEEAERKG 389

Query: 367 FIERVQFSRLRCTQRGMTMLDSV 389
            + R  F R+  T+RG+  L  +
Sbjct: 390 LVARDLF-RVWPTERGLDFLSDL 411


>gi|186475431|ref|YP_001856901.1| coproporphyrinogen III oxidase [Burkholderia phymatum STM815]
 gi|184191890|gb|ACC69855.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           phymatum STM815]
          Length = 404

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/377 (36%), Positives = 219/377 (58%), Gaps = 11/377 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFFG 77
           L +YVH+P+CV+KCPYCDFNSH  +     E+ ++ +  ++++    L   R + ++F G
Sbjct: 29  LALYVHFPWCVRKCPYCDFNSHESKGGTFPEDEYLDALRSDLERSLPLVWGRQVHTVFIG 88

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G+
Sbjct: 89  GGTPSLMSAKGLDRLLSDVRALLPLDADAEITLEANPGTFEAEKFAQFRASGVNRLSVGI 148

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  E  L+ LGR H++++A  A+ +A N F   + DL++ALPKQT+ + + +++ ALSY
Sbjct: 149 QSFNEAHLKALGRIHDSTQARHAVEVAANTFGNFNLDLMFALPKQTLAECQADIETALSY 208

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A  HLSLY LT+E  TLF K        LP ++ + D+ +     T   G   YE+S ++
Sbjct: 209 APPHLSLYHLTLEPNTLFAKFPPP----LPDDDSSADMQDWIHERTREAGYERYEVSAYA 264

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +S HNLNYWR+GDY+GIG GAH+++   +  +     KHP ++++  R +G+AV E
Sbjct: 265 KPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQMRYKHPATFIEEAR-SGNAVQE 323

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQFS 374
           +  + +     EF++  LRL EG  V  +    G  +    E  LQ   R+G I R  F 
Sbjct: 324 EHEVGARDLPFEFMLNALRLVEGFPVHRFIERTGLPI-TSIEPALQEAERRGLITR-DFE 381

Query: 375 RLRCTQRGMTMLDSVIA 391
           ++  T  G   L+ + A
Sbjct: 382 KIAPTPLGQAFLNDLQA 398


>gi|332970354|gb|EGK09346.1| oxygen-independent coproporphyrinogen III oxidase [Kingella kingae
           ATCC 23330]
          Length = 386

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/324 (38%), Positives = 197/324 (60%), Gaps = 4/324 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+C++KCPYCDFNSH  +  + +  +IQ+ LT++Q        R I +IF GG
Sbjct: 12  LSLYIHIPWCIQKCPYCDFNSHKIKTTLDENAYIQALLTDLQSELPYFWGRPIDTIFIGG 71

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPS+   + I  +L GI     ++   EIT+EANPS+ E++ FQG++ AG+NR+S+GVQ
Sbjct: 72  GTPSVFSAKAIDQLLSGIRALVKLNPETEITLEANPSTFEIDKFQGFKDAGINRLSIGVQ 131

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S ++  L+ LGR HNA EA  AI +A  IF R++ DL+YALP QT+     +++ A+++ 
Sbjct: 132 SFDDAKLKTLGRIHNAHEAKNAIEVATQIFERVNIDLMYALPHQTVQAACDDIRTAIAFG 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS- 257
             H+S YQLT+E  T F      G   LP ++ A D+ +   +  +  G   YE S  + 
Sbjct: 192 TTHISAYQLTLEPNTPFGHTPPQG---LPEDDNAQDIEDAIHAELAQAGFVQYETSAFAK 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               ++ HN+NYW++GDYIGIG GAH ++         + ++HP  +L  ++ N H  +E
Sbjct: 249 SPNQQARHNVNYWQFGDYIGIGAGAHGKLSHHDRIERTTRKRHPSDYLLAMQTNPHDAIE 308

Query: 318 KEFLSSEQQADEFLMMGLRLREGI 341
           ++ ++ +    EF+M  LRL +G+
Sbjct: 309 RKMVAPQDLPFEFMMNALRLVDGV 332


>gi|28198630|ref|NP_778944.1| coproporphyrinogen III oxidase [Xylella fastidiosa Temecula1]
 gi|182681313|ref|YP_001829473.1| coproporphyrinogen III oxidase [Xylella fastidiosa M23]
 gi|28056714|gb|AAO28593.1| coproporphyrinogen III oxidase [Xylella fastidiosa Temecula1]
 gi|182631423|gb|ACB92199.1| oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa M23]
 gi|307579764|gb|ADN63733.1| coproporphyrinogen III oxidase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 383

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 217/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  + ++ + L ++++   L   R + S+F G
Sbjct: 6   PLSLYVHLPWCVRKCPYCDFNSHQAKGALPFDAYVNALLRDLEYDLPLVWGRVVHSVFLG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L  +A    ++ + EIT+E NP + E   F  Y  AG+NR+S G+
Sbjct: 66  GGTPSLFPPEAIDRFLQIVAARLRLAPDAEITLETNPGTAEYGRFDRYLAAGINRLSFGI 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS  + +LR LGR H++ +A  A+ LA++  F  ++ DL+YALP+QT+ + E +LQRA +
Sbjct: 126 QSFNDAALRRLGRIHDSLQAEQAVKLAQDAGFTNINLDLMYALPEQTLLEAEHDLQRAFA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+FY     G   +P ++ A ++   TQ + +  G   YE+S +
Sbjct: 186 LAPTHLSYYQLTLEPNTVFYARPPQG---IPDDDAAWEMQEHTQRLLAEAGYQHYEVSAY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGHA 314
           +  G + LHNLNYWR+GDY+GIG GAH ++  G   H +     KHP ++L        A
Sbjct: 243 AREGWQCLHNLNYWRFGDYLGIGAGAHGKITSGVSQHVLRRWKCKHPYTYLDNA-GTVSA 301

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE---RV 371
           +   E + + +   E+++  LRLREG  ++D+ +  G  L +E      R+       R 
Sbjct: 302 IGGDEIVPTARLPFEYMLNLLRLREGFRLQDFAVRTG--LTVESIHAALREAVARGWLRC 359

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +   +  T+ G+   + VI
Sbjct: 360 ELEHVIPTELGLRFANDVI 378


>gi|296315022|ref|ZP_06864963.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria polysaccharea ATCC 43768]
 gi|296838225|gb|EFH22163.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria polysaccharea ATCC 43768]
          Length = 391

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETNPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|269965739|ref|ZP_06179836.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           alginolyticus 40B]
 gi|269829607|gb|EEZ83844.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           alginolyticus 40B]
          Length = 392

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 196/347 (56%), Gaps = 17/347 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T+++  R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++ L     +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFELGHQKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWL----KM 307
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L     M
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNM 301

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V+   H    +  ++ E +  EF M   RL E    +D+    G  L
Sbjct: 302 VKPYLHT---EHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPL 345


>gi|254508606|ref|ZP_05120722.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus 16]
 gi|219548457|gb|EED25466.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus 16]
          Length = 391

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 221/387 (57%), Gaps = 24/387 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQL-TGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH ++  + ++ +I + L +++      QL + PR + S
Sbjct: 8   ALSLYVHIPWCVQKCPYCDFNSHAQKAVIPEKEYIAALLQDLEADIERYQLESNPRLLHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  Q IA +L GI        ++EIT+EANP ++E   F GY+KAGV RI
Sbjct: 68  IFIGGGTPSLISAQGIAELLSGIEARLPFKPDIEITMEANPGTIEAERFAGYQKAGVTRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L+
Sbjct: 128 SVGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSVDQALADLE 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TLFY         LP ++   D++ L     +  G   YE
Sbjct: 188 KAIALDPPHLSWYQLTIEPNTLFYYKQP----TLPDDDDLWDIFELGHQKLADAGYVQYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP+ +L     +
Sbjct: 244 ISGYSKPGFQCQHNLNYWRFGDYLGIGCGAHGKISFRDGRIVRTTKIKHPKGYL-----D 298

Query: 312 GHAVVEKEFLSSEQQ--AD----EFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQ- 363
            +  + K +L+SE++  AD    EF M   RL E    +D+    G   + I+   N   
Sbjct: 299 AYDNMVKPYLNSEEEVAADDRPFEFFMNRFRLLEACPKQDFLDTTGLGFEAIQATMNWAI 358

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVI 390
             G+I+    +  + T++G   L+ ++
Sbjct: 359 EMGYIDESD-THWQITEKGKLFLNDLL 384


>gi|313199821|ref|YP_004038479.1| oxygen-independent coproporphyrinogen iii oxidase [Methylovorus sp.
           MP688]
 gi|312439137|gb|ADQ83243.1| oxygen-independent coproporphyrinogen III oxidase [Methylovorus sp.
           MP688]
          Length = 405

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 204/374 (54%), Gaps = 16/374 (4%)

Query: 8   ENNMTGQGSNS-------LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           EN + GQ ++S       L +Y+H P+CV+KCPYCDFNSH  R  + +  ++ + + +++
Sbjct: 14  ENPLVGQLTSSGLRNPPPLSLYIHIPWCVRKCPYCDFNSHESRNPIPESTYVDALIADLE 73

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
               L   R + SIFFGGGTPSL   ++I  IL  +     +    EIT+EANP + E  
Sbjct: 74  QATPLVWGRKVRSIFFGGGTPSLFSAESIDRILSHVRMLTPLEYEAEITLEANPGTFEAE 133

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
            F GYR AGVNRIS+G+QS   + L+ LGR HN+ EA  A   A  IF  ++ DL+YALP
Sbjct: 134 RFAGYRDAGVNRISIGIQSFNPRHLQALGRIHNSEEAQYAAEHAIKIFGNVNLDLMYALP 193

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
           +QT+ +   +++ A++    H+S Y LT+E  T FY         LP ++ +  +    +
Sbjct: 194 EQTLEEALQDMRTAIALGPTHISAYHLTLEPNTPFYYKPP----ALPDDDTSATMQEAIE 249

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            + + HG   YE S     G    HNLNYW +GDY+GIG GAHS++      +  S  K 
Sbjct: 250 HLLAEHGYSHYETSAFGKAGKRCRHNLNYWVFGDYLGIGAGAHSKLSFHDRILRQSRIKQ 309

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           P +++K V + GH + E+  L       EF+M  LRL EG     +  + G+ L    E 
Sbjct: 310 PNAYMKAVAETGH-IEEERLLDRSDLGFEFMMNALRLTEGFDPMLFTTMTGQALST-VEP 367

Query: 361 NLQ---RQGFIERV 371
            LQ   ++G I R 
Sbjct: 368 ALQQAEQRGLITRT 381


>gi|264679918|ref|YP_003279827.1| oxygen-independent coproporphyrinogen [Comamonas testosteroni
           CNB-2]
 gi|262210433|gb|ACY34531.1| putative oxygen-independent coproporphyrinogen [Comamonas
           testosteroni CNB-2]
          Length = 409

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/376 (34%), Positives = 220/376 (58%), Gaps = 12/376 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           L +YVH P+C+KKCPYCDFNSH   +   + ++ +I + + +++    L   R++ S+F 
Sbjct: 36  LSLYVHLPWCLKKCPYCDFNSHAWAKGDALPEDRYIDALMADLESALPLIWGRTVHSVFM 95

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P+++  ++ G+     +  + EIT+EANP + E + F+ +R AGVNR+S+G
Sbjct: 96  GGGTPSLFSPESMDKLIAGLRARLRMEPDCEITMEANPGTFEKDRFKAFRAAGVNRLSIG 155

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS +++ L+ +GR H+A++A AA+  A + F   + DL+YALP Q+M   + ++  ALS
Sbjct: 156 VQSFDDRYLQAVGRVHDAAQAQAAVREAADNFETFNIDLMYALPGQSMVDLQRDVDTALS 215

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLS+Y LTIE  T F K       V+P ++ A ++ +L  + T A G+  YE+S +
Sbjct: 216 FAPPHLSIYHLTIEPNTYFAKYPP----VVPEDDTAYEMLDLITASTRAAGMQRYEVSAY 271

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HN NYW++GDY+GIG GAHS++   +HR+   +  + P  ++ M    G  +
Sbjct: 272 AKDGHQCFHNSNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRFRDPARYMDMALA-GTPL 329

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQF 373
            +   +       E+++  LRLR G +++++    G  +    +     Q +G I R   
Sbjct: 330 AQDNEVKRADLPFEYMLNALRLRGGFALQEFMERTGLPMSAIAKGLDQAQAKGLISR-DL 388

Query: 374 SRLRCTQRGMTMLDSV 389
            R+  T+RG   L  +
Sbjct: 389 GRVVPTERGFDFLSDL 404


>gi|148550176|ref|YP_001270278.1| coproporphyrinogen III oxidase [Pseudomonas putida F1]
 gi|148514234|gb|ABQ81094.1| coproporphyrinogen III oxidase, anaerobic [Pseudomonas putida F1]
          Length = 391

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 215/378 (56%), Gaps = 14/378 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFFG
Sbjct: 18  PLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L GI +    + ++EIT+EANP + E + F+ YR+ G+NR+S+GV
Sbjct: 78  GGTPSLFSANALGRLLRGIEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIGV 137

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +   L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A+ 
Sbjct: 138 QSFQPAKLEALGRIHNGDEAVRAADMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAID 197

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S +
Sbjct: 198 LGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSAY 253

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR--KNGH 313
           +  G  + HNLNYWR+GD+IGIG GAH ++     R+  + + + P+ +L + +  K G 
Sbjct: 254 AQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLAKPFKAG- 312

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQRQGFIERVQ 372
               ++ L  ++   EFLM  LRL +G+  + +    G  L  ++  R    Q  + +V+
Sbjct: 313 ----EKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLSQLQEARPAAEQKGLLQVE 368

Query: 373 FSRLRCTQRGMTMLDSVI 390
             RL  T RG   L+ ++
Sbjct: 369 PDRLVATPRGQLFLNDLL 386


>gi|284007797|emb|CBA73657.1| oxygen-independent coproporphyrinogen III oxidase [Arsenophonus
           nasoniae]
          Length = 370

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/379 (36%), Positives = 228/379 (60%), Gaps = 18/379 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQLTGPRSISSIFFG 77
           + +YVH P+CV+KCPYCDFNSH  + ++ Q+ ++   LT++Q  + Q+ G R ++SIF G
Sbjct: 1   MSLYVHIPWCVQKCPYCDFNSHALKGELPQQEYVTHLLTDLQADLAQIKG-RQVNSIFIG 59

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++ + +  +LDGI +   ++S+ EIT+EANP +VE + F  Y++AG+NRIS+GV
Sbjct: 60  GGTPSLLDAKAMQSLLDGIRQRLLLASDAEITMEANPGTVEADRFSQYQQAGINRISIGV 119

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS     L  LGR H   EAI A  LA  +  R  + DL++ LP QT+ Q   +LQ+A+ 
Sbjct: 120 QSFAADKLTKLGRIHGPEEAIQAASLASALNLRSFNLDLMHGLPDQTLEQALSDLQQAID 179

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            +  H+S YQLTIE  T F         +LP+++   D+++    + +  G   YEIS +
Sbjct: 180 LSPPHISWYQLTIEPNTHFGSCPP----ILPNDDALWDIFSQGHQLLNKAGYQQYEISGY 235

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ KHP  ++      G  +
Sbjct: 236 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKISFADGRILRTMKTKHPRGYM-----TGQYL 290

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVK---DWEMLAGRNLDIECERNLQRQGFIERVQ 372
            +++ ++   +  EF M   RL EG++ +   D+  LA   +  + ++ L+ QG+I   +
Sbjct: 291 YQQQGVNQSDRPFEFFMNRFRLLEGVARQEFIDYTGLAENVIRHQLDKALE-QGYITETK 349

Query: 373 FSRLRCTQRGMTMLDSVIA 391
            S  + T++G   L+S++ 
Sbjct: 350 -SHWQITEQGKLFLNSLLT 367


>gi|149909461|ref|ZP_01898116.1| coproporphyrinogen III oxidase [Moritella sp. PE36]
 gi|149807571|gb|EDM67520.1| coproporphyrinogen III oxidase [Moritella sp. PE36]
          Length = 395

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 142/342 (41%), Positives = 192/342 (56%), Gaps = 16/342 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+CV+KCPYCDFNSH ++ K+ ++ +I   L +++        RS+ SIF GG
Sbjct: 23  LSLYVHIPWCVQKCPYCDFNSHTQKGKIPEDEYIADLLADLRSELPRVFQRSLHSIFIGG 82

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSLI  + I  ILDGI      S N+EIT+EANP +VE N F GY  AGVNRIS+GVQ
Sbjct: 83  GTPSLISAEGIGKILDGIEAMIPFSDNIEITMEANPGTVEANRFHGYVAAGVNRISIGVQ 142

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLA-RNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           SL+ + L  LGR H+  EAI A ++A  +     + DL++ LP Q +     +L +A+  
Sbjct: 143 SLQAEKLNLLGRIHDPDEAIRAANIASESALNSFNLDLMHGLPHQDLNDALYDLNKAVEL 202

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A  HLS YQLTIE+ T F+         LP E++  D++    ++ S  G   YEIS ++
Sbjct: 203 APQHLSWYQLTIEQNTQFHSKPP----TLPDEDILWDIFEQGHALLSEAGYEQYEISGYA 258

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAI--SIEKHPESWL---KMVRKNG 312
             G +  HNLNYWR+GDYIGIG GAH ++           S  KHP  ++   K    N 
Sbjct: 259 KAGNQCQHNLNYWRFGDYIGIGCGAHGKLTDPETGKIYRRSKVKHPRGYMDADKAFLDNE 318

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           H VV+ E         EF M   RL E    +D+    G  L
Sbjct: 319 HVVVQDEL------PFEFFMNRFRLTEATPKQDFCDFTGLPL 354


>gi|330815845|ref|YP_004359550.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia gladioli BSR3]
 gi|327368238|gb|AEA59594.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia gladioli BSR3]
          Length = 409

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 210/375 (56%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +E ++ +   +++        R + +IF 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPEEAYLDALRADLEQALPFVWGRQVHTIFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSIG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A + F   + DL++ALPKQT+ Q + +++ ALS
Sbjct: 148 IQSFNEAHLKALGRIHDTAQARAAVEIAASTFDNFNLDLMFALPKQTLAQCQADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           YA  HLSLY LT+E  TLF K        +P ++ + D+    Q  T+  G   YE+S +
Sbjct: 208 YAPPHLSLYHLTLEPNTLFAKFPP----AVPDDDASADMQEWIQERTAQAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 ARPNRQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATYMEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  +       EF++  LRL EG  V  +    G  L          +R+G I R  + 
Sbjct: 323 EEREVGPRDLPFEFMLNTLRLAEGFPVASYAERTGLPLSTIEPALAEAERRGLIAR-DYE 381

Query: 375 RLRCTQRGMTMLDSV 389
           R+  T  G   L+ +
Sbjct: 382 RIAPTPLGQRFLNDL 396


>gi|28899396|ref|NP_799001.1| coproporphyrinogen III oxidase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260366267|ref|ZP_05778726.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus K5030]
 gi|260878916|ref|ZP_05891271.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus AN-5034]
 gi|260898283|ref|ZP_05906779.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus Peru-466]
 gi|260902388|ref|ZP_05910783.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus AQ4037]
 gi|28807632|dbj|BAC60885.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308085845|gb|EFO35540.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus Peru-466]
 gi|308090492|gb|EFO40187.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus AN-5034]
 gi|308107145|gb|EFO44685.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus AQ4037]
 gi|308113531|gb|EFO51071.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           parahaemolyticus K5030]
          Length = 392

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 196/347 (56%), Gaps = 17/347 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T++   R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYISALLEDLDTDIDKYRLNDAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI        ++EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPDIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQEKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWL----KM 307
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L     M
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQNM 301

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V+   H    ++ ++ E +  EF M   RL E    +D+    G  L
Sbjct: 302 VKPYLHT---EQLVADEDRPFEFFMNRFRLMEACPKQDYVDTTGLPL 345


>gi|71900256|ref|ZP_00682393.1| Putative oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa Ann-1]
 gi|71729969|gb|EAO32063.1| Putative oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa Ann-1]
          Length = 383

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 217/379 (57%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  + ++ + L ++++   L   R + S+F G
Sbjct: 6   PLSLYVHLPWCVRKCPYCDFNSHQAKGALPFDAYVNALLRDLEYDLPLVWGRVVHSVFLG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L  +A    ++ + EIT+E NP + E   F  Y  AG+NR+S G+
Sbjct: 66  GGTPSLFPPEAIDRFLQIVAARLRLAPDAEITLETNPGTAEYGRFDRYLAAGINRLSFGI 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS  + +LR LGR H++ +A  A+ LA++  F  ++ DL+YALP+QT+ + E +LQRA +
Sbjct: 126 QSFNDAALRRLGRIHDSLQAEHAVKLAQDAGFTNINLDLMYALPEQTLLEAEHDLQRAFA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+FY     G   +P ++ A ++   TQ + +  G   YE+S +
Sbjct: 186 LAPTHLSYYQLTLEPNTVFYARPPQG---IPDDDAAWEMQEHTQRLLAEAGYQHYEVSAY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGHA 314
           +  G + LHNLNYWR+GDY+GIG GAH ++  G   H +     KHP ++L        A
Sbjct: 243 AREGWQCLHNLNYWRFGDYLGIGAGAHGKITSGVSQHVLRRWKCKHPYTYLDNA-GTVSA 301

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE---RV 371
           +   E + + +   E+++  LRLREG  ++D+ +  G  L +E      R+       R 
Sbjct: 302 IGGDEIVPTARLPFEYMLNLLRLREGFRLQDFAVRTG--LTVESIHAALREAVARGWLRC 359

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +   +  T+ G+   + VI
Sbjct: 360 ELEHVIPTELGLRFANDVI 378


>gi|194217113|ref|XP_001499707.2| PREDICTED: similar to Radical S-adenosyl methionine domain
           containing 1 [Equus caballus]
          Length = 412

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/336 (38%), Positives = 200/336 (59%), Gaps = 6/336 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            SLG+   WP+C K+C YC+FN ++ R  V +       +TE Q + QL+G R + S+FF
Sbjct: 8   KSLGLTSSWPYCEKRCSYCNFNKYIPR-GVEEAAMRSCLVTEAQTLLQLSGVRRVDSVFF 66

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P  +A +L+ +A+   + ++ E+T+E NP+S   +    +  AGVNR+S+G
Sbjct: 67  GGGTPSLASPHTVAAVLEAVAQAAHLPADSEVTLEVNPTSAPGSRLAAFGAAGVNRLSIG 126

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRAL 195
           +QSL++  LR LGR H+A++A+  +  AR++FP R+S DL+  LP Q +  W  +L+  L
Sbjct: 127 LQSLDDTELRLLGRTHSANDALRTLAEARHLFPGRVSVDLMLGLPAQQVGPWLGQLRELL 186

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +  DH+SLYQL++E+GT  +   + G L  P   +A ++Y   +++    G   YE+SN
Sbjct: 187 RHCDDHISLYQLSLERGTALFTQVQQGTLPAPDPELAAEMYQEGRAVLREAGFRQYEVSN 246

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKN 311
            +  GA S HN  YW+ G YIG+GPGAH R     VG H     I+   P++W+K V   
Sbjct: 247 FARNGALSTHNWTYWQCGQYIGVGPGAHGRFMPQGVGGHIREARIQTLEPDNWMKEVMLF 306

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWE 347
           GH   ++  L   +  +E L MGLR   GI+ + W+
Sbjct: 307 GHGTRKRVPLGELELLEEVLAMGLRTDVGITHQHWQ 342


>gi|260808973|ref|XP_002599281.1| hypothetical protein BRAFLDRAFT_64361 [Branchiostoma floridae]
 gi|229284558|gb|EEN55293.1| hypothetical protein BRAFLDRAFT_64361 [Branchiostoma floridae]
          Length = 381

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 203/351 (57%), Gaps = 10/351 (2%)

Query: 53  QSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEA 112
           +  + E   + Q +G R ++S+FFGGGTPSL  P  +A++L+ I+++  + ++ E+T+EA
Sbjct: 3   RCLVQETATLLQQSGVRRVNSVFFGGGTPSLALPHTMAVVLETISQHALLPADAEVTLEA 62

Query: 113 NPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RM 171
           NPSS E +  + ++ AG+NR+SLG+Q+     L  LGR+H+  +++ A+   R +FP R+
Sbjct: 63  NPSSTETDKLREFKTAGINRLSLGIQAFSPPDLHLLGRDHSVEDSLRALQEGRTLFPGRV 122

Query: 172 SFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV 231
           S DLI+  P QT+  W  ELQ+ALS   DH+SLYQLT+E+GT  ++  +     +P  + 
Sbjct: 123 SIDLIFGRPGQTVEAWRGELQQALSVCDDHVSLYQLTLERGTALFRQVEKKQQTVPDPDT 182

Query: 232 AVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-- 289
             DLY   +      G   YE+SN +  GAES HNL+YWR   YIG+GPGAH R      
Sbjct: 183 MADLYACARETLQNAGFQQYEVSNFARNGAESSHNLSYWRGKQYIGVGPGAHGRFACKGL 242

Query: 290 --SHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDW- 346
             + R A      P+ W+  V + GHA  ++  LS     +E LM+GLR  EG++ + W 
Sbjct: 243 GRTDREARIQTLEPQQWMGRVERLGHATAKRTSLSQLDILEEILMLGLRTTEGLANERWV 302

Query: 347 EMLAGRNLDIECERNLQRQGFIE----RVQFSRLRCTQRGMTMLDSVIANL 393
               G +L      ++  QGF+      +  S LR T  G+ +LDS+I +L
Sbjct: 303 RFSGGTSLHDIFGTSVAAQGFVNAGLLELSHSVLRATHTGLAVLDSIIPDL 353


>gi|149192345|ref|ZP_01870550.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
 gi|148833823|gb|EDL50855.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
          Length = 389

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 213/392 (54%), Gaps = 28/392 (7%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQL---TGPRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + Q+ +I + L ++   +RQ    +  R + S
Sbjct: 11  PLSLYIHIPWCVQKCPYCDFNSHAQKGDIPQQAYITALLEDLDTDIRQYGLASDSRPLHS 70

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P+ I  +LDG+ +      ++EIT+EANP ++E   F+ YR  GV RI
Sbjct: 71  IFIGGGTPSLIAPEYIKQLLDGVRERIPFRDDIEITMEANPGTIEAARFEQYRVVGVTRI 130

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS ++  L  LGR H  SEA+ A  LA  I     + DL++ LP+Q++     +L+
Sbjct: 131 SIGVQSFQQTKLERLGRIHGESEAVNAAKLAHEIGLNSFNLDLMHGLPEQSIDDALSDLK 190

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  TLFY         LP ++   D++     +    G   YE
Sbjct: 191 QAIELAPPHLSWYQLTIEPNTLFYSKPP----TLPDDDDLWDIFEQGHQMLVEAGYQQYE 246

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S    +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L M+   
Sbjct: 247 ISGYSKPDFQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKVKHPRGYLNML--- 303

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
                 K +L SE   D      EF +   RL E      + +  G NLDI  E  +   
Sbjct: 304 ------KPYLDSETNVDMKDRPFEFFINRFRLLEPCPKVQFTLRTGLNLDIIQEPIKRCL 357

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            QG+IE  +      T++G   L+ V+    +
Sbjct: 358 EQGYIEETE-EHWIVTEKGKLFLNDVLEQFEL 388


>gi|294789570|ref|ZP_06754805.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Simonsiella muelleri ATCC 29453]
 gi|294482507|gb|EFG30199.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Simonsiella muelleri ATCC 29453]
          Length = 387

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 195/326 (59%), Gaps = 4/326 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+C++KCPYCDFNSH  +  + ++ +I + L ++Q        R I +IF GG
Sbjct: 13  LSLYIHIPWCIQKCPYCDFNSHKIKTTLDEQTYINALLVDLQSELPYFWGRQIQTIFIGG 72

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPS+ +  +I  +L G+     ++   EIT+EANPS+ E N FQG++ AG+NR+S+GVQ
Sbjct: 73  GTPSVFQADSINQLLSGLRALVKLNPEAEITLEANPSTFERNKFQGFKDAGINRLSIGVQ 132

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S ++  L+ LGR HNA+EA AAI  A  IF R++ DL+YALP+QT+     +++ A+   
Sbjct: 133 SFDDTQLKTLGRIHNATEAQAAIETACQIFERVNIDLMYALPRQTVQAALHDVRTAIGLG 192

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS- 257
           V H+S YQLT+E  T F      G   LP ++ A D+ +   +  +  G   YE S  S 
Sbjct: 193 VSHISAYQLTLEPNTPFGHTPPQG---LPEDDAAQDIEDAIHNELANVGFTQYETSAFSK 249

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
                + HN+NYW++GDY+GIG GAH ++    H    + ++HP  +L  ++ N +  +E
Sbjct: 250 HPNQRARHNINYWQFGDYVGIGAGAHGKLSHHKHIERTTRKRHPNDYLAAMQHNPNDAIE 309

Query: 318 KEFLSSEQQADEFLMMGLRLREGISV 343
           ++ +       EF+M  LRL +G+  
Sbjct: 310 RKIIQPTDLPFEFMMNALRLVDGVPT 335


>gi|261392962|emb|CAX50547.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria meningitidis 8013]
          Length = 391

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFVHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGIPAAQIMAQIETARQKGLLETDPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|239817290|ref|YP_002946200.1| oxygen-independent coproporphyrinogen III oxidase [Variovorax
           paradoxus S110]
 gi|239803867|gb|ACS20934.1| oxygen-independent coproporphyrinogen III oxidase [Variovorax
           paradoxus S110]
          Length = 419

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 136/382 (35%), Positives = 218/382 (57%), Gaps = 19/382 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYK-------VGQENFIQSFLTEMQWMRQLTGPRSI 71
           L +Y+H P+C++KCPYCDFNSH  R         + +  ++ + + ++     L   R++
Sbjct: 38  LSLYIHLPWCLRKCPYCDFNSHEWRATNEAEAEGIPESAYLDALIADLDAALPLIWGRTV 97

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            +IF GGGTPSL  PQ I  +L  +     ++   EIT+EANP + E N F+ YR AGV 
Sbjct: 98  HTIFIGGGTPSLFSPQAIDRLLGDVRARLKLAPECEITLEANPGTFERNRFRAYRSAGVT 157

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+S+GVQS  ++ L+ LGR H+ ++AIAA+  A + F   + DL+YALP QT+   + +L
Sbjct: 158 RLSVGVQSFNDEHLKALGRVHDRAQAIAAVEEAASAFDTFNLDLMYALPGQTLEGLDADL 217

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +AL+ A  H+S+Y LTIE  T F K        LP +++A  + +     T+A G+  Y
Sbjct: 218 TQALALAPPHISVYHLTIEPNTRFAKFPP----ALPEDDLAYAMLDRITERTAASGMSRY 273

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRK 310
           E+S ++  G    HNLNYW++GDY+GIG GAHS++   +HR+   +  + P  ++   R 
Sbjct: 274 EVSAYARSGHACAHNLNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRFREPRLYMNNARA 332

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGF 367
            G AV + + ++      EF++  LRL+EG ++  +    G  +    ++ L   +R+G 
Sbjct: 333 -GAAVAQSDEVALADLPFEFMLNALRLKEGFTLPQFSERTGLAM-TSIQKGLEEAERKGL 390

Query: 368 IERVQFSRLRCTQRGMTMLDSV 389
           I R    R+  T+RG+  L  +
Sbjct: 391 IAR-DLHRVWPTERGLDFLSDL 411


>gi|218767786|ref|YP_002342298.1| coproporphyrinogen III oxidase [Neisseria meningitidis Z2491]
 gi|121051794|emb|CAM08100.1| putative porphyrin oxidoreductase [Neisseria meningitidis Z2491]
          Length = 399

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPTAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|254804543|ref|YP_003082764.1| putative porphyrin oxidoreductase [Neisseria meningitidis alpha14]
 gi|254668085|emb|CBA04593.1| putative porphyrin oxidoreductase [Neisseria meningitidis alpha14]
 gi|254670338|emb|CBA05750.1| putative porphyrin oxidoreductase [Neisseria meningitidis alpha153]
 gi|308388850|gb|ADO31170.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           meningitidis alpha710]
          Length = 391

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|260767471|ref|ZP_05876408.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio
           furnissii CIP 102972]
 gi|260617583|gb|EEX42765.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio
           furnissii CIP 102972]
          Length = 390

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 141/351 (40%), Positives = 194/351 (55%), Gaps = 21/351 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  +  + +  +I + L    T+++  +    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKADIPETEYIDALLEDLDTDIERYQLTDDPRLLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P  I  +L GI        ++EIT+EANP ++E   F GYR+ GV RI
Sbjct: 66  IFIGGGTPSLISPDGIGRLLRGIEARIAFKPDIEITMEANPGTIEAERFAGYRQVGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT+ Q   +L+
Sbjct: 126 SIGVQSFEPEKLTRLGRIHGRDEAVKAAQLAHQIGLNSFNLDLMHGLPDQTLEQALADLE 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            A+  A  HLS YQLTIE  TLFY         LP ++   D++ L     +A G   YE
Sbjct: 186 SAIELAPPHLSWYQLTIEPNTLFYFKPP----TLPDDDALWDIFELGHQKLTAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   +  
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN- 300

Query: 312 GHAVVEKEFLSSEQQ-AD-----EFLMMGLRLREGISVKDWEMLAGRNLDI 356
               + K +L SEQ  AD     EF M   RL E     D+    G  + +
Sbjct: 301 ----LAKPYLDSEQLVADVDRPFEFFMNRFRLIEPCPKADFSATTGLPISV 347


>gi|152980187|ref|YP_001353024.1| coproporphyrinogen III oxidase [Janthinobacterium sp. Marseille]
 gi|151280264|gb|ABR88674.1| oxygen-independent coproporphyrinogen III oxidase
           [Janthinobacterium sp. Marseille]
          Length = 414

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 205/344 (59%), Gaps = 6/344 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH+P+CVKKCPYCDFNSH       ++ ++ +   +++    L   R I +IF GG
Sbjct: 41  LSLYVHFPWCVKKCPYCDFNSHEATGGFPEDEYLSALRADLEMALPLIWGRKIYTIFIGG 100

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +  +L  I     +   VEIT+EANP + E   F+ YR +G+NR+S+G+Q
Sbjct: 101 GTPSLLSAAGLDRLLSDIRTLLPLDGAVEITMEANPGTFEAEKFKSYRASGINRLSIGIQ 160

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S   + L  LGR HN  EA  A+ +A + F   + DL+YALP QT+ +  +++Q A++YA
Sbjct: 161 SFNSRHLDALGRIHNGDEAQRAVDIAASNFDNFNLDLMYALPSQTLDEARLDVQTAIAYA 220

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLSLY LT+E  T+F K       V+P ++ + D+ ++ +  T A G   YE+S ++ 
Sbjct: 221 PPHLSLYHLTMEPNTVFAKYPP----VVPDDDASADMQDMIEQETGAAGYQHYEVSAYAQ 276

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
              ++ HNLNYW++GDY+GIG GAH+++      +  +  K P+S+++ +R  G+ + E+
Sbjct: 277 PKRQARHNLNYWQFGDYLGIGAGAHTKLSFPHRVIRQARYKQPKSYMEQMRL-GNPIQEE 335

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL 362
           + ++  +   EF++  +RL EG+ V  +    G  L+   ER L
Sbjct: 336 KEITRSELGFEFMLNAMRLVEGVEVNMFAERTGMPLN-AVERAL 378


>gi|325127827|gb|EGC50735.1| hypothetical protein NMXN1568_1476 [Neisseria meningitidis N1568]
 gi|325131882|gb|EGC54582.1| hypothetical protein NMBM6190_1409 [Neisseria meningitidis M6190]
 gi|325137932|gb|EGC60507.1| hypothetical protein NMBES14902_1559 [Neisseria meningitidis
           ES14902]
 gi|325139886|gb|EGC62417.1| hypothetical protein NMBCU385_1468 [Neisseria meningitidis CU385]
 gi|325197885|gb|ADY93341.1| hypothetical protein NMBG2136_0612 [Neisseria meningitidis G2136]
 gi|325200649|gb|ADY96104.1| hypothetical protein NMBH4476_1524 [Neisseria meningitidis H44/76]
          Length = 399

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFVHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|325129805|gb|EGC52613.1| hypothetical protein NMBOX9930304_1399 [Neisseria meningitidis
           OX99.30304]
 gi|325202539|gb|ADY97993.1| hypothetical protein NMBM01240149_1428 [Neisseria meningitidis
           M01-240149]
 gi|325207711|gb|ADZ03163.1| hypothetical protein NMBNZ0533_0711 [Neisseria meningitidis
           NZ-05/33]
          Length = 399

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|255066001|ref|ZP_05317856.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria sicca ATCC 29256]
 gi|255049912|gb|EET45376.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria sicca ATCC 29256]
          Length = 391

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 130/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F  M   G L    +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHMPPKGLL---QDEAALDIEDAVHGALEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++    A VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSAAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLATDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|194289071|ref|YP_002004978.1| coproporphyrinogen iii oxidase [Cupriavidus taiwanensis LMG 19424]
 gi|193222906|emb|CAQ68911.1| Oxygen-independent coproporphyrinogen III
           oxidase(Coproporphyrinogenase)(Coprogen oxidase)
           [Cupriavidus taiwanensis LMG 19424]
          Length = 410

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 130/381 (34%), Positives = 217/381 (56%), Gaps = 12/381 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHV----RRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           GS  L +YVH P+CV+KCPYCDFNSH       +++ ++ ++ +   +++    L   R 
Sbjct: 29  GSPPLSLYVHVPWCVRKCPYCDFNSHAAPGADNHEIPEDLYLDALRADLEQSLPLVWGRP 88

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + ++F GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  YR +G+
Sbjct: 89  VHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEANPGTFEAEKFASYRASGI 148

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+G+QS  ++ L+ LGR H  +EA  AI +A+  F  ++ DL+YALP QT+ + + +
Sbjct: 149 NRLSIGIQSFNDRHLQALGRIHGGTEARRAIDIAQASFDNINLDLMYALPGQTLQECQAD 208

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           ++ AL Y   HLSLY LT+E  TLF K        LP ++ A ++ +  ++ T+A G   
Sbjct: 209 VETALGYGTTHLSLYHLTLEPNTLFAKFPP----ALPDDDTAYEMQDWIEARTAAAGYRH 264

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE S ++    E+ HNLNYWR+GDY+GIG GAH ++      +     KHP +++     
Sbjct: 265 YETSAYARPHREARHNLNYWRFGDYLGIGAGAHGKLSFPQRVLRQMRHKHPATYMAQAMA 324

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGFI 368
            G+AV E   + +++   EF++  LRL +G+    ++   G  L    ++    +++G +
Sbjct: 325 -GNAVQEARDVGADELPFEFMLNALRLTDGVPASSFQDYTGLPLHTISKQLAEAEKKGLL 383

Query: 369 ERVQFSRLRCTQRGMTMLDSV 389
           E    + +R T+ G   L+ +
Sbjct: 384 E-ADLTTIRPTELGRRFLNDL 403


>gi|15676563|ref|NP_273707.1| coproporphyrinogen III oxidase [Neisseria meningitidis MC58]
 gi|7225891|gb|AAF41083.1| oxygen-independent coprophorphyrinogen III oxidase family protein
           [Neisseria meningitidis MC58]
 gi|316983631|gb|EFV62612.1| oxygen-independent coproporphyrinogen III oxidase-like protein yggW
           [Neisseria meningitidis H44/76]
          Length = 391

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFVHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|319410037|emb|CBY90371.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria meningitidis WUE 2594]
          Length = 391

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPTAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|161869602|ref|YP_001598769.1| coproporphyrinogen III oxidase [Neisseria meningitidis 053442]
 gi|161595155|gb|ABX72815.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           meningitidis 053442]
          Length = 399

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKINIDLMYALPNQTVRTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|170693636|ref|ZP_02884794.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           graminis C4D1M]
 gi|170141418|gb|EDT09588.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           graminis C4D1M]
          Length = 409

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 126/327 (38%), Positives = 197/327 (60%), Gaps = 6/327 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +     EN ++ +   +++    L   R + ++F 
Sbjct: 32  PLSLYVHFPWCVRKCPYCDFNSHEWKGDTFPENDYLDALRADLEMALPLVWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++++A  A+ +A + F   + DL++ALP+QT+ + + ++  ALS
Sbjct: 152 IQSFNEAHLKALGRIHDSTQARRAVEVAASTFDNFNLDLMFALPQQTLAECQADIDTALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP ++ + D+ +  Q  TSA G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIQERTSAAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 268 AKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPATFIEQA-KAGAAVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
           E+  +       EF++  LRL EG  V
Sbjct: 327 EEHEVGPRDLPFEFMLNALRLVEGFPV 353


>gi|71909464|ref|YP_287051.1| coproporphyrinogen III oxidase [Dechloromonas aromatica RCB]
 gi|71849085|gb|AAZ48581.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Dechloromonas aromatica RCB]
          Length = 399

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 131/340 (38%), Positives = 195/340 (57%), Gaps = 5/340 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S  L +YVH P+CV+KCPYCDFNSH     + +  ++ + + ++Q    L   R + S+F
Sbjct: 25  SPPLALYVHVPWCVQKCPYCDFNSHEANGTIPEREYVDALIADLQSALPLIWGRPVVSVF 84

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  ++        ++ + EIT+EANP +VE   F G+R AGVNR+SL
Sbjct: 85  FGGGTPSLLSPAAVDELIATFRALAMLAPDAEITLEANPGTVEAEKFAGFRSAGVNRLSL 144

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  ++ L+ LGR H A EA  A  LA   F   + DL+Y LP QT  Q   +++ AL
Sbjct: 145 GIQSFNDEHLQALGRIHGAEEAKRAAQLAGEHFDSFNLDLMYGLPGQTHEQALSDVETAL 204

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S++  HLS YQLT+E  T F     +    LP  ++  D+    ++  +A G   YE S 
Sbjct: 205 SFSPSHLSCYQLTLEPNTRFAAFPPE----LPESDICADMQESIEARLAAAGFSNYETSA 260

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            +  G +  HNLNYW +GDY+GIG GAHS++ +    +     KHP+++L+ +R +GHAV
Sbjct: 261 FAQRGKQCKHNLNYWYFGDYLGIGAGAHSKLTLHDRVLRQMRWKHPKAYLENIR-SGHAV 319

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
            E   +       EF+M  LRL +G     +E    ++L+
Sbjct: 320 QEDNQVEVASLPFEFMMNALRLADGFHPSLFEARTAQSLN 359


>gi|295677346|ref|YP_003605870.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1002]
 gi|295437189|gb|ADG16359.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1002]
          Length = 409

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 216/378 (57%), Gaps = 11/378 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +     + +++ +   +++    L   R + ++F 
Sbjct: 32  PLALYVHFPWCVRKCPYCDFNSHEWKGASFPESDYLDALRADLEMALPLIWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  I     + ++ EIT+EANP + E + F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEADKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+A++A  A+ +A   F   + DL++ALPKQT+ + + +++ ALS
Sbjct: 152 IQSFNETQLKALGRIHDAAQARHAVEVAATTFDNFNLDLMFALPKQTLAECQADVETALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP ++ + D+ +     T+A G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIHQRTAAAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  V  +  KHP ++++  R  G +V 
Sbjct: 268 ARPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRIVRQARYKHPTTFIEQARA-GASVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQF 373
           E+  +       EF++  LRL EG  V  +    G ++    E  LQ   R+  I R   
Sbjct: 327 EEHEVGPRDLPFEFMLNALRLVEGFPVHRFIERTGLSI-TTIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIA 391
            R+  T  G   L+ + A
Sbjct: 385 ERIAPTPLGQAFLNDLQA 402


>gi|8922911|ref|NP_060816.1| radical S-adenosyl methionine domain-containing protein 1,
           mitochondrial precursor [Homo sapiens]
 gi|145566941|sp|Q9HA92|RSAD1_HUMAN RecName: Full=Radical S-adenosyl methionine domain-containing
           protein 1, mitochondrial; AltName:
           Full=Oxygen-independent coproporphyrinogen-III
           oxidase-like protein RSAD1; Flags: Precursor
 gi|7023659|dbj|BAA92043.1| unnamed protein product [Homo sapiens]
          Length = 442

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 136/379 (35%), Positives = 220/379 (58%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R ++ +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-RLEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + +++E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQAAHLPADLEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +A ++Y   +++    G H YE+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|148683983|gb|EDL15930.1| radical S-adenosyl methionine domain containing 1, isoform CRA_c
           [Mus musculus]
          Length = 397

 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 126/330 (38%), Positives = 195/330 (59%), Gaps = 6/330 (1%)

Query: 25  WPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLI 84
           WP+C K+C YC+FN ++ R  V +       +TE + + +L+G + + S+FFGGGTPSL 
Sbjct: 1   WPYCEKRCSYCNFNKYIPR-GVEEGTVRNCLVTEARTLLRLSGVQRVESVFFGGGTPSLA 59

Query: 85  EPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQS 144
            P  +A +L+ +A+   + ++ E+T+EANP+S        +  AGVNR+S+G+QSL++  
Sbjct: 60  SPHTVAAVLEAVAQEVYLPADSEVTLEANPTSAPGPRLAAFGAAGVNRLSIGLQSLDDAE 119

Query: 145 LRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
           L+ LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +LQ+ L +  DHLS
Sbjct: 120 LQLLGRTHSASDALRTLAEARLLFPGRVSVDLMLGLPAQKVEPWLQQLQKLLYHCDDHLS 179

Query: 204 LYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAES 263
           LYQLT+E+GT  +   + G L  P  ++A ++Y   +++    G   YE+SN +  GA S
Sbjct: 180 LYQLTLERGTSLFAQVQQGTLPAPDPDLAAEMYQEGRTVLRDAGFRQYEVSNFARNGALS 239

Query: 264 LHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAVVEKE 319
            HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V   GH   +  
Sbjct: 240 THNWTYWQCGQYLGIGPGAHGRFVPQGTGGHTREARIQTLEPDNWMKEVTLFGHGTRKCV 299

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEML 349
            L   +  +E L MGLR   G++ + W+  
Sbjct: 300 RLGKLELLEEVLAMGLRTDVGVTHQHWQQF 329


>gi|307730702|ref|YP_003907926.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1003]
 gi|307585237|gb|ADN58635.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1003]
          Length = 409

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 126/327 (38%), Positives = 197/327 (60%), Gaps = 6/327 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  + +   EN ++ +   +++    L   R + ++F 
Sbjct: 32  PLSLYVHFPWCVRKCPYCDFNSHEWKGETFPENDYLDALRADLEMALPLVWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++ +A  A+ +A   F   + DL++ALP+QT+ + E +++ ALS
Sbjct: 152 IQSFNEAHLKALGRIHDSKQARQAVEVAATTFDNFNLDLMFALPQQTLAECEADVETALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S +
Sbjct: 212 FEPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIHERTSAAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 268 AKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPATFIEQA-KAGAAVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
           E+  +S+     EF++  LRL EG  V
Sbjct: 327 EEHEVSARDLPFEFMLNALRLMEGFPV 353


>gi|71274726|ref|ZP_00651014.1| Putative oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa Dixon]
 gi|71899593|ref|ZP_00681748.1| Putative oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa Ann-1]
 gi|170730032|ref|YP_001775465.1| coproporphyrinogen III oxidase [Xylella fastidiosa M12]
 gi|71164458|gb|EAO14172.1| Putative oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa Dixon]
 gi|71730635|gb|EAO32711.1| Putative oxygen-independent coproporphyrinogen III oxidase [Xylella
           fastidiosa Ann-1]
 gi|167964825|gb|ACA11835.1| coproporphyrinogen III oxidase [Xylella fastidiosa M12]
          Length = 383

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 216/379 (56%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  + ++ + L ++++   L   R + S+F G
Sbjct: 6   PLSLYVHLPWCVRKCPYCDFNSHQAKGALPFDAYVNALLRDLEYDLPLVWGRVVHSVFLG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   A    ++ + EIT+E NP + E   F  Y  AG+NR+S G+
Sbjct: 66  GGTPSLFPPEAIDRFLQIAAARLRLAPDAEITLETNPGTAEYGRFDRYLAAGINRLSFGI 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS  + +LR LGR H++ +A  A+ LA++  F  ++ DL+YALP+QT+ + E +LQRA +
Sbjct: 126 QSFNDAALRRLGRIHDSLQAEHAVKLAQDAGFTNINLDLMYALPEQTLLEAEHDLQRAFA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+FY     G   +P ++ A ++   TQ + +  G   YE+S +
Sbjct: 186 LAPTHLSYYQLTLEPNTVFYARPPQG---IPDDDAAWEMQEHTQRLLAEAGYQHYEVSAY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGHA 314
           +  G + LHNLNYWR+GDY+GIG GAH ++  G   H +     KHP ++L        A
Sbjct: 243 AREGWQCLHNLNYWRFGDYLGIGAGAHGKITSGVSQHVLRRWKCKHPYTYLDNA-GTVSA 301

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE---RV 371
           +   E + + +   E+++  LRLREG  ++D+ +  G  L +E      R+       R 
Sbjct: 302 IGGDEIVPTARLPFEYMLNLLRLREGFRLQDFALRTG--LTVESIHAALREAVARGWLRC 359

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +   +  T+ G+   + VI
Sbjct: 360 ELEHVIPTELGLRFANDVI 378


>gi|328474074|gb|EGF44879.1| HemN family oxidoreductase [Vibrio parahaemolyticus 10329]
          Length = 392

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 195/347 (56%), Gaps = 17/347 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L    T++   R    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYISALLEDLDTDIDKYRLNDAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI        ++EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIERLLKGIEARIPFKPDIEITMEANPGTIEAERFVGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A  L   I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQEKLERLGRIHGQDEAVNAAKLTHQIGLNSFNLDLMHGLPDQSIKQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   YE
Sbjct: 186 KAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWL----KM 307
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L     M
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQNM 301

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V+   H    ++ ++ E +  EF M   RL E    +D+    G  L
Sbjct: 302 VKPYLHT---EQLVADEDRPFEFFMNRFRLMEACPKQDYVDTTGLPL 345


>gi|254429937|ref|ZP_05043644.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alcanivorax sp. DG881]
 gi|196196106|gb|EDX91065.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alcanivorax sp. DG881]
          Length = 383

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 141/377 (37%), Positives = 214/377 (56%), Gaps = 20/377 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  R ++ +  ++Q+ LT+++    L G R + ++F GG
Sbjct: 8   LSLYIHTPWCVRKCPYCDFNSH-ERGEIPEAAYLQALLTDLEQDLPLIGDRPVETVFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+       +  GI +  T+ ++ EIT+EANP ++E   F+G+R AG+NR+S+GVQ
Sbjct: 67  GTPSLMSADFYRQLFQGIRQRLTLQADAEITLEANPGTLETGRFEGFRDAGINRLSIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L+ LGR H+AS AI A H AR   F   + D+++ALP Q+  Q   +LQ+A++ 
Sbjct: 127 SFNNAHLQALGRIHDASAAIDAAHQARAAGFDNFNLDIMHALPGQSHAQALDDLQQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS Y+LTIE  T+FY+       V P  +   D      ++ + HG   YEIS  +
Sbjct: 187 QPTHLSWYELTIEPNTVFYRAPP----VQPDSDAMADTEQAGFALLAQHGYQRYEISAFA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHAV 315
             G    HNLNYW++GDY+GIG GAH ++   S  H       + PE +L       HA 
Sbjct: 243 QSGRRCRHNLNYWQFGDYLGIGAGAHGKITQASQGHVHRYQKTRKPEDYLA---DAAHAR 299

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE-----RNLQRQGFIER 370
            + + ++ E +  E L+ GLRL +GI+   W+ LA    +   +       L++QG +  
Sbjct: 300 RQHQPIAREDRLFEALLNGLRLVDGIT---WQTLAQATGEPVSQWQNALTPLEQQGLLA- 355

Query: 371 VQFSRLRCTQRGMTMLD 387
           +   RL CT  G+  L+
Sbjct: 356 ITDQRLACTDNGLRHLN 372


>gi|325143947|gb|EGC66257.1| hypothetical protein NMBM01240013_1555 [Neisseria meningitidis
           M01-240013]
 gi|325206490|gb|ADZ01943.1| hypothetical protein NMBM04240196_1502 [Neisseria meningitidis
           M04-240196]
          Length = 399

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + ++FFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETVFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKINIDLMYALPNQTVRTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +   S     G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHSALENGGFIHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|297700808|ref|XP_002827424.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial-like [Pongo abelii]
          Length = 442

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 219/379 (57%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R +V +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-RVEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQTAHLPADSEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DH+SLYQL++E+GT  +   + G L  P   +A ++Y   +++    G H YE+SN +  
Sbjct: 221 DHVSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRALLREAGFHQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGIGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|240112338|ref|ZP_04726828.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae MS11]
 gi|240117362|ref|ZP_04731424.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID1]
 gi|240122917|ref|ZP_04735873.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID332]
 gi|254493139|ref|ZP_05106310.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 1291]
 gi|268598397|ref|ZP_06132564.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae MS11]
 gi|268603058|ref|ZP_06137225.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID1]
 gi|268681537|ref|ZP_06148399.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID332]
 gi|226512179|gb|EEH61524.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 1291]
 gi|268582528|gb|EEZ47204.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae MS11]
 gi|268587189|gb|EEZ51865.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID1]
 gi|268621821|gb|EEZ54221.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID332]
          Length = 391

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 204/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         GL  YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGLIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|55646747|ref|XP_511926.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial isoform 2 [Pan troglodytes]
          Length = 442

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 219/379 (57%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R +V +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-RVEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQTAHLPADSEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRMHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGLWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +A ++Y   +++    G H YE+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGIGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|294671109|ref|ZP_06735964.1| hypothetical protein NEIELOOT_02817 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307217|gb|EFE48460.1| hypothetical protein NEIELOOT_02817 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 391

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAITT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSVAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGIPAAKIMAQIETARQKGLLETNPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEQGRLFLNDLL 387


>gi|77461548|ref|YP_351055.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens Pf0-1]
 gi|77385551|gb|ABA77064.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 401

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 132/373 (35%), Positives = 216/373 (57%), Gaps = 12/373 (3%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R +SSIFFGGGTP
Sbjct: 32  YIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDAMLADLDQDLHAVYGRELSSIFFGGGTP 91

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           SL   + +  +L+G+ +    + ++EIT+EANP + E   F  YRK G+NR+S+G+QS +
Sbjct: 92  SLFSAEALGRLLEGVKQRIPFADDIEITLEANPGTFEQEKFVAYRKLGINRLSIGIQSFQ 151

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           ++ L+ LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A+     
Sbjct: 152 QEKLKALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPDQSLDDALSDLRQAIELKPT 211

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           H+S YQLT+E  T+F+        VLP ++   D+    Q++ + HG   YE+S ++  G
Sbjct: 212 HISWYQLTLEPNTVFWNQPP----VLPEDDTLWDIQEAGQALLAEHGYAQYEVSAYAQPG 267

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVVEKE 319
             + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L   +       EK 
Sbjct: 268 RPARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVRTWKTRLPKDYLNPAKS--FQAGEKA 325

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFSRLR 377
            L++++   EFLM  LRL  G+  + +    G +LD   E  R  ++ G ++ V+ SRL 
Sbjct: 326 -LTNDEMPFEFLMNALRLTAGVESRLYPERTGLSLDTLAEGRREAEQSGLLQ-VEPSRLA 383

Query: 378 CTQRGMTMLDSVI 390
            T+RG   L+ ++
Sbjct: 384 TTERGQLFLNDLL 396


>gi|325265917|ref|ZP_08132603.1| putative coproporphyrinogen dehydrogenase [Kingella denitrificans
           ATCC 33394]
 gi|324982555|gb|EGC18181.1| putative coproporphyrinogen dehydrogenase [Kingella denitrificans
           ATCC 33394]
          Length = 405

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 143/377 (37%), Positives = 215/377 (57%), Gaps = 11/377 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+C++KCPYCDFNSH  +  + ++ ++Q+ LT++Q        R I +IF GG
Sbjct: 12  LSLYVHIPWCLQKCPYCDFNSHTIKTTLDEDAYVQALLTDLQHELPHFWGRGIETIFIGG 71

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPS+     I  +L GI     ++   EIT+EANP + + + FQG+R AG+NR+S+GVQ
Sbjct: 72  GTPSVFSVSAIDRLLSGIRALVKLNPEAEITLEANPGTFDHDKFQGFRSAGINRLSIGVQ 131

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S +++ L  LGR H+A EA  AI  A  IF R++ DL+YALP+Q       ++Q ALS+ 
Sbjct: 132 SFDDRKLAALGRIHSADEARTAIEKACRIFERVNIDLMYALPQQNAADALADVQAALSFG 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           V H+S YQLT+E  T F      G   LP ++ A D+ +   S     G   YE S  + 
Sbjct: 192 VQHISAYQLTLEPNTPFGHTPPKG---LPEDDTAQDIEDTVHSALQHAGFERYETSAFAR 248

Query: 259 LG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSH--RVAISIEK-HPESWLKMVRKNGHA 314
              + + HNLNYW++GDYIGIG GAH ++   SH  R+  ++ K HPE++L  ++ N  A
Sbjct: 249 TPESRARHNLNYWQFGDYIGIGAGAHGKI---SHHDRIERTVRKRHPEAYLAAMQGNVQA 305

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERNLQRQGFIERVQF 373
            ++ + ++      EF+M  LRL  G+    +    G +L  IE      RQ  +     
Sbjct: 306 AIDHKTVAPNDLPFEFMMNALRLTGGVPAALFAERTGISLAQIEPVLAKARQKGLLDHAP 365

Query: 374 SRLRCTQRGMTMLDSVI 390
           + LR T+ G   L+ ++
Sbjct: 366 NVLRPTELGRRFLNDLL 382


>gi|110835441|ref|YP_694300.1| coproporphyrinogen oxidase [Alcanivorax borkumensis SK2]
 gi|110648552|emb|CAL18028.1| coproporphyrinogen oxidase [Alcanivorax borkumensis SK2]
          Length = 394

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 216/386 (55%), Gaps = 20/386 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  R ++ +  ++Q+ LT+++    L G R++ ++F G
Sbjct: 18  PLSLYIHTPWCVRKCPYCDFNSH-ERGEIPEAAYLQALLTDLEQDLPLIGERTVETVFIG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+       +  GI +   +  NVEIT+EANP ++E   FQG+R+AG+NR+S+G 
Sbjct: 77  GGTPSLLSADFYQQLFHGIRQRLALHPNVEITLEANPGTLENGRFQGFREAGINRLSIGA 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS     L+ LGR HNAS AI A H AR   F   + D+++ALP QT  Q   +LQ+A++
Sbjct: 137 QSFNNAHLQALGRIHNASAAINAAHQAREAGFDNFNLDIMHALPGQTHAQALDDLQQAIA 196

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS Y+LTIE  T+FY+       V P  +   D      ++ + HG   YEIS  
Sbjct: 197 LQPTHLSWYELTIEPNTVFYRSPP----VQPDSDTMADTEQAGFALLAEHGYLRYEISAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS----HRVAISIEKHPESWLKMVRKNG 312
           +  G    HNLNYW++GDY+GIG GAH ++   +    HR   +  + PE +L       
Sbjct: 253 AQPGRPCRHNLNYWQFGDYLGIGAGAHGKITAAAQGDVHRYQKT--RKPEDYLA---DAA 307

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIE 369
           HA  + + ++ E +  E L+ GLRL  G+  +  E   G  +  +    L   ++QG + 
Sbjct: 308 HARRQHQPIAREDRLFEALLNGLRLTHGLCWQTLEDATGEPV-AQWRHQLTPFEQQGLLT 366

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
                RL CT  G+  L+ ++  LA 
Sbjct: 367 LTD-QRLACTDNGLRHLNGLLEKLAA 391


>gi|323498666|ref|ZP_08103657.1| HemN family oxidoreductase [Vibrio sinaloensis DSM 21326]
 gi|323316266|gb|EGA69286.1| HemN family oxidoreductase [Vibrio sinaloensis DSM 21326]
          Length = 391

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 199/350 (56%), Gaps = 21/350 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQL-TGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  +  + ++ +I + L +++      QL + PR + S
Sbjct: 8   ALSLYVHIPWCVQKCPYCDFNSHALKADIPEKEYIAALLQDLEADIKRYQLESNPRLLHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  Q IA +L GI         +EIT+EANP ++E   F GY+KAGV RI
Sbjct: 68  IFIGGGTPSLISAQGIADLLSGIEARLPFKPGIEITMEANPGTIEAERFAGYQKAGVTRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP QT+ Q   +L+
Sbjct: 128 SVGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPNQTVDQALNDLE 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  T+FY         LP ++   D++ L     +  G   YE
Sbjct: 188 KAIALDPPHLSWYQLTIEPNTMFYYKQP----TLPDDDDLWDIFELGHKKLADAGYVQYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP+ +L      
Sbjct: 244 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKISFADGRIVRTTKIKHPKGYLA----- 298

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLD 355
            +  + K +L+SE+Q        EF M   RL E    +D+    G   D
Sbjct: 299 AYDNMVKPYLNSEEQVAEQDRPFEFFMNRFRLIEACPKQDFLDTTGLGFD 348


>gi|30046991|gb|AAH50538.1| Radical S-adenosyl methionine domain containing 1 [Homo sapiens]
 gi|119615016|gb|EAW94610.1| radical S-adenosyl methionine domain containing 1 [Homo sapiens]
          Length = 442

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 136/379 (35%), Positives = 219/379 (57%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R ++ +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-RLEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQTAHLPADSEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +A ++Y   +++    G H YE+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|59800687|ref|YP_207399.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA 1090]
 gi|293399618|ref|ZP_06643771.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           gonorrhoeae F62]
 gi|59717582|gb|AAW88987.1| putative porphyrin oxidoreductase [Neisseria gonorrhoeae FA 1090]
 gi|291610187|gb|EFF39309.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           gonorrhoeae F62]
          Length = 391

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|262273746|ref|ZP_06051559.1| coproporphyrinogen III oxidase, oxygen-independent [Grimontia
           hollisae CIP 101886]
 gi|262222161|gb|EEY73473.1| coproporphyrinogen III oxidase, oxygen-independent [Grimontia
           hollisae CIP 101886]
          Length = 384

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 146/384 (38%), Positives = 217/384 (56%), Gaps = 17/384 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ----WMRQLTGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH  +  V + ++I + L +++        ++G R +SS
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHTLKGDVPERDYIDALLDDLRKDLNRFHGVSG-RELSS 64

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+ P+ IA +L GI      + ++EIT+EANP +VE + F  YRKAGVNRI
Sbjct: 65  IFIGGGTPSLVSPEEIARLLQGIEAQIPFADDIEITMEANPGTVEADKFVAYRKAGVNRI 124

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS + Q L  LGR H A EAI A  LA        + DL++ LP QT+     +L+
Sbjct: 125 SIGVQSFDNQKLARLGRIHGADEAIRAARLAHEADLNSFNLDLMHGLPDQTLEGALDDLR 184

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  T +Y         LP ++   D++    ++ +  G   YE
Sbjct: 185 QAIALNPPHLSWYQLTIEPNTQYYSKPP----TLPDDDDLWDIFEQGHALLTEAGYVQYE 240

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
            S +S  G +  HNLNYWR+GDY+GIG GAH +V +  + V  +++ KHP  +L     +
Sbjct: 241 TSGYSKPGFQCRHNLNYWRFGDYLGIGCGAHGKVTLEDNTVKRTVKVKHPRGYLD---PD 297

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECE-RNLQRQGFIE 369
              + E   + + +   EF M   RL E     D+    G +LD +E   R+   +G + 
Sbjct: 298 NAYLSEIITVEASELPFEFFMNRFRLVEPCPKADYPARTGLSLDTVEAPLRHAIIEGLLT 357

Query: 370 RVQFSRLRCTQRGMTMLDSVIANL 393
             Q +  + T++G   L+ ++AN 
Sbjct: 358 ETQ-THWQVTEKGRLFLNDLLANF 380


>gi|325203752|gb|ADY99205.1| oxygen-independent coproporphyrinogen III oxidase-like protein yggW
           [Neisseria meningitidis M01-240355]
          Length = 391

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALENAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
                  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMRCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETNPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|325133820|gb|EGC56476.1| hypothetical protein NMBM13399_1544 [Neisseria meningitidis M13399]
          Length = 399

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFVHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|121634461|ref|YP_974706.1| coproporphyrinogen III oxidase [Neisseria meningitidis FAM18]
 gi|120866167|emb|CAM09907.1| putative porphyrin oxidoreductase [Neisseria meningitidis FAM18]
 gi|325135743|gb|EGC58355.1| hypothetical protein NMBM0579_1451 [Neisseria meningitidis M0579]
          Length = 399

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 25  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 84

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 85  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 144

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS     L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 145 QSFNNDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 204

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 205 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFVHYETSAFA 261

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 262 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAVE 321

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 322 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPAVF 381

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 382 RPTEKGRLFLNDLL 395


>gi|325141883|gb|EGC64325.1| hypothetical protein NMB9615945_1490 [Neisseria meningitidis
           961-5945]
          Length = 399

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 203/371 (54%), Gaps = 4/371 (1%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFGGGT
Sbjct: 28  LYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFGGGT 87

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GVQS 
Sbjct: 88  PSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGVQSF 147

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
            +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++    
Sbjct: 148 NDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIATGAT 207

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  +   
Sbjct: 208 HISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFVHYETSAFAKPA 264

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
            +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE++ 
Sbjct: 265 MQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVERKT 324

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRLRCT 379
           +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  R T
Sbjct: 325 VAAEDLPFEFMMNALRLTDGVPTAMLQERTGVPSAKIMAQIETARQKGLLETDPAVFRPT 384

Query: 380 QRGMTMLDSVI 390
           ++G   L+ ++
Sbjct: 385 EKGRLFLNDLL 395


>gi|293394479|ref|ZP_06638775.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291422944|gb|EFE96177.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 383

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 137/377 (36%), Positives = 216/377 (57%), Gaps = 16/377 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   L ++     +T  RSI +IF GG
Sbjct: 11  LSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLLADLDADLPMTSGRSIGTIFIGG 70

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V+ + EIT+EANP +VE + F GY++AGVNRIS+GVQ
Sbjct: 71  GTPSLLSAEAMQSLLDGVRARIRVNDDAEITMEANPGTVEADRFSGYQRAGVNRISIGVQ 130

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 131 SFSAEKLTRLGRIHGPDEAKRAAHLATGLGLRSFNLDLMHGLPDQSLAEALDDLRQAIAL 190

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF         VLP ++   D++    ++ SA G   YE S ++
Sbjct: 191 NPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFQQGHALLSAAGYQQYETSAYA 246

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +++     G  + 
Sbjct: 247 KPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRIVRTAKTKHPRGFMQ-----GKYLD 301

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN---LDIECERNLQRQGFIERVQF 373
           ++  +++E +  EF M   RL E     ++    G +   +  + +  L +   +E  Q 
Sbjct: 302 KQHEVATEDRPFEFFMNRFRLLEAAPRAEFSAYTGLDESTIRPQLDAALAKGYLVETAQH 361

Query: 374 SRLRCTQRGMTMLDSVI 390
            ++  T+RG   L+S++
Sbjct: 362 WQI--TERGKLFLNSLL 376


>gi|253997757|ref|YP_003049820.1| oxygen-independent coproporphyrinogen III oxidase [Methylovorus sp.
           SIP3-4]
 gi|253984436|gb|ACT49293.1| oxygen-independent coproporphyrinogen III oxidase [Methylovorus sp.
           SIP3-4]
          Length = 405

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/374 (37%), Positives = 203/374 (54%), Gaps = 16/374 (4%)

Query: 8   ENNMTGQGSNS-------LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           EN + GQ ++S       L +Y+H P+CV+KCPYCDFNSH  R  + +  ++ + + +++
Sbjct: 14  ENPLVGQLTSSGLRNPPPLSLYIHIPWCVRKCPYCDFNSHESRNPIPESAYVDALIADLE 73

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
               L   R + SIFFGGGTPSL   ++I  IL  +     +    EIT+EANP + E  
Sbjct: 74  QATPLVWGRKVRSIFFGGGTPSLFSAESIDRILSHVRMLTPLEYEAEITLEANPGTFEAE 133

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
            F GYR AGVNRIS+G+QS   + L+ LGR HN+ EA  A   A  IF  ++ DL+YALP
Sbjct: 134 RFAGYRDAGVNRISIGIQSFNPRHLQALGRIHNSEEAQYAAEHAIKIFGNVNLDLMYALP 193

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
           +QT+ +   ++  A++    H+S Y LT+E  T FY         LP ++ +  +    +
Sbjct: 194 EQTLEEALQDMHTAIALGPTHISAYHLTLEPNTPFYYKPP----ALPDDDTSATMQEAIE 249

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            + + HG   YE S     G    HNLNYW +GDY+GIG GAHS++      +  S  K 
Sbjct: 250 HLLADHGYGHYETSAFGKAGKRCRHNLNYWVFGDYLGIGAGAHSKLSFHDRILRQSRIKQ 309

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL---DIE 357
           P +++K V +  H V E+  L       EF+M  LRL EG   K +  + G+ L   D  
Sbjct: 310 PNAYMKAVAEMSH-VEEERLLDRADLGFEFMMNALRLTEGFDPKLFTTMTGQALSTVDPA 368

Query: 358 CERNLQRQGFIERV 371
            ++  QR G I R 
Sbjct: 369 LQQAEQR-GLITRT 381


>gi|194367045|ref|YP_002029655.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia
           R551-3]
 gi|194349849|gb|ACF52972.1| oxygen-independent coproporphyrinogen III oxidase [Stenotrophomonas
           maltophilia R551-3]
          Length = 408

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/380 (36%), Positives = 218/380 (57%), Gaps = 12/380 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  + ++  + +I + L ++     L   R + S+FFG
Sbjct: 30  PLSLYVHLPWCVRKCPYCDFNSHQAKGELPFDAYIDALLRDLDQDLPLVWGRVVHSVFFG 89

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   +     + N EIT+E NP + E   F  YR AGVNR+S G+
Sbjct: 90  GGTPSLFPPEAIDRFLQQASARLRFAPNAEITLETNPGTAEHGRFDRYRAAGVNRLSFGI 149

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++  L+ LGR H++ EA  A+ +A++  +   + DL+YALP+QT+   E +L+RA +
Sbjct: 150 QSFDDAMLKRLGRIHDSGEAERAVKMAQDAGYDNFNIDLMYALPEQTLAGAEADLERAFA 209

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  T+F+     G   +P E+ A D+    Q++ +  G   YE+S +
Sbjct: 210 LQPAHISHYQLTLEPNTVFFARPPQG---IPDEDNAWDMQEHCQALLAQAGFGQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +S HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+++L        +
Sbjct: 267 ARPGRQSAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKLKHPQAYLDSAGTPA-S 325

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN---LDIECERNLQRQGFIERV 371
               E ++ E+   E+++  LRL EG  ++D+E   G     LD      +QR G+++ V
Sbjct: 326 FGGDEVIAPERLPFEYMLNLLRLHEGFGLRDFESRTGLPRSVLDAPLAEAVQR-GWLD-V 383

Query: 372 QFSRLRCTQRGMTMLDSVIA 391
               ++ T+ G    + V++
Sbjct: 384 TDGHVQPTELGRRFTNDVVS 403


>gi|109491680|ref|XP_001081294.1| PREDICTED: radical S-adenosyl methionine domain containing 1-like
           [Rattus norvegicus]
 gi|149053892|gb|EDM05709.1| rCG34912 [Rattus norvegicus]
          Length = 442

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/331 (39%), Positives = 199/331 (60%), Gaps = 6/331 (1%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R  V +       +TE + + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-GVDEGAVRNCLVTEARTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A IL+ +A+   + ++ E+T+EANP+S        +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAILEAVAQEVYLPADSEVTLEANPTSAPGPRLAAFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  L+ LGR H+A EA+  +  AR++FP R+S DL+  LP Q +  W  +LQ+ L +  
Sbjct: 161 DDAELQLLGRTHSAREALQTLTEARHLFPGRVSVDLMLGLPAQKVKPWLQQLQKLLRHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQLT+E+GT  +   + G L  P  ++A ++Y   +++    G   YE+SN +  
Sbjct: 221 DHLSLYQLTLERGTSLFAQVQQGTLPAPDPDLAAEMYQEGRTVLRDAGFRQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+GIGPGAH +      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSNHNWTYWQCGQYLGIGPGAHGQFVPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDW 346
            +   LS  +  +E L MGLR   G++ + W
Sbjct: 341 RKCVPLSELELLEEVLAMGLRTDVGVTHQHW 371


>gi|332284448|ref|YP_004416359.1| coproporphyrinogen III oxidase [Pusillimonas sp. T7-7]
 gi|330428401|gb|AEC19735.1| coproporphyrinogen III oxidase [Pusillimonas sp. T7-7]
          Length = 416

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/386 (35%), Positives = 218/386 (56%), Gaps = 24/386 (6%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+CV+KCPYCDFNSH    ++ +++++ +   +++    L   R + SIF GG
Sbjct: 42  LSLYVHVPWCVRKCPYCDFNSHELGAELPEQDYLTALQADLEQALPLIWGRQVVSIFIGG 101

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  Q +  +L        +  + EIT+EANP +VE   F  Y  +GVNRISLG+Q
Sbjct: 102 GTPSLLSGQALDQMLAMFRACLNLLPDAEITLEANPGTVEAGRFADYAASGVNRISLGIQ 161

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S + ++L  LGR H+A +A AA+ +A+ +  R++ D++YALP Q++     +L +A+S+ 
Sbjct: 162 SFDNRALEALGRIHDAEQARAAVEIAQKVVDRVNLDIMYALPGQSIDDCAQDLHQAMSFQ 221

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLSLY LT+E  T+F K        +P ++ +  + +L    T+A G   YE+S ++ 
Sbjct: 222 TGHLSLYHLTLEPNTVFAKYPP----TVPDDDTSAAMQDLIADATAAGGWERYEVSAYAR 277

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK--MVRKNGHAVV 316
            G    HNLNYW +GDY+GIGPGAH ++      V  +  K+P SW+K  M+R   H   
Sbjct: 278 SGQRCRHNLNYWEFGDYLGIGPGAHGKLSFHDKIVRQAKLKNPSSWMKKAMLRDGSH--- 334

Query: 317 EKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRN---LDIECERNLQRQGF 367
               L+ ++Q D      EF++  LRL+ G+    +    G++   +    ER + R G 
Sbjct: 335 ----LAEDRQVDWKDLGFEFMLNVLRLKHGVPRSSYIERTGQSILAIAPALERAVAR-GL 389

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANL 393
           +E     RL+ T+ G   L+ + A  
Sbjct: 390 LEPGH-ERLQATEHGWQFLNDLQAEF 414


>gi|309378944|emb|CBX22397.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 391

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + ++FFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETVFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALENAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCCHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSVAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTKQGRLFLNDLL 387


>gi|260441106|ref|ZP_05794922.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI2]
 gi|291044438|ref|ZP_06570147.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI2]
 gi|291011332|gb|EFE03328.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI2]
          Length = 391

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|298368352|ref|ZP_06979670.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria sp.
           oral taxon 014 str. F0314]
 gi|298282355|gb|EFI23842.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria sp.
           oral taxon 014 str. F0314]
          Length = 391

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDGMLARLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F          LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPK---CLPQDEAALDIEDAVHGALEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  + +   +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLKTNPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|190575705|ref|YP_001973550.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia K279a]
 gi|190013627|emb|CAQ47262.1| putative coproporphyrinogen III oxidase family protein
           [Stenotrophomonas maltophilia K279a]
          Length = 408

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 222/393 (56%), Gaps = 12/393 (3%)

Query: 5   SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQ 64
           SA  +N        L +YVH P+CV+KCPYCDFNSH  + ++  + +I + L ++     
Sbjct: 17  SADHDNPPRLVPPPLSLYVHLPWCVRKCPYCDFNSHQAKGELPFDAYIDALLRDLDQDLP 76

Query: 65  LTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQG 124
           L   R + S+FFGGGTPSL  P+ I   L   +     + N EIT+E NP + E   F  
Sbjct: 77  LVWGRVVHSVFFGGGTPSLFPPEAIDRFLQQASARLRFAPNAEITLETNPGTAEHGRFDR 136

Query: 125 YRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQT 183
           YR AGVNR+S G+QS ++  L+ LGR H++ EA  A+ +A++  +   + DL+YALP+QT
Sbjct: 137 YRAAGVNRLSFGIQSFDDAMLKRLGRIHDSGEAERAVKMAQDAGYDNFNIDLMYALPEQT 196

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
           +   E +L+RA +    H+S YQLT+E  T+F+     G   +P E+ A D+    Q++ 
Sbjct: 197 LAGAEADLERAFALQPAHISHYQLTLEPNTVFFARPPQG---IPDEDNAWDMQEHCQALL 253

Query: 244 SAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHP 301
           +  G   YE+S ++  G +S HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP
Sbjct: 254 AQAGFGQYEVSAYARPGRQSAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKLKHP 313

Query: 302 ESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN---LDIEC 358
           +++L        +    + ++ E+   E+++  LRL EG  ++D+E   G     LD   
Sbjct: 314 QAYLDSAGTPA-SFGGNDVIAPERLPFEYMLNLLRLHEGFGLRDFESRTGLPRSVLDAPL 372

Query: 359 ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIA 391
              +QR G+++ V    ++ T+ G    + V++
Sbjct: 373 AEAVQR-GWLD-VTDGHVQPTELGRRFTNDVVS 403


>gi|308050659|ref|YP_003914225.1| coproporphyrinogen III oxidase, anaerobic [Ferrimonas balearica DSM
           9799]
 gi|307632849|gb|ADN77151.1| coproporphyrinogen III oxidase, anaerobic [Ferrimonas balearica DSM
           9799]
          Length = 379

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/381 (37%), Positives = 219/381 (57%), Gaps = 14/381 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C +KCPYCDFNSH R+  + ++ +I + L ++     L   R ++SIF G
Sbjct: 5   PLSLYIHIPWCEQKCPYCDFNSHARKGAIPEQEYIAALLADLDRDLALAQGRMLTSIFIG 64

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSLI P  IA +L G+A+    +   E+T+EANP ++E + F+ YR+AGVNR+S+GV
Sbjct: 65  GGTPSLISPAGIASLLSGVAERLPFAPQCEVTMEANPGTLEADRFRPYREAGVNRLSVGV 124

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++  L  LGR H A EA  A + AR   F R + DL++ LP Q++T    +L++A++
Sbjct: 125 QSFQQDKLLILGRIHGAEEARRAANEARKAGFERFNLDLMHTLPGQSVTDALYDLEQAIA 184

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  T F     +    LP ++    ++   +++  A G   YEIS  
Sbjct: 185 LKPPHLSWYQLTIEPNTQFASKPPE----LPDDDTQWAIFEQGKAMLEAAGYRQYEISAW 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++      +  +++ KHP+ +L+  R     +
Sbjct: 241 AQPGYQCEHNLNYWRFGDYLGIGCGAHGKITQPDGTLLRTVKVKHPKGYLEPGRD---PM 297

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWE---MLAGRNLDIECERNLQRQGFIERVQ 372
            E+  +  E QA E+ M  LRL E + + +      L   ++       LQR G IER  
Sbjct: 298 AEQYSVEREDQALEYYMNRLRLMEPMPLSELSERTQLTPDDVAKPLNWALQR-GLIERDN 356

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
             +++ T++G   L+ ++A  
Sbjct: 357 -QQMQLTEQGHRFLNELLAQF 376


>gi|313668861|ref|YP_004049145.1| porphyrin oxidoreductase [Neisseria lactamica ST-640]
 gi|313006323|emb|CBN87786.1| putative porphyrin oxidoreductase [Neisseria lactamica 020-06]
          Length = 391

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVRTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALENAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 QNNKQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETNPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|240127626|ref|ZP_04740287.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-93-1035]
 gi|268686006|ref|ZP_06152868.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-93-1035]
 gi|268626290|gb|EEZ58690.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-93-1035]
          Length = 391

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 203/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|221065459|ref|ZP_03541564.1| oxygen-independent coproporphyrinogen III oxidase [Comamonas
           testosteroni KF-1]
 gi|220710482|gb|EED65850.1| oxygen-independent coproporphyrinogen III oxidase [Comamonas
           testosteroni KF-1]
          Length = 409

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 220/377 (58%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
            L +YVH P+C+KKCPYCDFNSH   +   + ++ +I + + +++    L   R++ S+F
Sbjct: 35  PLSLYVHLPWCLKKCPYCDFNSHAWAKGDALPEDRYIDALMADLESALPLIWGRTVHSVF 94

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P++I  ++ G+     +  + EIT+EANP + E + F+ +R AGVNR+S+
Sbjct: 95  MGGGTPSLFSPESIDKLIAGLRARLRMEPDCEITMEANPGTFEKDRFKAFRAAGVNRLSI 154

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS +++ L+ +GR H+A++A AA+  A + F   + DL+YALP Q++   + ++  AL
Sbjct: 155 GVQSFDDRYLQAVGRVHDAAQAQAAVREAADNFETFNIDLMYALPGQSLADLQRDVDTAL 214

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++A  HLS+Y LTIE  T F K       ++P ++ A ++ +L  + T   G+  YE+S 
Sbjct: 215 AFAPPHLSIYHLTIEPNTYFAKYPP----LVPEDDTAYEMLDLITASTQGAGMQRYEVSA 270

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
           ++  G +  HN NYW++GDY+GIG GAHS++   +HR+   +  + P  ++ M    G  
Sbjct: 271 YAKEGHQCFHNSNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRFRDPARYMDMALA-GTP 328

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQ 372
           + +   +   +   E+++  LRLR G +++++    G  +    +     Q +G I R  
Sbjct: 329 LAQDNEVKRAELPFEYMLNALRLRGGFALQEFMERTGLPMSAIAKGLDQAQAKGLITR-D 387

Query: 373 FSRLRCTQRGMTMLDSV 389
             R+  T+RG   L  +
Sbjct: 388 LGRVVPTERGFDFLSDL 404


>gi|62896503|dbj|BAD96192.1| radical S-adenosyl methionine domain containing 1 variant [Homo
           sapiens]
          Length = 442

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 220/379 (58%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R ++ +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-RLEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + +++E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQAAHLPADLEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +L+  L +  
Sbjct: 161 DDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLRELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +A ++Y   +++    G H YE+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|304388086|ref|ZP_07370215.1| possible coproporphyrinogen dehydrogenase [Neisseria meningitidis
           ATCC 13091]
 gi|304337943|gb|EFM04083.1| possible coproporphyrinogen dehydrogenase [Neisseria meningitidis
           ATCC 13091]
          Length = 391

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + ++FFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETVFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALENAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
                  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMRCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETNPAVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|261364291|ref|ZP_05977174.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria mucosa ATCC 25996]
 gi|288567538|gb|EFC89098.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria mucosa ATCC 25996]
          Length = 391

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI+ A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLMRLGRVHNGKEALTAINTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPIEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++     EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAADLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T+RG   L+ ++
Sbjct: 374 RPTERGRLFLNDLL 387


>gi|73966371|ref|XP_851668.1| PREDICTED: similar to radical S-adenosyl methionine domain
           containing 1 [Canis familiaris]
          Length = 484

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 194/335 (57%), Gaps = 6/335 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           S G    WP+C K+C YC+FN ++ R  V +       +TE Q + +L+G R + S+FFG
Sbjct: 81  SPGPCPPWPYCEKRCSYCNFNKYIPR-GVEEAAVRSCLVTEAQTLLRLSGVRRVESVFFG 139

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P  +A +L+ + +   + ++ E+T+EANP+S   +    +  AGVNR+S+G+
Sbjct: 140 GGTPSLASPSTVAAVLEAVDQAAHLPADSEVTLEANPTSAPSSRLAAFGAAGVNRLSIGL 199

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALS 196
           QSL++  L+ LGR H++ +A+  +  AR +FP R+S DL+  LP Q +  W  +L+  L 
Sbjct: 200 QSLDDTELQLLGRTHSSRDALQTLAEARRLFPGRVSVDLMLGLPAQQVGPWLRQLRTLLG 259

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              DH+SLYQLT+E+GT  +   + G L  P   +A ++Y   +++    G   YE+SN 
Sbjct: 260 CCDDHISLYQLTLERGTELFTQVQRGTLSAPDPELAAEMYQEGRALLRDAGFRQYEVSNF 319

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVK---VGSHRVAISIEK-HPESWLKMVRKNG 312
           +  GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K V   G
Sbjct: 320 ARNGALSTHNWTYWQCGQYLGVGPGAHGRFAPQGAGDHTREARIQTLEPDNWMKEVMLFG 379

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWE 347
           H    +  LS  +  +E L MGLR   GI+ + W+
Sbjct: 380 HGTRRRIPLSKLELLEEVLAMGLRTDVGITHQHWQ 414


>gi|307547057|ref|YP_003899536.1| coproporphyrinogen III oxidase [Halomonas elongata DSM 2581]
 gi|307219081|emb|CBV44351.1| coproporphyrinogen III oxidase [Halomonas elongata DSM 2581]
          Length = 391

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 220/382 (57%), Gaps = 14/382 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           L +YVH P+CV+KCPYCDFNSH   R  ++ +E ++ + + ++     L   R I S+F 
Sbjct: 8   LALYVHVPWCVRKCPYCDFNSHGVGRGAELPEEEYLAALIEDLDADLPLAAGREIVSVFI 67

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+       +L+ +     ++S++EIT+EANP ++E   F GYR+AG+NR+SLG
Sbjct: 68  GGGTPSLMSASFYLRLLEALQARLPLASDIEITLEANPGTLERGRFAGYREAGINRLSLG 127

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS ++  L  LGR H+  +A AAI  AR+  F  ++ DL++ LP Q++     +L RAL
Sbjct: 128 VQSFQDDQLAALGRIHSGGDAGAAIAEARHAGFDNLNIDLMHGLPGQSVELALADLDRAL 187

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + + +HLS YQLT+E  T F+         LP E V  D+ ++      A GL  YEIS 
Sbjct: 188 ALSPEHLSWYQLTLEPNTEFHSRPP----TLPEEEVLWDIQDMGHERLEAEGLERYEISA 243

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-----KHPESWLKMVRK 310
           ++  G  + HNLNYWR+GDY+GIG GAH ++   +    ++IE     + PE++L+    
Sbjct: 244 YARPGLGARHNLNYWRFGDYLGIGAGAHGKLSARAGD-GLTIERRWKARQPEAYLRRRHD 302

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER-NLQRQGFIE 369
               V  +  +++++   EF M  LRL +G+S+  W   +G   ++   R    R+  + 
Sbjct: 303 PRGFVAGRAAVTADELPLEFAMNALRLVDGVSMATWSAHSGYPQEVMTSRLTRAREKGLL 362

Query: 370 RVQFSRLRCTQRGMTMLDSVIA 391
                RL+ + RG+  L+ ++A
Sbjct: 363 VEDPERLQASPRGLLFLNELLA 384


>gi|296202473|ref|XP_002748473.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial [Callithrix jacchus]
          Length = 442

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 218/379 (57%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +Y+HWP+C K+C YC+FN ++ R  + +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYIHWPYCEKRCSYCNFNKYIPR-GMEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + ++ E+T+EANP+S  V+    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQTAHLPADSEVTLEANPTSAPVSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRTHSARDALRTLAEARWLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +A ++Y   ++     G   YE+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFAQVQQGALPAPDPELAAEMYERGRAALREAGFRQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V + GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGIGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMRFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + WE            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWEQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|113866971|ref|YP_725460.1| coproporphyrinogen III oxidase [Ralstonia eutropha H16]
 gi|113525747|emb|CAJ92092.1| Coproporphyrinogen III oxidase, Fe-S oxidoreductase [Ralstonia
           eutropha H16]
          Length = 410

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 131/382 (34%), Positives = 219/382 (57%), Gaps = 14/382 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHV----RRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           GS  L +YVH P+CV+KCPYCDFNSH       +++ ++ ++ +   +++    L   R 
Sbjct: 29  GSPPLSLYVHIPWCVRKCPYCDFNSHAAPGADNHEIPEDIYLDALRADLEQSLPLVWGRP 88

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + ++F GGGTPSL+    +  +L  I     + ++ EIT+EA P + E + F  YR +G+
Sbjct: 89  VHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEAKPGTFEADKFASYRASGI 148

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+G+QS  ++ L+ LGR H  +EA  AI +A+  F  ++ DL+YALP QT+ +   +
Sbjct: 149 NRLSIGIQSFNDRHLQALGRIHGGAEARKAIDIAQASFDNINLDLMYALPGQTLDECRQD 208

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           ++ ALSY   HLSLY LT+E  TLF K        LP ++ A ++ +  ++ T+  G   
Sbjct: 209 VEAALSYGTTHLSLYHLTLEPNTLFAKFPP----ALPDDDSAYEMQDWIEARTAQAGYRH 264

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR 309
           YE S ++    E+ HNLNYWR+GDY+GIG GAH ++    HR+   +  KHP ++++   
Sbjct: 265 YETSAYAKPHREARHNLNYWRFGDYLGIGAGAHGKLSF-PHRILRQMRHKHPATYMERAL 323

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGF 367
             G+AV E   + +++   EF++  LRL +G+    +    G  L    ++    +++G 
Sbjct: 324 A-GNAVQEARDVGADELPFEFMLNALRLTDGVPASSFHDYTGLPLHTISKQLAEAEKKGL 382

Query: 368 IERVQFSRLRCTQRGMTMLDSV 389
           +E    + +R T+ G   L+ +
Sbjct: 383 LE-ADLTTIRATELGRRFLNDL 403


>gi|254281851|ref|ZP_04956819.1| putative oxygen-independent coproporphyrinogen III oxidase [gamma
           proteobacterium NOR51-B]
 gi|219678054|gb|EED34403.1| putative oxygen-independent coproporphyrinogen III oxidase [gamma
           proteobacterium NOR51-B]
          Length = 383

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/378 (36%), Positives = 208/378 (55%), Gaps = 10/378 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+C +KCPYCDFNSH       +  ++ + L +++   Q    R I+SIF GG
Sbjct: 10  LALYVHIPWCERKCPYCDFNSHEGFKPDLEPVYVAALLADIEAQEQWIDSRPIASIFIGG 69

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL     I  +LDG+A+   + +  EIT+E NP S E + + GYR AGVNR+S+GVQ
Sbjct: 70  GTPSLFSADAIGKLLDGVARVAHLPAGTEITLETNPGSAEASRYIGYRAAGVNRLSIGVQ 129

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S +++ L  LGR H AS A  A  LAR+  F R + DL++ LP Q++     +L +AL+ 
Sbjct: 130 SFDDKQLTRLGRIHTASNARLATELARSAGFDRFNIDLMHGLPNQSVESALDDLNQALAC 189

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             DHLS YQLTIE+ T F+K       +LP E    D+    +++    G   YE+S  +
Sbjct: 190 GGDHLSWYQLTIERNTEFFKRPP----ILPQEKALGDIQERGEALLLGQGFEQYEVSAFA 245

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G +  HNLNYW++GDY+G+G GAH ++   +  +     + P  +L+ ++    A  +
Sbjct: 246 RPGQQCHHNLNYWQFGDYLGVGAGAHGKITDSTGILRTQRTRLPRDYLQSIKD--QAPPK 303

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFSR 375
           +  +++   A EF+M  LRLR+G S        G       E  R+L+ +G I  +  S 
Sbjct: 304 QTRVAASDLAGEFMMNALRLRQGFSTDLLLQRTGLGTGSVNETLRSLESKGLIA-IGDSN 362

Query: 376 LRCTQRGMTMLDSVIANL 393
           +  T  G   LD V+   
Sbjct: 363 ISATALGWRFLDDVVGEF 380


>gi|281340024|gb|EFB15608.1| hypothetical protein PANDA_012970 [Ailuropoda melanoleuca]
          Length = 342

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/324 (38%), Positives = 189/324 (58%), Gaps = 6/324 (1%)

Query: 24  HWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSL 83
            WP+C K+C YC+FN ++ R  V +       +TE Q + +L+G + + S+FFGGGTPSL
Sbjct: 18  QWPYCEKRCSYCNFNKYIPR-GVEEAAMRSCLVTEAQTLLRLSGVQRVESVFFGGGTPSL 76

Query: 84  IEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQ 143
             P  +A +L+ + +   + ++ E+T+EANP+S   +    +  AGVNR+S+G+QSL++ 
Sbjct: 77  ASPNTVAAVLEAVDQISHLPADSEVTLEANPTSASGSKLAAFGAAGVNRLSIGLQSLDDT 136

Query: 144 SLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAVDHL 202
            LR LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L    DHL
Sbjct: 137 ELRLLGRTHSASDALQTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQTLLGCCDDHL 196

Query: 203 SLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAE 262
           SLYQLT+E+GT  +   + G L  P   +  ++Y   +++    G   YE+SN +  GA 
Sbjct: 197 SLYQLTLERGTALFTQVQRGTLPAPDPELTAEMYQEGRAVLREAGFRQYEVSNFARNGAL 256

Query: 263 SLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAVVEK 318
           S HN  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V   GH+   +
Sbjct: 257 STHNWTYWQCGQYLGIGPGAHGRFVLQGAGGHTREARIQTLEPDNWMKEVMLFGHSTRRR 316

Query: 319 EFLSSEQQADEFLMMGLRLREGIS 342
             L   +  +E L MGLR   GI+
Sbjct: 317 VPLGQLELLEEVLAMGLRTDVGIT 340


>gi|323493574|ref|ZP_08098695.1| HemN family oxidoreductase [Vibrio brasiliensis LMG 20546]
 gi|323312097|gb|EGA65240.1| HemN family oxidoreductase [Vibrio brasiliensis LMG 20546]
          Length = 390

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 146/397 (36%), Positives = 212/397 (53%), Gaps = 34/397 (8%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  +  + ++ +I + L    T+++  +    PR + S
Sbjct: 8   ALSLYVHIPWCVQKCPYCDFNSHALKADIPEQEYIAALLQDLETDIERYQLNNSPRPLHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L GI       S++EIT+EANP ++E   F GY+KAGV RI
Sbjct: 68  IFIGGGTPSLISAEGIATLLQGIEARIPFKSDIEITMEANPGTIEAERFAGYQKAGVTRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 128 SVGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSVEQALADLD 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++       +  G   YE
Sbjct: 188 KAIELDPPHLSWYQLTIEPNTMFYYKQP----TLPDDDDLWDIFEQGHKKLADAGYVQYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L      
Sbjct: 244 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAFDN- 302

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAG-------RNLDIEC 358
               + K +LS E + D      EF M   RL E    +D+    G         +D   
Sbjct: 303 ----MVKPYLSDETEVDDTDRPFEFFMNRFRLIEACPKQDFLDTTGLGFTAIQETIDWAI 358

Query: 359 ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E+     G+I+    S  + T++G   L+ ++    V
Sbjct: 359 EK-----GYIDESD-SHWQITKKGKLFLNDLLEAFMV 389


>gi|325918112|ref|ZP_08180267.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325535658|gb|EGD07499.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 385

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/337 (37%), Positives = 203/337 (60%), Gaps = 7/337 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R + S+FFG
Sbjct: 8   PLSLYVHLPWCVRKCPYCDFNSHAVKGVLPFEEYVDALIRDLDADLPLVWGRVVHSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL   + I  +L   A     + N+EIT+E NP + E   F+ YR AGVNR+S GV
Sbjct: 68  GGTPSLFPAEAIDRLLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGVNRLSFGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+ ++ +L+ LGR H++++A  AI LA++  +  ++ DL+YALP+QT+ Q E +L+RA +
Sbjct: 128 QTFDDVALQRLGRIHDSADAERAIKLAQDAGYDNVNIDLMYALPEQTLLQAEHDLERAFA 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  T+F+     G   +P ++ A D+    Q++ +  G   YE+S +
Sbjct: 188 LQPTHMSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQALLAEAGYAQYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS--IEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH ++  G+ +  +     KHP+++L     +  +
Sbjct: 245 AKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAQQHVLRRWKHKHPQTYLASA-GSAAS 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +   E +  E+   E+++  LRL EG  + D+E   G
Sbjct: 304 IGGDEIVPLERLPFEYMLNLLRLHEGFRLSDFEASTG 340


>gi|94309795|ref|YP_583005.1| coproporphyrinogen III oxidase [Cupriavidus metallidurans CH34]
 gi|93353647|gb|ABF07736.1| Oxygen-independent coproporphyrinogen III oxidase-like protein
           [Cupriavidus metallidurans CH34]
          Length = 419

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 198/345 (57%), Gaps = 10/345 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHV-----RRYKVGQENFIQSFLTEMQWMRQLTGPR 69
           GS  L +YVH P+CV+KCPYCDFNSH        +++ ++ ++ +   +++    L   R
Sbjct: 37  GSPPLSLYVHIPWCVRKCPYCDFNSHAAPGKPDSHEIPEDAYLDALRADLEQSLPLVWGR 96

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + ++F GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  YR +G
Sbjct: 97  PVHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEANPGTFEAERFASYRASG 156

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           +NR+S+G+QS  +  L+ LGR H   EA AAI +A   F  ++ DL+YALP QT+ +   
Sbjct: 157 INRLSIGIQSFNDAHLKALGRIHGEREARAAIDIALKHFDNVNLDLMYALPGQTLDECAR 216

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L  ALSY   HLSLY LT+E  TLF K        LP E+ A ++ ++ ++ T+  G  
Sbjct: 217 DLDAALSYGTTHLSLYHLTLEPNTLFAKFPP----ALPDEDTAYEMQDIVEARTAQAGYR 272

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE S ++    E+ HNLNYWR+GDY+GIG GAH ++   +  +     KHP ++++   
Sbjct: 273 HYETSAYAKPHREARHNLNYWRFGDYLGIGAGAHGKLSFPNRILRQMRHKHPATYMEQAL 332

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
             G+AV E   + +++   EF++  LRL +G+    +    G  L
Sbjct: 333 A-GNAVQEAREVGADELPFEFMLNALRLTDGVPASSFHDYTGLPL 376


>gi|227325981|ref|ZP_03830005.1| coproporphyrinogen III oxidase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 379

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 136/379 (35%), Positives = 213/379 (56%), Gaps = 18/379 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L ++     L   R + SIF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLDADLPLASGRELHSIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GV
Sbjct: 66  GGTPSLLSAEAMQALLDGVRARIPLTPDAEITMEANPGTVEADRFSGYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFDPQKLTRLGRIHGPDEAKRAAHLATGLGLRSFNLDLMHGLPDQSLDEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF          LP ++   D+Y    ++ SA G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFSSRPP----TLPDDDALWDIYEQGHALLSAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDDRILRTVKVRHPRGYMQ-----GTYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERN----LQRQGFIERV 371
            ++  ++++ +  EF M   RL E    +D+    G  LD  C R        QG++   
Sbjct: 297 DKQHDVANDDRPFEFFMNRFRLLEAAPREDFTAYTG--LDEHCIRPQLDLALAQGYLTET 354

Query: 372 QFSRLRCTQRGMTMLDSVI 390
             +  + T+ G   L+S++
Sbjct: 355 A-THWQITEHGKLFLNSLL 372


>gi|240080124|ref|ZP_04724667.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA19]
 gi|268596276|ref|ZP_06130443.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA19]
 gi|268550064|gb|EEZ45083.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA19]
          Length = 391

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|89091919|ref|ZP_01164874.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
 gi|89083654|gb|EAR62871.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
          Length = 380

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 141/379 (37%), Positives = 218/379 (57%), Gaps = 16/379 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+C++KCPYCDFNSH +R ++ ++ +I+  L +++        R+I SIF GG
Sbjct: 8   LSLYIHVPWCIRKCPYCDFNSHAQRGELPEQAYIECLLEDLRSELHFAQGRTIQSIFIGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL +  +   +L GI     +  + EIT+EANP + E   F GY+ AG+NR+S+G+Q
Sbjct: 68  GTPSLFQADSFKRLLLGINAIIPIERDAEITLEANPGTFEQEKFIGYKDAGINRLSIGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S     L+ LGR H++ EA+ A  LAR IFPR++ DL++ LP Q+ T    +LQ+A+   
Sbjct: 128 SFNNNHLQALGRIHSSDEAVRAATLAREIFPRLNLDLMHGLPSQSETDAIADLQQAIDLD 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLS YQLTIE  T FY         LP +     +    Q + + H L  YEIS ++ 
Sbjct: 188 PDHLSWYQLTIEPNTEFYSKSPS----LPVDETLWGIQEQGQQLLADHLLAQYEISAYA- 242

Query: 259 LGAE--SLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS--IEKHPESWLKMVRKNGHA 314
            G +  S HNLNYW +GDYIGIG GAH ++ +      I    +K P+++++   +    
Sbjct: 243 KGEQFKSRHNLNYWSFGDYIGIGAGAHGKITLPDEDRIIRRWKQKQPKAYMQSTTR---- 298

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIEC-ERNLQRQGFIERVQ 372
           +   + ++ E++A EF+M  LRL  G+ V+ +    G  L D+     N + +G +E+  
Sbjct: 299 LTGDQPITREERAFEFMMNALRLYHGVPVELFAERTGLPLTDVSALLDNARGKGLLEKGT 358

Query: 373 FSRLRCTQRGMTMLDSVIA 391
             RL  TQ G   L+ +++
Sbjct: 359 -DRLAPTQHGRLFLNDLLS 376


>gi|10433428|dbj|BAB13962.1| unnamed protein product [Homo sapiens]
          Length = 442

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 219/379 (57%), Gaps = 19/379 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVHWP+C K+C YC+FN ++ R ++ +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHWPYCEKRCSYCNFNKYIPR-RLEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + +++E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTVAAVLEAVAQAAHLPADLEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRTHSACDALRTLAEARGLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +A ++Y   +++    G H  E+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQCEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTHNWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA---------GRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+            G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTM 385
            ++ +    LRC+  G+ +
Sbjct: 398 LLQ-LDHRGLRCSWEGLAV 415


>gi|296160049|ref|ZP_06842869.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           Ch1-1]
 gi|295889795|gb|EFG69593.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           Ch1-1]
          Length = 409

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 196/327 (59%), Gaps = 6/327 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +     EN ++ +   +++    L   R + ++F 
Sbjct: 32  PLALYVHFPWCVRKCPYCDFNSHEWKGDTFPENEYLDALRADLEMALPLVWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++++A  A+ +A   F   + DL++ALP QT+ + + +++ ALS
Sbjct: 152 IQSFNEAHLKALGRIHDSAQARHAVEVASTTFDNFNLDLMFALPGQTLAECQTDVETALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIHERTSAAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 268 AQPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPTTFIEQA-KAGTAVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
           E+  + +     EF++  LRL EG  V
Sbjct: 327 EEHEVGTRDLPFEFMLNALRLVEGFPV 353


>gi|323527038|ref|YP_004229191.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1001]
 gi|323384040|gb|ADX56131.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1001]
          Length = 409

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 199/327 (60%), Gaps = 6/327 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  + +   EN ++ +   +++    L   R + ++F 
Sbjct: 32  PLSLYVHFPWCVRKCPYCDFNSHEWKGETFPENDYLDALRADLEMALPLVWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++++A  A+ +A + F   + DL++ALP+QT+ + + +++ ALS
Sbjct: 152 IQSFNEAHLKALGRIHDSTQARRAVEVAASTFDNFNLDLMFALPRQTLAECQADVETALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIHERTSAAGYGRYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYW +GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 268 AKPHRQSKHNLNYWGFGDYLGIGAGAHTKLSFPNRVLRQARYKHPATFIEQA-KAGAAVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
           E+  +S+     EF++  LRL EG  V
Sbjct: 327 EEHEVSARDLPFEFMLNALRLVEGFPV 353


>gi|301631758|ref|XP_002944962.1| PREDICTED: oxygen-independent coproporphyrinogen-III oxidase-like
           protein HI_0463-like [Xenopus (Silurana) tropicalis]
          Length = 398

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/377 (35%), Positives = 215/377 (57%), Gaps = 13/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH P+C++KCPYCDFNSH  +   + ++ +I + + +++    L   R++ SIF 
Sbjct: 23  PLSLYVHLPWCLRKCPYCDFNSHAMQAGTLPEQRYIDALVADLEAALPLVWGRTVHSIFI 82

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P +I  +L  +     + ++ E T+EANP + E   F+ +R AGV R+S+G
Sbjct: 83  GGGTPSLFSPDSIDRLLSDLRARLRIEADCETTLEANPGTFEKERFRAFRAAGVTRLSIG 142

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS ++  L+ LGR HN ++A+AA+  A   F   + D++YALP Q+M   E +L+ AL+
Sbjct: 143 VQSFDDGHLQALGRVHNRAQALAAVQEAAQAFETFTLDIMYALPGQSMADLERDLETALA 202

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLS+Y LTIE  T F K        LP  + A  + +    +T A GL  YE+S +
Sbjct: 203 FAPPHLSVYHLTIEPNTWFAKHPP----ALPEGDEAYAMLDRITEMTGAAGLTRYEVSAY 258

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G + +HN NYW++GDY+GIG GAHS++   +HR+   +  + P  ++      G AV
Sbjct: 259 ARKGHQCVHNGNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRYREPRRYMDKALA-GCAV 316

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQ 372
            + E +       E+++  LRLR+G +++ +    G  +     R L   +R+G I R  
Sbjct: 317 AQDEDVRRADLPFEYMLNALRLRQGFALQHFCERTGLPV-TAIARGLEQAERKGLIVR-D 374

Query: 373 FSRLRCTQRGMTMLDSV 389
              +R T+RG   L  +
Sbjct: 375 MGHVRPTERGFDFLSDL 391


>gi|291405795|ref|XP_002719153.1| PREDICTED: radical S-adenosyl methionine domain containing 1-like
           [Oryctolagus cuniculus]
          Length = 490

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 200/342 (58%), Gaps = 12/342 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG--QENFIQSFL-TEMQWMRQLTGPRSIS 72
           S    +YVHWP+C K+C YC+FN    +Y  G  +E  ++  L TE + + + +G R + 
Sbjct: 38  SARAALYVHWPYCEKRCSYCNFN----KYLPGGVEEVAVRRCLETEARTLLRFSGVRRVE 93

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           S+FFGGGTPSL  P  +A +L+ +A+   +  + E+T+EANP+S   +    +  AGVNR
Sbjct: 94  SVFFGGGTPSLASPHTVAAVLEAVAQATYLPVDSEVTLEANPTSAASSRLAAFGAAGVNR 153

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMEL 191
           +S+G+QSL++  LR LGR H+AS+A+  +  AR +FP R+S DL+  LP Q +  W  +L
Sbjct: 154 LSIGLQSLDDAELRLLGRTHSASDALRTLAEARRLFPGRVSVDLMLGLPAQQVRPWLGQL 213

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           +  L    DH+SLYQL++E+GT  +   + G L  P   +A ++Y   +++    G   Y
Sbjct: 214 RELLRRCDDHVSLYQLSLERGTALFAQVQQGALPAPDPELAAEMYQEGRAVLRDAGFRQY 273

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKM 307
           E+SN +  GA S HN  YW+ G Y+G+GPGAH R      G H     I+   P++W+K 
Sbjct: 274 EVSNFARNGALSTHNWTYWQCGQYLGVGPGAHGRFVPQGAGGHTREARIQTLEPDAWMKE 333

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEML 349
           V + GH   ++  L   +  +E L MGLR   GI+ + W+  
Sbjct: 334 VMQFGHGTRKRTPLGELELLEEVLAMGLRTDVGITHQHWQQF 375


>gi|107022074|ref|YP_620401.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia AU 1054]
 gi|116689018|ref|YP_834641.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia HI2424]
 gi|170732307|ref|YP_001764254.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia MC0-3]
 gi|105892263|gb|ABF75428.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia cenocepacia AU 1054]
 gi|116647107|gb|ABK07748.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia cenocepacia HI2424]
 gi|169815549|gb|ACA90132.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           cenocepacia MC0-3]
          Length = 404

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 214/375 (57%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  + +++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPEADYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEAHLKALGRIHDTAQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGTAVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLITR-DFT 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|15838108|ref|NP_298796.1| coproporphyrinogen III oxidase [Xylella fastidiosa 9a5c]
 gi|9106539|gb|AAF84316.1|AE003980_8 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 383

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 215/379 (56%), Gaps = 12/379 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  + ++ + L ++++   L   R + S+F G
Sbjct: 6   PLSLYVHLPWCVRKCPYCDFNSHQAKGALPFDAYVNALLRDLEYDLPLVWGRVVHSVFLG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   A    ++ + EIT+E NP + E   F  Y  AG+NR+S G+
Sbjct: 66  GGTPSLFPPEAIDRFLQIAAARLRLAPDAEITLETNPGTAEYGRFDRYLAAGINRLSFGI 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS  + +LR LGR H++ +A  A+ LA++  F  ++ DL+YALP+QT+ + E +LQRA +
Sbjct: 126 QSFNDVALRRLGRIHDSLQAEHAVKLAQDAGFTNINLDLMYALPEQTLLEAEHDLQRAFA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+FY     G   +P ++ A ++   TQ + +  G   YE+S +
Sbjct: 186 LAPTHLSYYQLTLEPNTVFYARPPQG---IPDDDAAWEMQEHTQRLLAEAGYQHYEVSAY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGHA 314
           +  G + LHNLNYWR+GDY+GIG GAH ++  G   H +     KHP ++L        A
Sbjct: 243 AREGWQCLHNLNYWRFGDYLGIGAGAHGKITSGVSQHVLRRWKCKHPYTYLDNA-GTVSA 301

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE---RV 371
           +   E + + +   E+++  LRLR G  ++D+ +  G  L +E       +       R 
Sbjct: 302 IGGDEIVPTARLPFEYMLNLLRLRAGFRLQDFAVRTG--LTVESIHAALSEAVARGWLRC 359

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +  R+  T+ G+   + VI
Sbjct: 360 ELERVIPTELGLRFANDVI 378


>gi|167586473|ref|ZP_02378861.1| coproporphyrinogen III oxidase [Burkholderia ubonensis Bu]
          Length = 404

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 213/375 (56%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEHALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+A++A AA+ +A N F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNETHLKALGRIHDAAQARAAVEVAANTFDNFNLDLMFALPNQTLDECRADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYERYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPHHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLIAR-DFA 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|224824835|ref|ZP_03697942.1| oxygen-independent coproporphyrinogen III oxidase [Lutiella
           nitroferrum 2002]
 gi|224603328|gb|EEG09504.1| oxygen-independent coproporphyrinogen III oxidase [Lutiella
           nitroferrum 2002]
          Length = 396

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 212/375 (56%), Gaps = 9/375 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H+P+CV+KCPYCDFNSH  +    ++ ++ + L +++        R + +IF GG
Sbjct: 20  LSLYIHFPWCVRKCPYCDFNSHEVKNGFDEDAYVAALLADLESALPAVWGRPVHTIFMGG 79

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL   + +  +L GI     +  + EIT+EANP + E + F+G+R+AG+NR+S+G+Q
Sbjct: 80  GTPSLFSARAMDTLLAGIRARVRLYPDAEITMEANPGTFESDKFKGFREAGINRLSIGIQ 139

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S +   L+ LGR H+  +A  A+ +A   F  ++ DL+YALP QT+ Q   ++  ALS+ 
Sbjct: 140 SFDPAHLKALGRIHHGDDARRAVDIALTHFDNVNLDLMYALPGQTLEQALTDMGTALSFG 199

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           V H+S Y LTIE  TLF +        LP + ++ D+    ++  +  G   YE S  + 
Sbjct: 200 VTHVSAYHLTIEPNTLFARYLPPK---LPDDELSADMQEALEARLTEAGFGHYETSAFAR 256

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G E  HNLNYW++GDY+GIG GAH+++      V     K P ++LK V   G     +
Sbjct: 257 PGRECRHNLNYWQFGDYLGIGAGAHAKISAHDGIVREMRYKQPAAYLKAV-AEGRPTQSR 315

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSR 375
           E ++   +  EF+M  LRL +G  ++ +    G  L    +R L   + QG IER   + 
Sbjct: 316 ERIARADRPFEFMMNLLRLTDGFELRLFAERTGLPL-THIQRELAEAEAQGLIER-DLTT 373

Query: 376 LRCTQRGMTMLDSVI 390
           L+ T +G   L+ ++
Sbjct: 374 LKPTLKGQRFLNDLL 388


>gi|261401086|ref|ZP_05987211.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria lactamica ATCC 23970]
 gi|269208978|gb|EEZ75433.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria lactamica ATCC 23970]
          Length = 391

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + ++FFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETVFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALENAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
                  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMRCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G  +  I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEQGRLFLNDLL 387


>gi|319761727|ref|YP_004125664.1| oxygen-independent coproporphyrinogen iii oxidase [Alicycliphilus
           denitrificans BC]
 gi|317116288|gb|ADU98776.1| oxygen-independent coproporphyrinogen III oxidase [Alicycliphilus
           denitrificans BC]
          Length = 411

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 133/380 (35%), Positives = 216/380 (56%), Gaps = 13/380 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVR---RYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
            L +YVH P+C++KCPYCDFNSH        + +  +  + + +++    L   R++ SI
Sbjct: 34  PLSLYVHLPWCLRKCPYCDFNSHQAPGGSEALPEARYTAALVADLEAALPLVWGRTVHSI 93

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL  P+ +  +L  I     + +  E+T+EANP + E   F+ YR AGV R+S
Sbjct: 94  FIGGGTPSLFSPEAMDRLLGDIRARLPLDAGCEVTLEANPGTFEKERFRAYRGAGVTRLS 153

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQS  ++ L+ LGR H+ ++A+AA+  A   F   + D++YALP QT  + E ++++A
Sbjct: 154 IGVQSFNDRHLQALGRVHDRAQALAAVEEAAQAFETFNLDIMYALPGQTPAEQEQDMRQA 213

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L+ A  H+S+Y LTIE  T F K        LP ++ A  + +    +T+A GL  YE+S
Sbjct: 214 LALAPPHISIYHLTIEPNTYFAKYPPR----LPEDDQAYAMLDRITELTAAAGLSRYEVS 269

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGH 313
            ++  G +  HN NYW++GDY+GIG GAHS++   +HR+   +  + P+ ++      G 
Sbjct: 270 AYAREGHQCQHNRNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRLRDPQLYMTGALA-GR 327

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERV 371
           A+ + E +       EF++  LRLREG +++D+    G+ L    +  +  + +G I R 
Sbjct: 328 AIAQDEDVRRADLPFEFMLNALRLREGFALQDFTERTGQPLTAIAQGLQQAEARGLIAR- 386

Query: 372 QFSRLRCTQRGMTMLDSVIA 391
               +R T+RG   L  + A
Sbjct: 387 DMGHVRPTERGFDFLSDLQA 406


>gi|325275641|ref|ZP_08141540.1| HemN family oxidoreductase [Pseudomonas sp. TJI-51]
 gi|324099228|gb|EGB97175.1| HemN family oxidoreductase [Pseudomonas sp. TJI-51]
          Length = 391

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 216/377 (57%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + LT++         R ISSIFFG
Sbjct: 18  PLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVAALLTDLDQELAAVQGRPISSIFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    ++++EIT+EANP + E + F+ YR+ G+NR+S+GV
Sbjct: 78  GGTPSLFSAGALGRLLRGVEQRIPFAADIEITLEANPGTFEQDKFKAYRQTGINRLSIGV 137

Query: 138 QSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +   L+ LGR HN  E   AA       F   + DL++ LP Q++     +L++A+ 
Sbjct: 138 QSFQPAKLQALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLEDALGDLRQAMD 197

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S +
Sbjct: 198 LGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGFRQYEVSAY 253

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYWR+GD+IGIG GAH ++     R+  + + + P+ +L + +   +  
Sbjct: 254 AQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLAKP--YKA 311

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
            EK  L  ++   EFLM  LRL +G+  + +    G  L+   E  R  +++G ++ V+ 
Sbjct: 312 GEK-LLPVDELPFEFLMNALRLTDGVEAQLFTQRTGLPLEQLREARRAAEQKGLLQ-VES 369

Query: 374 SRLRCTQRGMTMLDSVI 390
            RL  T RG   L+ ++
Sbjct: 370 DRLVATPRGQLFLNDLL 386


>gi|194097947|ref|YP_002000993.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae NCCP11945]
 gi|239998420|ref|ZP_04718344.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 35/02]
 gi|240015984|ref|ZP_04722524.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA6140]
 gi|268594282|ref|ZP_06128449.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 35/02]
 gi|193933237|gb|ACF29061.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae NCCP11945]
 gi|268547671|gb|EEZ43089.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 35/02]
 gi|317163706|gb|ADV07247.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 391

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|83746456|ref|ZP_00943507.1| Coproporphyrinogen oxidase, anaerobic [Ralstonia solanacearum
           UW551]
 gi|83726787|gb|EAP73914.1| Coproporphyrinogen oxidase, anaerobic [Ralstonia solanacearum
           UW551]
          Length = 425

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 144/384 (37%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH    + + +E F+ +   +++    +   R + +
Sbjct: 41  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPDQGIPEERFLAAVRQDLEAALPMVWGRRVHT 100

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 101 IFIGGGTPSLLSAQGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 160

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  LR LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 161 SIGIQSFNDAHLRALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 220

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 221 ALSFETSHVSLYHLTLEPNTYFAKYPP----ALPDDDTAFGMQDWIHARLAAAGYEHYEV 276

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  +HPE++L+     G
Sbjct: 277 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVLREMRHRHPETYLRQAETAG 335

Query: 313 HAVV--EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGF 367
            A V  E+  + +     EF++  LRL  G  V  ++   G   R ++ E +   QR G 
Sbjct: 336 GAAVLQEQREVDAADLPFEFMLNALRLTGGFPVTLFQERTGLPLRAIERELDAAEQR-GL 394

Query: 368 IERVQFSRLRCTQRGMTMLDSVIA 391
           + R   + +R T+ G   L+ + A
Sbjct: 395 LARDHVA-IRPTELGQRFLNDLQA 417


>gi|330505400|ref|YP_004382269.1| coproporphyrinogen III oxidase [Pseudomonas mendocina NK-01]
 gi|328919686|gb|AEB60517.1| coproporphyrinogen III oxidase [Pseudomonas mendocina NK-01]
          Length = 384

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 218/379 (57%), Gaps = 16/379 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++    Q    R ++SIFFG
Sbjct: 11  PLALYIHIPWCVRKCPYCDFNSHAAGPTLPEEEYVDALLADLDIDLQHVHGRPLTSIFFG 70

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL   + +  +L+G+ +    + ++EIT+EANP + E   F+GYR  G+NR+S+GV
Sbjct: 71  GGTPSLFSDRALGRLLEGVEQRVGFAPDIEITLEANPGTFEQAKFKGYRSLGINRLSIGV 130

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR H+ SEA+ A  +AR   F   + DL++ LP+Q++     +L+ A+S
Sbjct: 131 QSFQEAKLKALGRIHDGSEAVRAADMARAAGFDNFNLDLMHGLPEQSIEDALFDLRTAIS 190

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+         LP +++  D+    Q++ +A G   YE+S +
Sbjct: 191 QGPTHLSWYQLTMEPNTVFWSQPP----TLPEDDLLWDIQEAGQALLAAEGYAQYEVSAY 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR--KNGH 313
           +  G ++ HNLNYW +GD++GIG GAH+++   + R+  + + + P+ +L   +  + G 
Sbjct: 247 ARPGKQARHNLNYWTFGDFLGIGAGAHAKLSAPAGRIQRTWKTRLPKDYLDPAKVFQAGE 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERV 371
            V+E   L       E+LM  LRL  G   + +    G  L    +  R  +RQG ++  
Sbjct: 307 RVLEASELPF-----EYLMNVLRLTGGAPAELFSQRTGLPLQQLEQARREAERQGLLQ-A 360

Query: 372 QFSRLRCTQRGMTMLDSVI 390
             +RL  T +G   L+ ++
Sbjct: 361 DPTRLVATAKGQLFLNDLL 379


>gi|218710635|ref|YP_002418256.1| coproporphyrinogen III oxidase [Vibrio splendidus LGP32]
 gi|218323654|emb|CAV19953.1| Oxygen-independent coproporphyrinogen III oxidase-like protein
           [Vibrio splendidus LGP32]
          Length = 395

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 146/386 (37%), Positives = 215/386 (55%), Gaps = 22/386 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++       QL G PR + S
Sbjct: 10  ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEKEYIDALLEDLDTDIEKYQLNGAPRPLHS 69

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAG+ RI
Sbjct: 70  IFIGGGTPSLFSPEGIGRLLQGIEQRIPFKPEIEITMEANPGTIEAERFAGYQKAGITRI 129

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L 
Sbjct: 130 SVGVQSFEQEKLERLGRIHGQDEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADLD 189

Query: 193 RALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           RA+     HLS YQLTIE  T+F YK  K     LP ++   D+++L     +  G   Y
Sbjct: 190 RAIELNPPHLSWYQLTIEPNTMFYYKTPK-----LPDDDDLWDIFDLGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   + 
Sbjct: 245 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN 304

Query: 311 NGHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-----IECERNLQR 364
                +  E  + +E +  EF M   RL E    +D+    G   D     IE  ++L  
Sbjct: 305 LVKPYLSDELEVPNEDRPFEFFMNRFRLMEACPKQDFIDTTGLEFDSIQPTIEWAKDL-- 362

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVI 390
            G++     S  + T++G   L+ ++
Sbjct: 363 -GYLNETD-SHWQITEKGKLFLNDLL 386


>gi|240013545|ref|ZP_04720458.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI18]
 gi|240115078|ref|ZP_04729140.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID18]
 gi|240120617|ref|ZP_04733579.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID24-1]
 gi|240125171|ref|ZP_04738057.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-92-679]
 gi|268600752|ref|ZP_06134919.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID18]
 gi|268683766|ref|ZP_06150628.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-92-679]
 gi|268584883|gb|EEZ49559.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID18]
 gi|268624050|gb|EEZ56450.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-92-679]
          Length = 391

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 202/374 (54%), Gaps = 4/374 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 DATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQNRPGEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQFSRL 376
           ++ +++E    EF+M  LRL +G+     +   G     I  +    RQ  +     +  
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVF 373

Query: 377 RCTQRGMTMLDSVI 390
           R T++G   L+ ++
Sbjct: 374 RPTEKGRLFLNDLL 387


>gi|254246046|ref|ZP_04939367.1| Coproporphyrinogen III oxidase [Burkholderia cenocepacia PC184]
 gi|124870822|gb|EAY62538.1| Coproporphyrinogen III oxidase [Burkholderia cenocepacia PC184]
          Length = 404

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 214/375 (57%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  + +++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPEADYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAVKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEAHLKALGRIHDTAQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGTAVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLITR-DFT 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|329120740|ref|ZP_08249402.1| coproporphyrinogen dehydrogenase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327460537|gb|EGF06873.1| coproporphyrinogen dehydrogenase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 391

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/326 (36%), Positives = 185/326 (56%), Gaps = 3/326 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+GV
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIGV 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNDDMLARLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALNDVQTAITT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISV 343
           ++ ++++    EF+M  LRL +G+  
Sbjct: 314 RKTVAADDLPFEFMMNALRLTDGVPA 339


>gi|270263063|ref|ZP_06191333.1| hypothetical protein SOD_d00780 [Serratia odorifera 4Rx13]
 gi|270042751|gb|EFA15845.1| hypothetical protein SOD_d00780 [Serratia odorifera 4Rx13]
          Length = 379

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 215/377 (57%), Gaps = 16/377 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   L ++     L G R IS+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLLADLDADLPLAGGREISTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V+ + EIT+EANP +VE + F GY++AGVNRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQSLLDGVRARIRVADDAEITMEANPGTVEADRFSGYQRAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFSAEKLTRLGRIHGPEEAKRAAHLATGLGLRSFNLDLMHGLPDQSLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF         VLP ++   D++     + SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFERGHQLLSAAGYRQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTAKTKHPRGFMQ-----GKYMD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQF 373
           ++  +++  +  EF M   RL E     D+    G +  +   + +  L++    E  ++
Sbjct: 298 KQHEVTTADRPFEFFMNRFRLLEAAPRADFAHYTGLDESVIRPQLDEALEKGYLEETAEY 357

Query: 374 SRLRCTQRGMTMLDSVI 390
            ++  T++G   L+S++
Sbjct: 358 WQI--TEKGKLFLNSLL 372


>gi|312963629|ref|ZP_07778110.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas fluorescens WH6]
 gi|311282138|gb|EFQ60738.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas fluorescens WH6]
          Length = 400

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 213/379 (56%), Gaps = 16/379 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++         R +SSIFFG
Sbjct: 27  PLALYIHIPWCVRKCPYCDFNSHTASQVLPEEEYVDALLDDLDQDLHAVYGRELSSIFFG 86

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+      + ++EIT+EANP + E   F  YRK G+NR+S+GV
Sbjct: 87  GGTPSLFSAAALGRLLKGVEARIPFAGDIEITLEANPGTFEQEKFVAYRKLGINRLSIGV 146

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +++ L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A++
Sbjct: 147 QSFQQEKLEALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPNQSLDDALSDLRQAIA 206

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+        VLP ++   D+    Q++ + HG   YE+S +
Sbjct: 207 LKPTHLSWYQLTLEPNTVFWNQPP----VLPEDDTLWDIQEAGQALLAEHGYRQYEVSAY 262

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L   +      
Sbjct: 263 AQPGRPARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVRTWKTRAPKDYLNPAKPFQAGA 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD----IECERNLQRQGFIERV 371
            E   L++E+   EFLM  LRL EG+  + +    G  LD     E  R  ++ G ++ V
Sbjct: 323 KE---LTNEELPFEFLMNALRLTEGVEARLYAERTG--LDQASLAEGRREAEQSGLMQ-V 376

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           + SRL  T RG   L+ ++
Sbjct: 377 EPSRLAATDRGQLFLNDLL 395


>gi|241663554|ref|YP_002981914.1| coproporphyrinogen III oxidase [Ralstonia pickettii 12D]
 gi|240865581|gb|ACS63242.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia
           pickettii 12D]
          Length = 422

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/382 (37%), Positives = 222/382 (58%), Gaps = 14/382 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH    + + +E F+ +   +++    +   R + +
Sbjct: 38  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEQGIPEERFLAAVRQDLEAALPMVWGRHVHT 97

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 98  IFIGGGTPSLLSAQGLDRLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 157

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 158 SIGIQSFNDAHLQALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 217

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+  +H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 218 ALSFDTNHVSLYHLTLEPNTYFAKYPP----ALPDDDAAFAMQDWIHARLAAAGYEHYEV 273

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  KHP+++L+     G
Sbjct: 274 SAYAKAGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVIREMRHKHPDTYLRQAETAG 332

Query: 313 HAVV--EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGF 367
            A V  E+  + +     EF++  LRL +G  V  ++   G  L    ER L   +++G 
Sbjct: 333 GAAVMQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLR-SIERQLDVAEQRGL 391

Query: 368 IERVQFSRLRCTQRGMTMLDSV 389
           + R   + +R T+ G   L+ +
Sbjct: 392 LTRDHVA-IRLTELGQRFLNDL 412


>gi|83648998|ref|YP_437433.1| coproporphyrinogen III oxidase-like protein [Hahella chejuensis
           KCTC 2396]
 gi|83637041|gb|ABC33008.1| Coproporphyrinogen III oxidase and related Fe-S oxidoreductase
           [Hahella chejuensis KCTC 2396]
          Length = 388

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 148/390 (37%), Positives = 220/390 (56%), Gaps = 20/390 (5%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGP 68
           G  +  L +YVH P+CV+KCPYCDFNSH  R ++ +  ++Q+ L    TEM  + Q+ G 
Sbjct: 8   GLHTPPLALYVHIPWCVRKCPYCDFNSHTARSELPEREYLQALLSDLDTEMFRLEQIGGK 67

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R++ SIFFGGGTPSL+ P  IA ++DG  +      ++EIT+EANP +V+   F+   + 
Sbjct: 68  RALGSIFFGGGTPSLLSPDIIASVIDGARQRLGFHDDIEITLEANPGTVDEAKFKDLFQG 127

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQW 187
           GVNR+SLGVQS + + L  LGR HN  +AI A+  AR   F   + DL++ LP Q++   
Sbjct: 128 GVNRLSLGVQSFQPELLTTLGRIHNGEDAIRAVDKARQAGFDNFNLDLMHGLPGQSLQHA 187

Query: 188 EMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHG 247
             +L  A+S    HLS YQLTIE  T FY+        LP ++   +++       +  G
Sbjct: 188 MEDLDTAISLGPTHLSWYQLTIEPNTEFYRHPPQ----LPEDDTLWEIHENGCERLAQAG 243

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWL 305
            + YEIS  +  G ES HNLNYWR+GDY+ IG GAH ++  GS    I   K   P+ +L
Sbjct: 244 YNQYEISAFAQTGKESRHNLNYWRFGDYLAIGAGAHGKL-TGSSGDVIRYWKTRLPQHYL 302

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQR 364
             +    +    +E   + +   +FLM  LRLREG+  +      G  +  +E + +  R
Sbjct: 303 SRI---DNYTAGEEITPAHEAGVDFLMNALRLREGVEEELLVRRTGVGVSLLEPQLSEAR 359

Query: 365 Q-GFIERVQFSRLRCTQRGMTMLDSVIANL 393
           Q G++   Q  RL+CT+ G   L++V+ + 
Sbjct: 360 QKGWL---QADRLQCTELGYRHLNAVLTHF 386


>gi|160897476|ref|YP_001563058.1| oxygen-independent coproporphyrinogen III oxidase [Delftia
           acidovorans SPH-1]
 gi|160363060|gb|ABX34673.1| oxygen-independent coproporphyrinogen III oxidase [Delftia
           acidovorans SPH-1]
          Length = 414

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/380 (35%), Positives = 218/380 (57%), Gaps = 19/380 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           L +YVH P+C++KCPYCDFNSH       ++ ++ +I + + +++    L   R++ SIF
Sbjct: 38  LSLYVHLPWCIRKCPYCDFNSHEHGRDGPELPEDRYIDALVADLESALPLIWGRTVHSIF 97

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P++I  +L  I     + ++ EIT+EANP + E + F+ +R AGV R+S+
Sbjct: 98  IGGGTPSLFAPESIDRLLAAIRARLRMEADCEITMEANPGTFETDRFRAFRAAGVTRLSI 157

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS +++ L+ +GR H+ ++A AA+  A + F   + DL+YALP QT      +L  A+
Sbjct: 158 GVQSFDDRLLQAVGRVHDGAQARAAVREAADSFETFNIDLMYALPGQTELDLARDLDVAM 217

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLS+Y LTIE  T F K        +P +++A D+ +   + T+A G+  YEIS 
Sbjct: 218 SFAPPHLSVYHLTIEPNTYFAKFPP----AIPEDDLAYDMLDRITARTAAAGMQRYEISA 273

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
           ++  G +  HN NYW++GDY+GIG GAHS++   +HR+   +  + P  ++         
Sbjct: 274 YAREGHQCWHNRNYWQFGDYLGIGAGAHSKLSF-AHRIVRQVRFRDPARYMDQALAGAPL 332

Query: 315 VVEKEFLSSEQQAD---EFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIE 369
             + E     ++AD   E+++  LRLREG +++D+    G  L    +     Q +G I 
Sbjct: 333 AQDGEV----RRADLPFEYMLNALRLREGFALQDFMERTGLPLSSIAKGLDAAQAKGLIT 388

Query: 370 RVQFSRLRCTQRGMTMLDSV 389
           R    R+  T+RG   L  +
Sbjct: 389 R-DLGRVVPTERGFDFLSDL 407


>gi|134095309|ref|YP_001100384.1| coproporphyrinogen III oxidase [Herminiimonas arsenicoxydans]
 gi|133739212|emb|CAL62261.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Herminiimonas arsenicoxydans]
          Length = 414

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/374 (35%), Positives = 216/374 (57%), Gaps = 10/374 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH+P+CVKKCPYCDFNSH       ++ ++ +   +++    L   R I +IF GG
Sbjct: 41  LSLYVHFPWCVKKCPYCDFNSHEATGGFPEDEYLSALRADLEQALPLIWGRKIYTIFIGG 100

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +L  I     +   VEIT+EANP + E   F+ YR +GVNR+S+G+Q
Sbjct: 101 GTPSLLSAKGLDRLLSDIRTLLPLDGAVEITMEANPGTFEAEKFKSYRSSGVNRLSIGIQ 160

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S   + L+ LGR H+  EA  A+ +A   F   + DL+YALP QT+ +   ++Q A+++A
Sbjct: 161 SFNARHLQALGRIHDGDEARRAVDIAMANFENFNLDLMYALPSQTLEEARQDVQTAIAFA 220

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLSLY LT+E  T+F K       V+P ++ + D+ ++    T+A G   YE+S ++ 
Sbjct: 221 PPHLSLYHLTMEPNTVFAKYPP----VVPDDDASADMQDMIAEETTAAGYQHYEVSAYAQ 276

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
              ++ HNLNYW++GDY+GIG GAH+++      +  +  K P+S+++ +R  G+ + E+
Sbjct: 277 PKRQARHNLNYWQFGDYLGIGAGAHTKLSFPHRVIRQARYKQPKSYMEQMRL-GNPIQEE 335

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSR 375
             +S  +   EF++  +RL  G+ V  +    G  L+   ER L   + +G + R     
Sbjct: 336 TEISRSELGFEFMLNAMRLTNGVEVNLFADRTGMPLNA-IERALRAAEDKGLLYR-DHKT 393

Query: 376 LRCTQRGMTMLDSV 389
           ++ T+ G   L+ +
Sbjct: 394 IKPTELGQRFLNDL 407


>gi|209519148|ref|ZP_03267953.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           H160]
 gi|209500448|gb|EEA00499.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           H160]
          Length = 409

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 216/377 (57%), Gaps = 9/377 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQE-NFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  + +   E +++++   +++    L   R + ++F 
Sbjct: 32  PLALYVHFPWCVRKCPYCDFNSHEWKGETFPEGDYLEALRADLEMALPLIWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  I     + ++ EIT+EANP + E + F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDSMLSDIRALLPLDADAEITLEANPGTFEADKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+A++A  A+ +A   F   + DL++ALP QT+ + + +++ ALS
Sbjct: 152 IQSFNEAHLKALGRIHDAAQARHAVEVAATTFDNFNLDLMFALPGQTLAECQADVETALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP ++ + D+ +     T+  G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIHQRTAEAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  V  +  KHP ++++  R  G +V 
Sbjct: 268 ARPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRIVRQARYKHPTTFIEQARA-GASVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECE-RNLQRQGFIERVQFS 374
           E+  +       EF++  LRL EG  V  +    G ++  IE      +R+  I R    
Sbjct: 327 EEHEVGPRDLPFEFMLNALRLVEGFPVHRFIERTGLSITTIEAALEEAERRKLITR-DHE 385

Query: 375 RLRCTQRGMTMLDSVIA 391
           R+  T  G   L+ + A
Sbjct: 386 RIAPTPLGQAFLNDLQA 402


>gi|297537274|ref|YP_003673043.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           sp. 301]
 gi|297256621|gb|ADI28466.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           sp. 301]
          Length = 382

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 198/339 (58%), Gaps = 8/339 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG---QENFIQSFLTEMQWMRQLTGPRSISSIF 75
           L +Y+H P+CVKKCPYCDFNSH  R+K G   +  ++ + + +++        R I S+F
Sbjct: 7   LSLYIHIPWCVKKCPYCDFNSHESRHKDGAIPESAYVDALIADLELATPKVWGRKIKSVF 66

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL   + I  IL  +     +  + EIT+EANP +V+  NF GY++AGVNR+SL
Sbjct: 67  FGGGTPSLFSAEAIDRILSHVRMLTPLEFDAEITLEANPGTVDAANFVGYKQAGVNRLSL 126

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS +   L+ LGR H++ +A AA+ LA   F +++ D++Y LP Q++     + Q A+
Sbjct: 127 GIQSFKSDYLKALGRIHDSEQAFAAVELAMKTFDQVNCDIMYGLPNQSLEDAMQDAQTAV 186

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS Y LT+E  T FY+        LP ++ + D+    +++ + +G   YE S 
Sbjct: 187 RLNPTHLSFYHLTLEPNTPFYRTPPS----LPDDDTSSDMQIAIETLLAENGYEHYETSA 242

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            +  G ++ HNLNYW++GDY+GIG GAHS++            KHP+++++   + G AV
Sbjct: 243 FAKKGKQAKHNLNYWQFGDYLGIGAGAHSKLSYHDKITREVRPKHPKAYMEQALQ-GKAV 301

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
             +  +   +   EF+M  LRL +G+ V  ++   G N+
Sbjct: 302 EREWLIPQNELGFEFMMNALRLIDGVPVDLFQQRTGLNI 340


>gi|146309173|ref|YP_001189638.1| coproporphyrinogen III oxidase [Pseudomonas mendocina ymp]
 gi|145577374|gb|ABP86906.1| coproporphyrinogen III oxidase, anaerobic [Pseudomonas mendocina
           ymp]
          Length = 386

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 220/379 (58%), Gaps = 16/379 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQLTGPRSISSIFF 76
            L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++   +R + G R ++SIFF
Sbjct: 13  PLALYIHIPWCVRKCPYCDFNSHAAGPTLPEEEYVDALLADLDANLRHVHG-RPLTSIFF 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    + ++EIT+EANP + E   F+GYR  G+NR+S+G
Sbjct: 72  GGGTPSLFSDRALGRLLEGVERRVAFAPDIEITLEANPGTFEQAKFKGYRALGINRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +E  L+ LGR H+ +EA+ A  +AR   F   + DL++ LP+Q++     +L+ A+
Sbjct: 132 VQSFQEAKLKALGRIHDGNEAVRAADMARAAGFDNFNLDLMHGLPEQSIEDALFDLRTAI 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S    HLS YQLT+E  T+F+        VLP +++  D+    Q++ +A G   YE+S 
Sbjct: 192 SQGPTHLSWYQLTMEPNTVFWSQPP----VLPEDDLLWDIQEAGQALLAAEGYAQYEVSA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR--KNG 312
           ++  G ++ HNLNYW +GD++GIG GAH+++     R+  S + + P+ +L   +  + G
Sbjct: 248 YAQTGKQARHNLNYWTFGDFLGIGAGAHAKLSAPDGRILRSWKTRLPKDYLDPAKVFQAG 307

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERNLQRQGFIERV 371
             V     L +++   EFLM  LRL +G+  + +    G  L  ++  R       + R 
Sbjct: 308 ERV-----LGADELPFEFLMNVLRLTDGVPARLFSERTGLPLASLDAARAEAEGRKLLRA 362

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +  RL  T  G   L+ ++
Sbjct: 363 EPERLCATAEGQLFLNDLL 381


>gi|254522825|ref|ZP_05134880.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Stenotrophomonas sp. SKA14]
 gi|219720416|gb|EED38941.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Stenotrophomonas sp. SKA14]
          Length = 408

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 200/337 (59%), Gaps = 7/337 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  + ++  + +I + L ++     L   R + S+FFG
Sbjct: 30  PLSLYVHLPWCVRKCPYCDFNSHQAKGELPFDAYIDALLRDLDQDLPLVWGRVVHSVFFG 89

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I   L   +     + N EIT+E NP + E   F  YR AGVNR+S G+
Sbjct: 90  GGTPSLFPPEAIDRFLQQASARLRFAPNAEITLETNPGTAEHGRFDRYRAAGVNRLSFGI 149

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++  L+ LGR H++ EA  A+ +A++  +   + DL+YALP+QT+   E +L+RA +
Sbjct: 150 QSFDDAMLKRLGRIHDSGEAERAVKMAQDAGYDNFNIDLMYALPEQTLAGAEADLERAFA 209

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  T+F+     G   +P E+ A D+    Q++ +  G   YE+S +
Sbjct: 210 LQPAHISHYQLTLEPNTVFFARPPQG---IPDEDNAWDMQEHCQALLAQAGFGQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +  G +S HNLNYWR+GDY+GIG GAH ++  G+  H +     KHP+++L+       +
Sbjct: 267 ARPGRQSAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKLKHPQAYLESAGTPA-S 325

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
               + ++  +   E+++  LRL EG S++D+E   G
Sbjct: 326 FGGDDVIAPGRLPFEYMLNLLRLHEGFSLRDFESRTG 362


>gi|293605629|ref|ZP_06688009.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
 gi|292816009|gb|EFF75110.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
          Length = 406

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/375 (33%), Positives = 216/375 (57%), Gaps = 9/375 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+CV+KCPYCDFNSH    ++ +  ++ +  ++++        R + S+F GG
Sbjct: 32  LSIYVHVPWCVRKCPYCDFNSHAAPGEIPERAYLDALRSDLEQALPSIWGRQVVSVFIGG 91

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +  +L  +     +  + EIT+EANP + E + F+ Y  +GV R SLG+Q
Sbjct: 92  GTPSLLSSAGLDELLAMLRACLNLWPDAEITMEANPGTAEASRFRDYAASGVTRFSLGIQ 151

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S ++  L+ LGR H+A++A AAI +A++   R++ D+++ALP QT+     +L++A+S+ 
Sbjct: 152 SFDDAQLKKLGRIHDAAQARAAIDMAQHAVSRVNLDMMFALPGQTLEACVADLRQAISFG 211

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLY LT+E  T+F K        LP ++ +  + +  ++  +A GL  YE+S ++ 
Sbjct: 212 TEHLSLYHLTMEPNTVFAKFPP---AELPDDDTSAAMQDAVEAELAAAGLSRYEVSAYAR 268

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK--MVRKNGHAVV 316
            GA   HNLNYW +GDY+GIGPGAH ++      V  +  + P+SW++  M R   H + 
Sbjct: 269 AGARCRHNLNYWEFGDYLGIGPGAHGKLSFHDRIVREARLRSPDSWMQAAMARDGSH-LA 327

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGFIERVQFS 374
           E   +  ++   EF++  LRL++G+    +    G +L     +     ++G ++    +
Sbjct: 328 ESRQVGPDELPFEFMLNALRLKDGVPATAFNERTGLSLAAIAHQLEAASKRGLLD-ADPT 386

Query: 375 RLRCTQRGMTMLDSV 389
           RL+ T  G   L+ +
Sbjct: 387 RLKATPLGWRFLNDL 401


>gi|322834243|ref|YP_004214270.1| oxygen-independent coproporphyrinogen III oxidase [Rahnella sp.
           Y9602]
 gi|321169444|gb|ADW75143.1| oxygen-independent coproporphyrinogen III oxidase [Rahnella sp.
           Y9602]
          Length = 378

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 214/378 (56%), Gaps = 16/378 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V  ++++   L ++     L G RS+ +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVAHLLADLDADLHLVGGRSVGTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     + +N EIT+EANP +VE + F GY++AGVNRIS+GV
Sbjct: 66  GGTPSLLSSEAMQNLLDGVRARLPLDANAEITMEANPGTVEADRFSGYQRAGVNRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR H   EA  A HLA  +  R  + DL++ LP QT+ +   +L++A++
Sbjct: 126 QSFDAQKLERLGRIHGPDEATRAAHLATGLNLRSFNLDLMHGLPDQTLEEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  T++          LP ++   D++     + +A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTMYASRPP----TLPDDDALWDIFEQGDQLLTAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     ++  +++ KHP  +++    +    
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTQPDGQILRTVKTKHPRGYMQGRYMDKQHP 301

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQ 372
           VE E L       EF M   RL E    +++ +  G +  +   + +  + ++  +E   
Sbjct: 302 VETEDLPF-----EFFMNRFRLLEAAPREEFGLYTGLDESVIRAQLDEAITKEYLVETA- 355

Query: 373 FSRLRCTQRGMTMLDSVI 390
            +  + T +G   L+S++
Sbjct: 356 -THWQITGKGKLFLNSLL 372


>gi|37681064|ref|NP_935673.1| coproporphyrinogen III oxidase [Vibrio vulnificus YJ016]
 gi|37199814|dbj|BAC95644.1| coproporphyrinogen III oxidase [Vibrio vulnificus YJ016]
          Length = 389

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/341 (39%), Positives = 194/341 (56%), Gaps = 21/341 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM----QWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +  +    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHTLKEQIPEQMYINALLEDLDRDIEKYQLHRAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI K    + ++EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIRDLLQGIEKRIPFTPSIEITMEANPGTIEAERFAGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++       +  G   YE
Sbjct: 186 KAIELNPPHLSWYQLTIEPNTMFYYKPP----ALPDDDQLWDIFERGHQKLTQAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP+ +L      
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKIKHPKGYLA----- 296

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDW 346
            H  + K +L SEQ  +      EF M   RL E    +D+
Sbjct: 297 AHQNMVKPYLDSEQLVEEIDRPFEFFMNRFRLMEACPKQDF 337


>gi|89074113|ref|ZP_01160612.1| coproporphyrinogen III oxidase [Photobacterium sp. SKA34]
 gi|89050049|gb|EAR55575.1| coproporphyrinogen III oxidase [Photobacterium sp. SKA34]
          Length = 387

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/348 (38%), Positives = 199/348 (57%), Gaps = 25/348 (7%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISSI 74
           L +YVH P+CV+KCPYCDFNSH  +  + + ++I + +    T++   + + G R + SI
Sbjct: 7   LSLYVHIPWCVQKCPYCDFNSHALKTDLPELDYIDALIDDLETDLSAYQLINGARPLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSLI P  I  +L  I +    S ++EIT+EANP +VE   F+ YR+AGVNRIS
Sbjct: 67  FIGGGTPSLISPSEIGRLLKAIEQRILFSDDIEITMEANPGTVEAGRFEAYRQAGVNRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS + + L  LGR H A EAI A  LA+       + DL++ LP Q+++    +L++
Sbjct: 127 IGIQSFQNEKLDRLGRIHGADEAIRAAGLAKKAGLNSFNVDLMHGLPDQSVSDAISDLKQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A++    HLS YQLTIE  TL+Y         LP ++   D++     + +  G   YEI
Sbjct: 187 AIALDPPHLSWYQLTIEPNTLYYSKPP----TLPDDDDLWDIFEQGHQLLTEAGYQQYEI 242

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S +S  G +  HNLNYWR+GDY+GIG GAH ++     ++  +++ KHP  +L+      
Sbjct: 243 SGYSKTGKQCQHNLNYWRFGDYLGIGCGAHGKISFADGQIIRTVKVKHPRGYLQ------ 296

Query: 313 HAVVEKEFLSSEQQ-AD-----EFLMMGLRLREGISVKDWEMLAGRNL 354
               +K +L+ E Q AD     EF M   RL E    +D+    G  L
Sbjct: 297 ---ADKPYLTQENQVADGERPFEFFMNRFRLLESCPKQDFVARTGLAL 341


>gi|320155273|ref|YP_004187652.1| radical SAM family enzyme, coproporphyrinogen III oxidase
           oxygen-independent-like protein clustered with
           nucleoside-triphosphatase RdgB [Vibrio vulnificus
           MO6-24/O]
 gi|319930585|gb|ADV85449.1| radical SAM family enzyme, coproporphyrinogen III oxidase
           oxygen-independent clustered with
           nucleoside-triphosphatase RdgB [Vibrio vulnificus
           MO6-24/O]
          Length = 389

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/341 (39%), Positives = 194/341 (56%), Gaps = 21/341 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM----QWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +  +    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKEQIPEQMYINALLEDLDRDIEKYQLHRAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI K    + ++EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIRDLLQGIEKRIPFTPSIEITMEANPGTIEAERFAGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++       +  G   YE
Sbjct: 186 KAIELNPPHLSWYQLTIEPNTMFYYKPP----ALPDDDQLWDIFEQGHQKLTQAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP+ +L      
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKIKHPKGYLA----- 296

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDW 346
            H  + K +L SEQ  +      EF M   RL E    +D+
Sbjct: 297 AHQNMVKPYLDSEQLVEEIDRPFEFFMNRFRLMEACPKQDF 337


>gi|27364890|ref|NP_760418.1| HemN family oxidoreductase [Vibrio vulnificus CMCP6]
 gi|27361035|gb|AAO09945.1| coproporphyrinogen III oxidase-related protein [Vibrio vulnificus
           CMCP6]
          Length = 389

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/341 (39%), Positives = 194/341 (56%), Gaps = 21/341 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM----QWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +  +    PR + S
Sbjct: 6   ALSLYVHIPWCVQKCPYCDFNSHALKEQIPEQMYINALLEDLDRDIEKYQLHRAPRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + I  +L GI K    + ++EIT+EANP ++E   F GYRKAGV RI
Sbjct: 66  IFIGGGTPSLISAEGIRDLLQGIEKRIPFTPSIEITMEANPGTIEAERFAGYRKAGVTRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L 
Sbjct: 126 SIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLD 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++       +  G   YE
Sbjct: 186 KAIELNPPHLSWYQLTIEPNTMFYYKPP----ALPDDDQLWDIFERGHQKLTQAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP+ +L      
Sbjct: 242 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKIKHPKGYLA----- 296

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDW 346
            H  + K +L SEQ  +      EF M   RL E    +D+
Sbjct: 297 AHQNMVKPYLDSEQLVEEIDRPFEFFMNRFRLMEACPKQDF 337


>gi|108758188|ref|YP_629403.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Myxococcus xanthus DK 1622]
 gi|108462068|gb|ABF87253.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Myxococcus xanthus DK 1622]
          Length = 401

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/400 (36%), Positives = 219/400 (54%), Gaps = 22/400 (5%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
           + +TG  +   G+Y+H+P+C+ KCPYCDF   V R +V +E + ++ L E+   R    P
Sbjct: 8   DALTGMPAARFGLYLHFPYCLAKCPYCDFAVAVAR-QVPEERYARAVLAELD-TRLAAEP 65

Query: 69  ----RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQG 124
               + + SIF GGGTPSL  P+ +A +LDGIA    V+  VE+++E NP   +   F G
Sbjct: 66  SLAGKVLDSIFLGGGTPSLWHPRYVAQVLDGIAARLRVAPGVEVSLEGNPERADAERFAG 125

Query: 125 YRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQT 183
           YR AGVNR+SLGVQS + ++L+ LGR H+A+    A+  AR+  FP ++ D IY +  QT
Sbjct: 126 YRAAGVNRLSLGVQSFQPETLKALGRAHDAAMVEGAVDAARSAAFPVVAMDFIYGVHGQT 185

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTL-----FYKMHKDGDLVLPSENVAVDLYNL 238
           + Q E + +RA++ A +HLS Y LT+E+  L       K  K G+L LP ++  VD+  +
Sbjct: 186 VAQVEADARRAVALAPEHLSTYALTVERDVLAEDTPLSKRLKRGELELPPDDTVVDMARV 245

Query: 239 TQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE 298
            + +  A GLH YE+SNH+  G  S HN  YW  G+Y+ +G GA   +        +++ 
Sbjct: 246 VREVYGAAGLHRYEVSNHARPGFSSRHNALYWTGGEYLALGVGATGMLLSPQPHRYVNL- 304

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR-NLDIE 357
           +  E +L            +E L  E+   E L MGLRL  G+   DWE +  R    +E
Sbjct: 305 RSAERYLVEAEAGRLPEEGREPLGPEELFAERLAMGLRLVSGV---DWEAVCERYGQPVE 361

Query: 358 CER----NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANL 393
             R     L   GF   ++  RL  T++G  +  +V A L
Sbjct: 362 PRRAEVARLVAHGFAT-LRDGRLALTEKGADVHSAVCARL 400


>gi|206561361|ref|YP_002232126.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia J2315]
 gi|198037403|emb|CAR53338.1| putative coproporphyrinogen III oxidase family protein
           [Burkholderia cenocepacia J2315]
          Length = 404

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 213/375 (56%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEGHLKALGRIHDTAQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGAAVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLITR-DFT 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|124267888|ref|YP_001021892.1| putative anaerobic coproporphyrinogen III oxidase oxidoreductase
           protein [Methylibium petroleiphilum PM1]
 gi|124260663|gb|ABM95657.1| putative anaerobic coproporphyrinogen III oxidase oxidoreductase
           protein [Methylibium petroleiphilum PM1]
          Length = 417

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 217/393 (55%), Gaps = 29/393 (7%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSH-------VRRYKVG-----------QENFIQSFLTEMQ 60
           L +YVH P+C+KKCPYCDFNSH       +R  + G           +  ++ +   +++
Sbjct: 26  LALYVHLPWCLKKCPYCDFNSHELTTAPMLRPDRPGAGTGRALDAGVESRYLDALRADLE 85

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
               L   R + S+F GGGTPSL  P  I  +L  +     +    EIT+EANP + E  
Sbjct: 86  GALPLVWGRRVVSVFIGGGTPSLFSPDAIGQLLADVRARLPLEPGCEITLEANPGTFERE 145

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
            F+ +R AGV R+S+GVQS ++  L+ LGR H+ ++A+AA+  AR+ F   + DL+YALP
Sbjct: 146 RFRAFRAAGVTRLSIGVQSFDDAKLKALGRVHDRAQALAAVEEARSAFDTFNLDLMYALP 205

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            Q++   E ++++AL++   HLS+Y LT+E  T F      G   LP ++ A  + +   
Sbjct: 206 GQSLADCEADVRQALTFEPPHLSVYHLTLEPNTQFASRPPAG---LPDDDTAFGMLDRIT 262

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-K 299
            +T+A GL  YE+S ++  G    HNLNYW++GDY+GIG GAHS++   +HRV      +
Sbjct: 263 ELTTAAGLGRYEVSAYARPGHRCQHNLNYWQFGDYLGIGAGAHSKLSF-AHRVLRQTRWR 321

Query: 300 HPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE 359
            P ++L+     G AV  +  ++ ++   EF++  LRLREG  +  +    G  +    +
Sbjct: 322 EPAAYLRQA-VEGAAVSNEHEVARQELPFEFMLNALRLREGFELARFAERTGLAV-TAIQ 379

Query: 360 RNL---QRQGFIERVQFSRLRCTQRGMTMLDSV 389
           R L   + +G IER    R+  T+RG   L  +
Sbjct: 380 RGLEAAEAKGLIER-DLQRVWPTERGFDFLSDL 411


>gi|78065575|ref|YP_368344.1| coproporphyrinogen III oxidase [Burkholderia sp. 383]
 gi|77966320|gb|ABB07700.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia sp. 383]
          Length = 404

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/376 (35%), Positives = 214/376 (56%), Gaps = 11/376 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + +IF 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTIFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNETHLKALGRIHDTTQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDVETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           YA  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S +
Sbjct: 208 YAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGHYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G AV 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTAVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQF 373
           E+  + +     EF++  LRL EG  V ++    G  +    E  LQ   R+G I R  F
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHNFAERTGLPMST-IEPALQEAERRGLIAR-DF 380

Query: 374 SRLRCTQRGMTMLDSV 389
           +++  T  G   L+ +
Sbjct: 381 AQIAPTPLGQRFLNDL 396


>gi|299066244|emb|CBJ37428.1| Coproporphyrinogen dehydrogenase [Ralstonia solanacearum CMR15]
          Length = 424

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 144/383 (37%), Positives = 223/383 (58%), Gaps = 12/383 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH    + + ++ F+ +   +++    +   R + +
Sbjct: 40  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPDQGIPEDRFLAAIRQDLEAALPMVWGRRVHT 99

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  + +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 100 IFIGGGTPSLLSARGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 159

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 160 SIGIQSFNDAHLQALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 219

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 220 ALSFGTSHVSLYHLTLEPNTYFAKHPP----ALPDDDTAFAMQDWIHARLAAAGYEHYEV 275

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  KHPE++L+     G
Sbjct: 276 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVIREMRHKHPETYLRQSETAG 334

Query: 313 HAVV--EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERN-LQRQGFI 368
            A V  E+  + +     EF++  LRL EG  V  ++   G  L  IE E +  +R+G +
Sbjct: 335 GATVVQEQREVDAADLPFEFMLNTLRLTEGFPVTLFQERTGLPLRGIERELDAAERRGLL 394

Query: 369 ERVQFSRLRCTQRGMTMLDSVIA 391
            R   + +R T+ G   L+ + A
Sbjct: 395 VRDHVA-IRPTELGQRFLNDLQA 416


>gi|332264560|ref|XP_003281303.1| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial [Nomascus leucogenys]
          Length = 442

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 220/382 (57%), Gaps = 19/382 (4%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +YVH P+C K+C YC+FN ++ R+ V +    +  +TE Q + +L+G + + S+FFGGGT
Sbjct: 42  LYVHGPYCEKRCSYCNFNKYIPRH-VEEAAMQKCLVTEAQTLLRLSGVQWVESVFFGGGT 100

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           PSL  P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S+G+QSL
Sbjct: 101 PSLASPHTLAAVLEAVAQTAHLPADSEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSL 160

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           ++  LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  
Sbjct: 161 DDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVELWLGQLQELLHHCD 220

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           DHLSLYQL++E+GT  +   + G L  P   +  ++Y   ++I    G H YE+SN +  
Sbjct: 221 DHLSLYQLSLERGTALFTQVQRGALPAPDPELTAEMYQRGRAILREAGFHQYEVSNFARN 280

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAV 315
           GA S  N  YW+ G Y+GIGPGAH R      G H     I+   P++W+K V   GH  
Sbjct: 281 GALSTPNWTYWQCGQYLGIGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGT 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEM---------LAGRNLDIECERNLQRQG 366
            ++  L   +  +E L +GLR   GI+ + W+          + G N +++    L  +G
Sbjct: 341 RKRVPLGRLELLEEVLALGLRTDVGITHQHWQQFEPQLTLWDMFGANKEVQ---ELLERG 397

Query: 367 FIERVQFSRLRCTQRGMTMLDS 388
            ++ +    LRC+  G+ +LDS
Sbjct: 398 LLQ-LDHRGLRCSWEGLAVLDS 418


>gi|117923370|ref|YP_863987.1| coproporphyrinogen III oxidase anaerobic [Magnetococcus sp. MC-1]
 gi|117607126|gb|ABK42581.1| coproporphyrinogen III oxidase, anaerobic [Magnetococcus sp. MC-1]
          Length = 390

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 212/382 (55%), Gaps = 9/382 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLT-GPRSISSIFF 76
           L +Y+H P+CV KCPYCDF+S V   +V QE ++ + L E+  W R+ +   R + SIF 
Sbjct: 6   LSLYLHIPYCVHKCPYCDFHSRVE-VQVPQERYVDALLMELGMWRRRFSQDARPLQSIFL 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +P  I  ++ GI   W + S  E+T+E NP S+      GY +AG+ R+S+G
Sbjct: 65  GGGTPSLFDPPQIGRLMAGIGAIWPLESGCEVTMEGNPESLTQGRLAGYGEAGITRMSVG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIH-LARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQ+L+E  LR L R H+ ++A+  +  LA+  F   S D I+A P  T+  W  EL   L
Sbjct: 125 VQALDEGRLRQLQRPHDRAQALQGLGWLAQAGFSSWSADFIFATPGHTVAGWLEELAEVL 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++A  HLS Y LT+E GT F++  + G+ ++  E   + L   T    +A GL +YEISN
Sbjct: 185 AFAPPHLSCYGLTVEPGTPFFQRQQGGEALVADEERQLALLEATYERLTAAGLPSYEISN 244

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
            +  G    HN+NYWR+GDY+G+G  AH +       V  S        ++  V      
Sbjct: 245 FARAGHGCRHNVNYWRFGDYLGVGVAAHGKWSDADGVVWRSANLADAARYMACVEAGRSP 304

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERV 371
            V  + L+ ++  +E L+MGLR+ EG+S   ++ + G +L       L   +RQG + + 
Sbjct: 305 WVRDQRLTPQEAGNEALVMGLRMGEGMSKATYQWVRGVSLQQSVGDGLAWFERQGMLAQ- 363

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
             + +  T RG+ + D V+A L
Sbjct: 364 SATHVWLTPRGLRLADGVMAEL 385


>gi|121593341|ref|YP_985237.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Acidovorax sp. JS42]
 gi|222110070|ref|YP_002552334.1| oxygen-independent coproporphyrinogen iii oxidase [Acidovorax
           ebreus TPSY]
 gi|120605421|gb|ABM41161.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Acidovorax sp. JS42]
 gi|221729514|gb|ACM32334.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           ebreus TPSY]
          Length = 414

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 214/379 (56%), Gaps = 16/379 (4%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYK------VGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           YVH P+C++KCPYCDFNSH  R        V +  +I + L +++    L   R++ SIF
Sbjct: 38  YVHLPWCLRKCPYCDFNSHEARGGMGGDGGVPEARYIDALLADLEAALPLIWGRTVHSIF 97

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P++I  +L  I     + +  EIT+EANP + E   F+ YR AGV R+S+
Sbjct: 98  IGGGTPSLFAPESIDRLLGDIRARLRLDAGCEITLEANPGTFEKERFRAYRGAGVTRLSI 157

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS  ++ L+ LGR HN ++A+AA+  A   F   + D++YALP QT  + + +++ AL
Sbjct: 158 GVQSFNDRHLQALGRVHNRAQALAAVEEAAQAFDTFNLDIMYALPGQTPAELDEDMRTAL 217

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    H+S+Y LTIE  T F K        LP ++ A  + +    +T A GL  YE+S 
Sbjct: 218 ALQPPHISIYHLTIEPNTYFAKYPPP----LPEDDAAYAMLDRITELTGAAGLARYEVSA 273

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
           ++  G + +HN NYW++GDY+GIG GAHS++   +HRV   +  + P+ ++      G A
Sbjct: 274 YAREGHQCVHNRNYWQFGDYLGIGAGAHSKLSF-AHRVVRQVRLRDPQLYMAGALA-GRA 331

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQ 372
           + + + +       EF++  LRL+EG +++D+    G  +       +  + QG I R  
Sbjct: 332 IAQDDDVRRADLPFEFMLNALRLQEGFALQDFTARTGLAITAIAAGLQQAEAQGLITR-D 390

Query: 373 FSRLRCTQRGMTMLDSVIA 391
             R+R TQRG   L  + A
Sbjct: 391 MERVRPTQRGFDFLSDLQA 409


>gi|330812372|ref|YP_004356834.1| coproporphyrinogen dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380480|gb|AEA71830.1| putative coproporphyrinogen dehydrogenase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 399

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 131/373 (35%), Positives = 210/373 (56%), Gaps = 12/373 (3%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           YVH P+CV+KCPYCDFNSH    ++ +E ++ + L ++         R +SSIFFGGGTP
Sbjct: 30  YVHIPWCVRKCPYCDFNSHTASPQLPEEEYVDALLADLDQDLHAVHGRPLSSIFFGGGTP 89

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           SL   Q +  +L G+      + ++EIT+EANP + E   F  YR  G+NR+S+G+QS +
Sbjct: 90  SLFSAQALGRLLKGVEARIPFAQDIEITLEANPGTFEQEKFVAYRALGINRLSIGIQSFQ 149

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           +  L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A++    
Sbjct: 150 QAKLEALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPDQSLEDALSDLRQAIALKPT 209

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           HLS YQLT+E  T+F+         LP ++   D+    Q++ + HG   YE+S ++  G
Sbjct: 210 HLSWYQLTLEPNTVFWNQPP----TLPEDDTLWDIQEAGQALLAEHGYAQYEVSAYAQPG 265

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVVEKE 319
             + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L   +        ++
Sbjct: 266 RAARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVRTWKTRLPKDYLNPAKS---FQAGEK 322

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQFSRLR 377
            L++E+   EFLM  LRL  G+  + +    G  L    E  R  ++ G ++ V+ +RL 
Sbjct: 323 TLANEELPFEFLMNALRLTAGVEARLYPERTGLPLQSLAEGRREAEQSGLLQ-VEPTRLA 381

Query: 378 CTQRGMTMLDSVI 390
            T+RG   L+ ++
Sbjct: 382 ATERGQLFLNDLL 394


>gi|53802786|ref|YP_115466.1| oxygen-independent coproporphyrinogen III oxidase [Methylococcus
           capsulatus str. Bath]
 gi|53756547|gb|AAU90838.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Methylococcus capsulatus str. Bath]
          Length = 380

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/378 (37%), Positives = 215/378 (56%), Gaps = 17/378 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           LG+YVH P+CV+KCPYCDFNSH     + + ++I + L ++         R + S+F GG
Sbjct: 7   LGLYVHVPWCVRKCPYCDFNSHRLEGGLPERDYIAALLNDLARDADRVTGRCVESVFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ + L+L+G+     ++S+ EIT+EANP + E   F+G+R+AGVNR+S+GVQ
Sbjct: 67  GTPSLLSPEAVDLLLEGVRSRIALASDAEITLEANPGTAETAKFKGFREAGVNRLSIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S ++  L  LGR H+   A+ A  +AR   F   + DL++ LP QT+ Q + +++ A++ 
Sbjct: 127 SFDDAKLTALGRIHDGRAAVEAAAMAREAGFTNFNLDLMFGLPGQTIAQAKRDVETAIAQ 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S YQLT+E  TLF++        LP  +   D+    Q++ +  G   YEIS ++
Sbjct: 187 RPTHVSYYQLTLEPNTLFHRSPP----ALPEADAVWDIQRAGQALLADAGYGHYEISAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRV-KVGSHRVA-ISIEKHPESWLKMVRKNGHAV 315
             G    HN+NYWR+GDY+G+G GAH +V    S R+  +   +HP  +L+     G  V
Sbjct: 243 RDGFRCRHNVNYWRFGDYLGVGAGAHGKVTDPASGRITRLWKTRHPARYLETQGLGGEHV 302

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN---LDIECERNLQRQGFIERVQ 372
           V+   L       EFLM  LRLREG  +  +    G     L+      LQ +G +ER  
Sbjct: 303 VDDASLPF-----EFLMNQLRLREGFELASFTERTGLTACALEPALSECLQ-EGHLER-H 355

Query: 373 FSRLRCTQRGMTMLDSVI 390
              +RC+ RG   LD V+
Sbjct: 356 GGVIRCSDRGWNFLDEVL 373


>gi|261377934|ref|ZP_05982507.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria cinerea ATCC 14685]
 gi|269145794|gb|EEZ72212.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria cinerea ATCC 14685]
          Length = 391

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 202/377 (53%), Gaps = 10/377 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFFG
Sbjct: 17  PLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+++AG+ R+S+G 
Sbjct: 77  GGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKEAGITRLSIGA 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS     L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++ 
Sbjct: 137 QSFNNDMLARLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIAT 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  +
Sbjct: 197 GATHVSAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYETSAFA 253

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      VE
Sbjct: 254 KPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAVE 313

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQF 373
           ++ +++E    EF+M  LRL +G+      ML  R       I  +    RQ  +     
Sbjct: 314 RKTVAAEDLPFEFMMNALRLTDGVPAA---MLHERTGVPAAKIMAQIETARQKGLLETDP 370

Query: 374 SRLRCTQRGMTMLDSVI 390
           +  R T++G   L+ ++
Sbjct: 371 TVFRPTEQGQLFLNDLL 387


>gi|86146419|ref|ZP_01064743.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
 gi|85835898|gb|EAQ54032.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
          Length = 395

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 215/386 (55%), Gaps = 22/386 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L    T+++  +    PR + S
Sbjct: 10  ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEKEYIDALLEDLDTDIEKYQLNDAPRPLHS 69

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAGV+RI
Sbjct: 70  IFIGGGTPSLFSPEGIGRLLQGIKQRIPFKPEIEITMEANPGTIEAERFAGYQKAGVSRI 129

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L 
Sbjct: 130 SVGVQSFEQEKLERLGRIHGQDEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADLD 189

Query: 193 RALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           +A+     HLS YQLTIE  T+F YK  K     LP ++   D+++L     +  G   Y
Sbjct: 190 KAIELDPPHLSWYQLTIEPNTMFYYKTPK-----LPDDDDLWDIFDLGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   + 
Sbjct: 245 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN 304

Query: 311 NGHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-----IECERNLQR 364
                +  E  + +E +  EF M   RL E    +D+    G   D     IE  + L  
Sbjct: 305 LVKPYLSDELEVPNEDRPFEFFMNRFRLMEACPKQDFIDTTGLGFDSIQETIEWAKEL-- 362

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVI 390
            G++     S  + T++G   L+ ++
Sbjct: 363 -GYLNETN-SHWQITEKGKLFLNDLL 386


>gi|332529687|ref|ZP_08405641.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Hylemonella gracilis ATCC 19624]
 gi|332040708|gb|EGI77080.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Hylemonella gracilis ATCC 19624]
          Length = 397

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 144/381 (37%), Positives = 221/381 (58%), Gaps = 14/381 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSH-VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH P+C+KKCPYCDFNSH +   +V ++ ++ + + +++    L   R + SIF 
Sbjct: 20  PLSLYVHLPWCLKKCPYCDFNSHELNPREVPEQRYLDALIADLEASLPLIWGRPVQSIFI 79

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P  I  +L  I     ++++ EIT+EANP + E + F  +R AGV R+S+G
Sbjct: 80  GGGTPSLFSPTGINRLLSDIRARLRLAADCEITLEANPGTFEKDRFAAFRAAGVTRLSVG 139

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L+ LGR H+ ++A+AA+  A   F   + DL+YALP Q++TQ + +L  ALS
Sbjct: 140 VQSFNDAHLKALGRVHDRAQALAALEEAARSFETWNLDLMYALPGQSLTQLDADLDAALS 199

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLS+Y LTIE  T F K         P E+ A  + +     T A GL  YE+S +
Sbjct: 200 FAPPHLSVYHLTIEPNTYFAKFPPQ----TPDEDTAYAMLDRITERTGASGLGRYEVSAY 255

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK--MVRKNGH 313
           +  G    HNLNYW++GDY+GIG GAH ++   +HRV   +  + P  +++  +    G 
Sbjct: 256 AQPGHGCRHNLNYWQFGDYLGIGAGAHGKLSF-AHRVIRQVRAREPRLYMERALSADPGS 314

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIER 370
           AVV+ E +S      EF++  LRLREG +++D+    G  L    ++ L   +R+G++ R
Sbjct: 315 AVVQDEEVSRADLPFEFMLNALRLREGFALQDFADRTGLAL-TAIQKPLEEAERKGWLTR 373

Query: 371 VQFSRLRCTQRGMTMLDSVIA 391
              +R   T++G   L  + A
Sbjct: 374 -DLNRAWPTEQGFDFLSDLQA 393


>gi|290476324|ref|YP_003469228.1| putative oxidase [Xenorhabdus bovienii SS-2004]
 gi|289175661|emb|CBJ82464.1| putative oxidase [Xenorhabdus bovienii SS-2004]
          Length = 376

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 195/335 (58%), Gaps = 11/335 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L +++    +   R +S+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLRADLPMIEDREVSTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+  +  +SS  EIT+EANP +VE   F  Y+KAGVNRIS+GVQ
Sbjct: 67  GTPSLLSAEGMQRLLDGVRASLPLSSQAEITMEANPGTVEAGRFSAYQKAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L  LGR H   EA  A HLA ++  R  + DL++ LP QT+ +   +L++A+  
Sbjct: 127 SFGSDKLIRLGRIHGPDEAKRAAHLAADLGLRSFNLDLMHGLPNQTLNEALDDLRQAIEL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  T F         VLP ++   D+++    + +A G   YE S ++
Sbjct: 187 SPPHLSWYQLTIEPNTSFGSRPP----VLPDDDALWDIFSQGHQLLTAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ KHP  +++     G  + 
Sbjct: 243 KAGYQCQHNLNYWRFGDYLGIGCGAHGKISFEDGRILRTVKTKHPRGYMQ-----GRYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           ++  L +E +  EF M   RL E +   D+    G
Sbjct: 298 QQNQLDNEDRPFEFFMNRFRLLEAMPRHDFSDFTG 332


>gi|227112388|ref|ZP_03826044.1| coproporphyrinogen III oxidase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 380

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 126/336 (37%), Positives = 195/336 (58%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L ++     L   R + SIF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLDADLPLASGRELHSIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GV
Sbjct: 66  GGTPSLLSAEAMQALLDGVRARIPLTPDAEITMEANPGTVEADRFSGYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFDPQKLTRLGRIHGPDEAKRAAHLANGLGLRSFNLDLMHGLPDQSLDEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF          LP ++   D+Y    ++ SA G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFSSRPP----TLPDDDALWDIYEQGHALLSAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTVKVRHPRGYMQ-----GTYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            ++  ++++++  EF M   RL E     D+    G
Sbjct: 297 DKQHDVANDERPFEFFMNRFRLLEAAPRADFTAYTG 332


>gi|285017588|ref|YP_003375299.1| coproporphyrinogen III oxidase [Xanthomonas albilineans GPE PC73]
 gi|283472806|emb|CBA15311.1| putative coproporphyrinogen III oxidase protein [Xanthomonas
           albilineans]
          Length = 381

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 121/337 (35%), Positives = 202/337 (59%), Gaps = 7/337 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  +  +  + ++ + + ++     L   R + S+FFG
Sbjct: 4   PLSLYVHLPWCVRKCPYCDFNSHAAKGALPFDAYVDALIRDLDQDLPLVWGRVVHSVFFG 63

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ IA  L+  +     +  +EIT+E NP + E   F  Y  AGVNR+S G+
Sbjct: 64  GGTPSLFPPEAIARFLEAASARLRFAPGLEITLETNPGTAEHGRFDRYLAAGVNRLSFGI 123

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++ +L+ LGR H+++EA  A+ LA++  F  ++ DL+YALP+QT+ + E ++ RA++
Sbjct: 124 QSFDDAALQRLGRIHDSAEAERAVKLAQDAGFTNLNLDLMYALPQQTLAEAERDVTRAMA 183

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  TLF      G   +P ++ A ++    Q++ +A G   YE+S +
Sbjct: 184 LQPTHISHYQLTLEPNTLFAARPPQG---IPEDDDAWNMQEHCQALLAAAGYAQYEVSAY 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAIS--IEKHPESWLKMVRKNGHA 314
           +  G   +HNLNYW +GDY+GIG GAH ++  G+ +  +     KHP++++        A
Sbjct: 241 AREGERCVHNLNYWTFGDYLGIGAGAHGKISSGAEQRILRRWKHKHPQAFMAAAGTPA-A 299

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +   +++  +Q+  E+++  LRL  G +++D+    G
Sbjct: 300 IGGDDWIEPKQRPFEYMLNALRLNHGFALRDFTARTG 336


>gi|152979528|ref|YP_001345157.1| coproporphyrinogen III oxidase [Actinobacillus succinogenes 130Z]
 gi|150841251|gb|ABR75222.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Actinobacillus succinogenes 130Z]
          Length = 391

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 203/351 (57%), Gaps = 20/351 (5%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ-----WMRQL 65
           MT      L +YVH P+CV+KCPYCDFNSH ++ ++ + ++++  LT+++     +   +
Sbjct: 4   MTELTLPPLSLYVHIPWCVQKCPYCDFNSHGQKGEIPERDYVRHLLTDLRQDLTRYAASV 63

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
            G R++ SIF GGGTPSL   +NI  +L GI      + N+EIT+EANP + E   F+GY
Sbjct: 64  NG-RALQSIFIGGGTPSLFSAENIGELLHGIRAQIAFADNIEITLEANPGTAEAERFRGY 122

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR----MSFDLIYALPK 181
             AGVNRIS+G+QS  ++ L+ LGR HN++EA +A+  A+++  R     + DL++ LP 
Sbjct: 123 VNAGVNRISMGIQSFSDEKLKILGRIHNSAEAKSAVGFAQDLLGRGLKSFNLDLMHGLPN 182

Query: 182 QTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQS 241
           QT+ Q   +L+RA+     HLS YQLTIE  TLF          LP +++  D++     
Sbjct: 183 QTVQQALDDLRRAIVLNPPHLSWYQLTIEPNTLFAYRPP----ALPDDDLLWDIFEQGHQ 238

Query: 242 ITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKH 300
           + +A G   YE S ++  G +  HNLNYWR+GDY+ IG GAH ++     R+   S  KH
Sbjct: 239 LLTAAGYQQYETSAYAKPGFQCRHNLNYWRFGDYLAIGCGAHGKLGFTDGRIVRYSKTKH 298

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           P+ +L+     G  +  ++ +    +A EF M   RL E +   + +   G
Sbjct: 299 PKGYLR-----GEYLFNEKNVPESDRAFEFFMNRFRLLEPVPKAELKQFTG 344


>gi|91784890|ref|YP_560096.1| coproporphyrinogen III oxidase [Burkholderia xenovorans LB400]
 gi|91688844|gb|ABE32044.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia xenovorans LB400]
          Length = 409

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 196/327 (59%), Gaps = 6/327 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +     E  ++ +   +++    L   R + ++F 
Sbjct: 32  PLALYVHFPWCVRKCPYCDFNSHEWKGDTFPETEYLDALRADLEMALPLVWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E + F  +R +GV+R+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEADKFAQFRASGVSRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++++A  A+ +A   F   + DL++ALP QT+ + + +++ ALS
Sbjct: 152 IQSFNEAHLKALGRIHDSAQARHAVEVASTTFDNFNLDLMFALPGQTLAECQADVEMALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIHERTSAAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G AV 
Sbjct: 268 ARPHRQSRHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPTTFIEQA-KAGTAVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
           E+  + +     EF++  LRL EG  V
Sbjct: 327 EEHEVGTRDLPFEFMLNALRLVEGFPV 353


>gi|167563699|ref|ZP_02356615.1| coproporphyrinogen III oxidase [Burkholderia oklahomensis EO147]
 gi|167570849|ref|ZP_02363723.1| coproporphyrinogen III oxidase [Burkholderia oklahomensis C6786]
          Length = 405

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 199/341 (58%), Gaps = 11/341 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISS 73
            L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + +
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSH--EWKDGGALPEHDYLDALRADLEQALPLVWGRQVHT 85

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+
Sbjct: 86  VFIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRL 145

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS +E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ 
Sbjct: 146 SIGIQSFDESHLKALGRIHDAAQARAAVEIAARTFDNFNLDLMFALPNQTLDECRTDLET 205

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+
Sbjct: 206 ALSFAPPHLSLYHLTLEPNTYFAKFPP----AVPDDDASADMQDWLHERTAQAGYERYEV 261

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G 
Sbjct: 262 SAYAKPHRQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGA 320

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           AV E+  +       EF++  LRL EG+    +    G +L
Sbjct: 321 AVQEEREVGPRDLPFEFMLNALRLVEGVPTHSFAERTGMSL 361


>gi|22127208|ref|NP_670631.1| coproporphyrinogen III oxidase [Yersinia pestis KIM 10]
 gi|45443234|ref|NP_994773.1| coproporphyrinogen III oxidase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108806316|ref|YP_650232.1| coproporphyrinogen III oxidase [Yersinia pestis Antiqua]
 gi|108813303|ref|YP_649070.1| coproporphyrinogen III oxidase [Yersinia pestis Nepal516]
 gi|145597876|ref|YP_001161952.1| coproporphyrinogen III oxidase [Yersinia pestis Pestoides F]
 gi|165924952|ref|ZP_02220784.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|167399879|ref|ZP_02305397.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167422016|ref|ZP_02313769.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|21960275|gb|AAM86882.1|AE013934_5 putative oxidase [Yersinia pestis KIM 10]
 gi|45438102|gb|AAS63650.1| putative oxidase [Yersinia pestis biovar Microtus str. 91001]
 gi|108776951|gb|ABG19470.1| coproporphyrinogen III oxidase, anaerobic [Yersinia pestis
           Nepal516]
 gi|108778229|gb|ABG12287.1| coproporphyrinogen III oxidase, anaerobic [Yersinia pestis Antiqua]
 gi|145209572|gb|ABP38979.1| coproporphyrinogen III oxidase, anaerobic [Yersinia pestis
           Pestoides F]
 gi|165923152|gb|EDR40303.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|166960153|gb|EDR56174.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050587|gb|EDR61995.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Antiqua str. UG05-0454]
          Length = 380

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 137/380 (36%), Positives = 215/380 (56%), Gaps = 22/380 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF GG
Sbjct: 11  LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHVLADLDADVPLVSGREISTIFIGG 70

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V+S+ EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 71  GTPSLLSAEAMQQLLDGVRARLPVASDAEITMEANPGAVEADRFSGYQRAGINRISIGVQ 130

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   Q L  LGR H   EA  A  LA ++  R  + DL++ LP QT+ +   +L++A++ 
Sbjct: 131 SFSAQKLTRLGRIHGPDEARRAAELATSLQLRSFNLDLMHGLPDQTLEEALDDLRQAIAL 190

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T F         +LP ++   D++     + SA G   YE S ++
Sbjct: 191 NPPHLSWYQLTIEPNTGFSSRPP----ILPDDDALWDIFQQGHQLLSAAGYLQYETSAYA 246

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK---MVRKNGH 313
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +I+ KHP  +++   + ++   
Sbjct: 247 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGRILRTIKTKHPRGFMQGKYLDKQYEV 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIER 370
           A V++ F        EF M   RL E     D+    G     +  + +  + ++  IE 
Sbjct: 307 AAVDRPF--------EFFMNRFRLLEAAPRADFYHFTGLTESTIRPQLDEAIAKEYLIET 358

Query: 371 VQFSRLRCTQRGMTMLDSVI 390
            ++ ++  T++G   L+S++
Sbjct: 359 TEYWQI--TEKGKLFLNSLL 376


>gi|186896652|ref|YP_001873764.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis PB1/+]
 gi|186699678|gb|ACC90307.1| oxygen-independent coproporphyrinogen III oxidase [Yersinia
           pseudotuberculosis PB1/+]
          Length = 376

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 137/380 (36%), Positives = 215/380 (56%), Gaps = 22/380 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHVLADLDADVPLVSGREISTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V+S+ EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQQLLDGVRARLPVASDTEITMEANPGAVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   Q L  LGR H   EA  A  LA ++  R  + DL++ LP QT+ +   +L++A++ 
Sbjct: 127 SFSAQKLTRLGRIHGPDEARRAAELATSLQLRSFNLDLMHGLPDQTLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T F         +LP ++   D++     + SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTGFSSRPP----ILPDDDALWDIFQQGHQLLSAAGYLQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK---MVRKNGH 313
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +I+ KHP  +++   + ++   
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGRILRTIKTKHPRGFMQGKYLDKQYEV 302

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIER 370
           A V++ F        EF M   RL E     D+    G     +  + +  + ++  IE 
Sbjct: 303 AAVDRPF--------EFFMNRFRLLEAAPRADFYHFTGLTESTIRPQLDEAIAKEYLIET 354

Query: 371 VQFSRLRCTQRGMTMLDSVI 390
            ++ ++  T++G   L+S++
Sbjct: 355 TEYWQI--TEKGKLFLNSLL 372


>gi|51597528|ref|YP_071719.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis IP
           32953]
 gi|149367045|ref|ZP_01889078.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis CA88-4125]
 gi|153949486|ref|YP_001399809.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis IP
           31758]
 gi|162420837|ref|YP_001604773.1| coproporphyrinogen III oxidase [Yersinia pestis Angola]
 gi|165937288|ref|ZP_02225852.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010233|ref|ZP_02231131.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212704|ref|ZP_02238739.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167426718|ref|ZP_02318471.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167468165|ref|ZP_02332869.1| coproporphyrinogen III oxidase [Yersinia pestis FV-1]
 gi|170023075|ref|YP_001719580.1| coproporphyrinogen III oxidase [Yersinia pseudotuberculosis YPIII]
 gi|218928118|ref|YP_002345993.1| coproporphyrinogen III oxidase [Yersinia pestis CO92]
 gi|229837639|ref|ZP_04457801.1| predicted oxidoreductase [Yersinia pestis Pestoides A]
 gi|229840865|ref|ZP_04461024.1| predicted oxidoreductase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842574|ref|ZP_04462729.1| predicted oxidoreductase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903766|ref|ZP_04518879.1| predicted oxidoreductase [Yersinia pestis Nepal516]
 gi|270487544|ref|ZP_06204618.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis KIM D27]
 gi|294502891|ref|YP_003566953.1| coproporphyrinogen III oxidase [Yersinia pestis Z176003]
 gi|51590810|emb|CAH22456.1| Putative conserved coproporphyrinogen III oxidase [Yersinia
           pseudotuberculosis IP 32953]
 gi|115346729|emb|CAL19612.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis CO92]
 gi|149290659|gb|EDM40735.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis CA88-4125]
 gi|152960981|gb|ABS48442.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pseudotuberculosis IP 31758]
 gi|162353652|gb|ABX87600.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis Angola]
 gi|165914762|gb|EDR33375.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165990719|gb|EDR43020.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205996|gb|EDR50476.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167054321|gb|EDR64140.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169749609|gb|ACA67127.1| oxygen-independent coproporphyrinogen III oxidase [Yersinia
           pseudotuberculosis YPIII]
 gi|229679536|gb|EEO75639.1| predicted oxidoreductase [Yersinia pestis Nepal516]
 gi|229690884|gb|EEO82938.1| predicted oxidoreductase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697231|gb|EEO87278.1| predicted oxidoreductase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229704327|gb|EEO91338.1| predicted oxidoreductase [Yersinia pestis Pestoides A]
 gi|262360926|gb|ACY57647.1| coproporphyrinogen III oxidase [Yersinia pestis D106004]
 gi|270336048|gb|EFA46825.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia pestis KIM D27]
 gi|294353350|gb|ADE63691.1| coproporphyrinogen III oxidase [Yersinia pestis Z176003]
 gi|320013972|gb|ADV97543.1| putative oxidoreductase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 376

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 137/380 (36%), Positives = 215/380 (56%), Gaps = 22/380 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHVLADLDADVPLVSGREISTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V+S+ EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQQLLDGVRARLPVASDAEITMEANPGAVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   Q L  LGR H   EA  A  LA ++  R  + DL++ LP QT+ +   +L++A++ 
Sbjct: 127 SFSAQKLTRLGRIHGPDEARRAAELATSLQLRSFNLDLMHGLPDQTLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T F         +LP ++   D++     + SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTGFSSRPP----ILPDDDALWDIFQQGHQLLSAAGYLQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK---MVRKNGH 313
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +I+ KHP  +++   + ++   
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGRILRTIKTKHPRGFMQGKYLDKQYEV 302

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIER 370
           A V++ F        EF M   RL E     D+    G     +  + +  + ++  IE 
Sbjct: 303 AAVDRPF--------EFFMNRFRLLEAAPRADFYHFTGLTESTIRPQLDEAIAKEYLIET 354

Query: 371 VQFSRLRCTQRGMTMLDSVI 390
            ++ ++  T++G   L+S++
Sbjct: 355 TEYWQI--TEKGKLFLNSLL 372


>gi|315634900|ref|ZP_07890182.1| coproporphyrinogen dehydrogenase [Aggregatibacter segnis ATCC
           33393]
 gi|315476452|gb|EFU67202.1| coproporphyrinogen dehydrogenase [Aggregatibacter segnis ATCC
           33393]
          Length = 389

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 205/341 (60%), Gaps = 17/341 (4%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPRSISSIFF 76
           +Y+H P+CV+KCPYCDFNSH ++  + ++ +++  L ++       ++    RS+ SIF 
Sbjct: 16  LYIHIPWCVQKCPYCDFNSHAQKGSIPEQEYVRHLLADLTADLSRYQESVQQRSLHSIFI 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   +NIA +L  I +    + ++EIT+EANP + E   F GY +AGVNRIS+G
Sbjct: 76  GGGTPSLFSAENIAFLLHQIEQRIPFAPHIEITLEANPGTAEAERFLGYVQAGVNRISMG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRM-SFDLIYALPKQTMTQWEMELQRAL 195
           +QS  ++ L+ LGR HNA+EA +A+  AR    R+ + DL++ LP QT+ +   +L++A+
Sbjct: 136 IQSFSDEKLQKLGRIHNAAEAKSAVGFARVSSLRIFNLDLMHGLPNQTLNEALDDLRQAI 195

Query: 196 SYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
             A  HLS YQLTIE  T+F Y+  K     LP ++   D++     + +A G   YE S
Sbjct: 196 ELAPPHLSWYQLTIEPNTMFAYRPPK-----LPDDDELWDIFEQGHQLLTAAGYQQYETS 250

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKNGH 313
            ++  G +  HNLNYWR+GDY+ IG GAH ++   S ++   S  KHP+ +++     G 
Sbjct: 251 AYAKPGFQCQHNLNYWRFGDYLAIGCGAHGKLSFPSGKILRYSKTKHPKGYMR-----GE 305

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            + E+  +S+E +  EF M   RL E +   ++E   G +L
Sbjct: 306 YLYEERDVSAEDRPFEFFMNRFRLLEAVPKSEFEQFTGLSL 346


>gi|134295023|ref|YP_001118758.1| coproporphyrinogen III oxidase [Burkholderia vietnamiensis G4]
 gi|134138180|gb|ABO53923.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia vietnamiensis G4]
          Length = 404

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 131/375 (34%), Positives = 212/375 (56%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEGHLKALGRIHDTAQARAAVEIAAQTFDNFNLDLMFALPNQTLAECRADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           YA  HLSLY LT+E  TLF K       V+P ++ + D+       T+  G   YE+S +
Sbjct: 208 YAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHERTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERN-LQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +  IE   N  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMGTIEPALNEAERRGLITR-DFT 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|187925063|ref|YP_001896705.1| coproporphyrinogen III oxidase [Burkholderia phytofirmans PsJN]
 gi|187716257|gb|ACD17481.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           phytofirmans PsJN]
          Length = 409

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 194/327 (59%), Gaps = 6/327 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-FIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +     EN ++ +   +++    L   R + ++F 
Sbjct: 32  PLALYVHFPWCVRKCPYCDFNSHEWKGDTFPENEYLDALRADLEMALPLVWGRQVHTVFI 91

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 92  GGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 151

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++++A  A+ +A   F   + DL++ALP QT+ Q + +++ ALS
Sbjct: 152 IQSFNEAHLKALGRIHDSAQARHAVEVAATTFDNFNLDLMFALPGQTLAQCQADVETALS 211

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        LP  + + D+ +     TSA G   YE+S +
Sbjct: 212 FAPPHLSLYHLTLEPNTLFAKFPP----ALPDADSSADMQDWIHERTSAAGYERYEVSAY 267

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G AV 
Sbjct: 268 ARPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPTTFIERALA-GTAVQ 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
           E+  + +     EF++  LRL EG  V
Sbjct: 327 EEREVGTRDLPFEFMLNALRLVEGFPV 353


>gi|253689817|ref|YP_003019007.1| oxygen-independent coproporphyrinogen III oxidase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251756395|gb|ACT14471.1| oxygen-independent coproporphyrinogen III oxidase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 380

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 198/345 (57%), Gaps = 13/345 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L ++     L   R + SIF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLDADLPLASGRELHSIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     ++ + E+T+EANP +VE + F GY++AG+NRIS+GV
Sbjct: 66  GGTPSLLSAEAMQALLDGVRARIPLTPDAEVTMEANPGTVEADRFSGYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFDPQKLTRLGRIHGPDEAKRAAHLATGLGLRSFNLDLMHGLPDQSLDEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF          LP ++   D+Y    ++ SA G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFSSRPP----TLPDDDALWDIYEQGHALLSAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTVKVRHPRGYMQ-----GTYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
            ++  ++++ +  EF M   RL E     D+    G  L+  C R
Sbjct: 297 DKQHDVANDDRPFEFFMNRFRLLEAAPRADFTAYTG--LEEHCIR 339


>gi|240949314|ref|ZP_04753657.1| coproporphyrinogen III oxidase [Actinobacillus minor NM305]
 gi|240296265|gb|EER46914.1| coproporphyrinogen III oxidase [Actinobacillus minor NM305]
          Length = 385

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 210/389 (53%), Gaps = 23/389 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++ +IQ  L ++       +   G R I SI
Sbjct: 8   LSLYIHIPWCVQKCPYCDFNSHAQKGVIPEKAYIQHLLADLSQDLTAYKTAIGERKIHSI 67

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   + I  +L  I K       +EIT+EANP + E   F GY + GVNRIS
Sbjct: 68  FIGGGTPSLFSAEGIQYLLAEIQKRIAFEDQIEITLEANPGTAEAERFLGYVQGGVNRIS 127

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI----FPRMSFDLIYALPKQTMTQWEME 190
           +G+QS E + L  LGR HN  EAI A+  A+N         + DL++ LP Q+++Q   +
Sbjct: 128 MGIQSFEPEKLLKLGRIHNREEAIQAVEFAKNAASLGLRSFNLDLMHGLPNQSVSQALSD 187

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A++    HLS YQLTIE  T+FY         LP ++   D++     + ++ G   
Sbjct: 188 LKQAIALNPPHLSWYQLTIEPNTMFYYRQP----TLPDDDELWDIFEQGHQLLTSAGYEQ 243

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVR 309
           YE S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +++   
Sbjct: 244 YETSAYAKKGYQCQHNLNYWRFGDYLAIGCGAHGKITYPTGEIYRFSKTKHPKGYMQ--- 300

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQG 366
             G     +E ++ E +  EF M   RL E     D+E L G   ++++    + L++  
Sbjct: 301 --GEYRYSQELIALEDRPFEFFMNRFRLLEATPKTDFEQLTGLTLKSIEPIITQALEKNY 358

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            IE  Q    + TQ G   L+ ++    V
Sbjct: 359 IIETEQ--HWQITQHGKLFLNELLEGFLV 385


>gi|325981769|ref|YP_004294171.1| oxygen-independent coproporphyrinogen III oxidase [Nitrosomonas sp.
           AL212]
 gi|325531288|gb|ADZ26009.1| oxygen-independent coproporphyrinogen III oxidase [Nitrosomonas sp.
           AL212]
          Length = 404

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 123/336 (36%), Positives = 189/336 (56%), Gaps = 7/336 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           L +YVH+P+C+KKCPYCDFNSH  R    +V +E ++ + + +++   Q    R ++S+F
Sbjct: 15  LSLYVHFPWCLKKCPYCDFNSHELRTDESRVPEEEYVATLIRDLESALQDVWGRRLNSVF 74

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL     +  +L  +     +    E+T+EANP + E   F  +RKAG+NR+S+
Sbjct: 75  LGGGTPSLFSAGAMDAVLTAVRTLLPLEHFAEVTLEANPGTFEAQKFADFRKAGINRLSI 134

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS   Q L+ LGR H+  EA  A+ +A   F  ++ DL+YALP QT+   + +++ A 
Sbjct: 135 GIQSFNPQHLKALGRVHDDQEAHRAVDIALKYFDNINLDLMYALPGQTLEHAQADIEAAC 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +  V H+S Y LT+E  TLFY+        LP +  A  + ++ +  TS H    YE S 
Sbjct: 195 ACGVTHISAYHLTLEPNTLFYRFPPK----LPDDEAAAAMQDMIEQTTSDHQYRNYETSA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            +  G ES HN+NYW +GDY+GIG GAHS++      V     K P+ +L   R  G  +
Sbjct: 251 FARAGKESRHNVNYWLFGDYVGIGAGAHSKISFADKIVRQMRYKQPKEYLAKARMGGSLI 310

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
             ++ L+   ++ EF+M  LRL  G     ++   G
Sbjct: 311 QVQQELTVADRSFEFMMNALRLTGGFDTPLFQERTG 346


>gi|17546880|ref|NP_520282.1| coproporphyrinogen III oxidase [Ralstonia solanacearum GMI1000]
 gi|17429180|emb|CAD15868.1| putative cog0635, coproporphyrinogen III oxidase and related fe-s
           oxidoreductases oxidoreductase protein [Ralstonia
           solanacearum GMI1000]
          Length = 424

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 142/383 (37%), Positives = 221/383 (57%), Gaps = 12/383 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVR-RYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + ++ F+ +   +++    +   R + +
Sbjct: 40  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEAGIPEDRFLAAIRQDLEAALPMVWGRRVHT 99

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  + +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 100 IFIGGGTPSLLSARGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 159

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 160 SIGIQSFNDTHLQALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 219

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 220 ALSFGTSHVSLYHLTLEPNTYFAKHPP----ALPDDDTAFAMQDWIHARLAAAGYEHYEV 275

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  KHPE++L+     G
Sbjct: 276 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVIRDMRHKHPETYLRQAETAG 334

Query: 313 HAVV--EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERN-LQRQGFI 368
            A V  E+  + +     EF++  LRL +G  V  ++   G  L  IE E +  +R+G +
Sbjct: 335 GATVVQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLRGIERELDAAERRGLL 394

Query: 369 ERVQFSRLRCTQRGMTMLDSVIA 391
                + +R T+ G   L+ + A
Sbjct: 395 VH-DHATIRPTELGQRFLNDLQA 416


>gi|84394059|ref|ZP_00992795.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
 gi|84375301|gb|EAP92212.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
          Length = 395

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 214/386 (55%), Gaps = 22/386 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++       QL G PR + S
Sbjct: 10  ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEKEYIDALLEDLDTDIEKYQLNGMPRPLHS 69

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAG+ RI
Sbjct: 70  IFIGGGTPSLFSPEGIGRLLQGIEQRIPFKPEIEITMEANPGTIEAERFAGYQKAGITRI 129

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L 
Sbjct: 130 SVGVQSFEQEKLERLGRIHGQVEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADLD 189

Query: 193 RALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           +A+     HLS YQLTIE  T+F YK  K     LP ++   D+++L     +  G   Y
Sbjct: 190 KAIELDPPHLSWYQLTIEPNTMFYYKTPK-----LPDDDDLWDIFDLGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP  +L   + 
Sbjct: 245 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN 304

Query: 311 NGHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-----IECERNLQR 364
                +  E  + +E +  EF M   RL E    +D+    G   D     IE  + L  
Sbjct: 305 LVKPYLSDELEVPNEDRPFEFFMNRFRLMEACPKQDFIDTTGLGFDSIQETIEWAKEL-- 362

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVI 390
            G++     +  + T++G   L+ ++
Sbjct: 363 -GYLNETD-THWQITEKGKLFLNDLL 386


>gi|117619818|ref|YP_855387.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117561225|gb|ABK38173.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 381

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/341 (37%), Positives = 198/341 (58%), Gaps = 10/341 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH ++ ++    ++ + L +++        R +SSIF G
Sbjct: 6   PLSLYIHVPWCVQKCPYCDFNSHAQKGELPHLEYVAALLEDLEQDLHWAQGRPLSSIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     ++++ EIT+EANP +VE + F G+++AG+NRIS+GV
Sbjct: 66  GGTPSLLSVEAMQALLDGVRARIELTADCEITMEANPGTVEADKFAGFQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +++ L  LGR H  +EA  A  LA  I  P  + DL++ LP Q++     +LQ+A+ 
Sbjct: 126 QSFQQEKLTRLGRIHGPAEARKAAELAHAIKLPTFNLDLMHGLPDQSLADALSDLQQAID 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLTIE  T F          LP ++   D+Y    ++ +AHG   YEIS +
Sbjct: 186 CAPPHLSWYQLTIEPNTAFASKPP----TLPEDDTLWDIYEQGHAMLTAHGYQQYEISAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVK--VGSHRVAISIEKHPESWLKMVRKNGHA 314
           +  G +  HNLNYWR+GDY+GIG GAH +V        +  +  KHP+ +L   R     
Sbjct: 242 AKAGYQCRHNLNYWRFGDYLGIGCGAHGKVTDLANPQILRTAKVKHPKGYLDPSRPY--- 298

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
           + E+  ++++    E+ M   RL E     ++E   G  L+
Sbjct: 299 LDEQWQVTADDLPLEYFMNRFRLFEPAPKAEFEAYTGLGLE 339


>gi|54310246|ref|YP_131266.1| coproporphyrinogen III oxidase [Photobacterium profundum SS9]
 gi|46914687|emb|CAG21464.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Photobacterium profundum SS9]
          Length = 384

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 198/358 (55%), Gaps = 26/358 (7%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ---WMRQL-TGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH  + ++ + ++I + L ++       QL  G R + S
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHALKAEIPELDYIDALLEDLDIDLAKYQLEAGVRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P  I  +L GI      S ++EIT+EANP +VE   F  Y++ G+NRI
Sbjct: 66  IFIGGGTPSLISPPEIGRLLKGIETRIPFSHDIEITMEANPGTVEAGRFVAYQEVGINRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS +++ L  LGR H + EA  A  LA +      + DL++ LP Q++     +L+
Sbjct: 126 SIGVQSFQDEKLTRLGRIHGSDEARKAAKLATDAGLNSFNIDLMHGLPDQSIDDAMYDLK 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+S    HLS YQLTIE  T+FY         LP ++   D++     I +A G   YE
Sbjct: 186 QAISLNPPHLSWYQLTIEPNTMFYSKPP----TLPDDDDLWDIFEQGHQILAAAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH +V      +  +++ KHP  +L      
Sbjct: 242 ISGYSKPGLQCRHNLNYWRFGDYLGIGCGAHGKVSFADGNITRTVKVKHPRGYLNPA--- 298

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ 363
                 K +L  E Q D      EF M   RL E    +D+    G +LD   + N+Q
Sbjct: 299 ------KPYLDKETQVDAAERPFEFFMNRFRLLEACPKQDYCDRTGLSLDT-IDTNIQ 349


>gi|145638622|ref|ZP_01794231.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittII]
 gi|145272217|gb|EDK12125.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittII]
 gi|309750121|gb|ADO80105.1| Putative oxidase [Haemophilus influenzae R2866]
          Length = 383

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 201/340 (59%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHTQKGDIPEQDYIYHLLQDLQADLQRFKDAIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +A G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTAAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +S   +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVSEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|330446893|ref|ZP_08310544.1| radical SAM superfamily protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491084|dbj|GAA05041.1| radical SAM superfamily protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 387

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 132/348 (37%), Positives = 195/348 (56%), Gaps = 23/348 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH  + ++ + ++I + +    T++   + + G R + S
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHALKTELPELDYIDALIDDLETDLSAYQLVNGVRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P  I  +L  I +    S ++EIT+EANP +VE   F  YR+AGVNRI
Sbjct: 66  IFIGGGTPSLISPSEIGRLLKAIEQRIPFSDDIEITMEANPGTVEAGRFDAYRQAGVNRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+G+QS + + L  LGR H   EAI A  LA+       + DL++ LP Q++     +L+
Sbjct: 126 SIGIQSFQNEKLERLGRIHGCDEAIRAAGLAKQAGLNSFNVDLMHGLPDQSVEDAISDLK 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TL+Y         LP ++   D++     + +  G   YE
Sbjct: 186 QAIALDPPHLSWYQLTIEPNTLYYSKPP----TLPDDDDLWDIFEQGHQLLTEAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK----- 306
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ KHP  +L+     
Sbjct: 242 ISGYSKPGKQCQHNLNYWRFGDYLGIGCGAHGKISFEDGRIIRTVKVKHPRGYLQADKPY 301

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           + ++   A  E+ F        EF M   RL E    +D+    G  L
Sbjct: 302 LTQETNVADCERPF--------EFFMNRFRLLEACPKQDYPTRTGLPL 341


>gi|226940859|ref|YP_002795933.1| coproporphyrinogen III oxidase [Laribacter hongkongensis HLHK9]
 gi|226715786|gb|ACO74924.1| Probable porphyrin oxidoreductase [Laribacter hongkongensis HLHK9]
          Length = 406

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 136/376 (36%), Positives = 206/376 (54%), Gaps = 9/376 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+C+KKCPYCDFNSH  R  V +  +I + L ++     L   RS+ ++F G
Sbjct: 20  PLSLYVHVPWCLKKCPYCDFNSHGVRGPVDEAGYIDALLADLDQSLPLVWGRSLKTVFIG 79

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  +    +L G+     +    EIT+EANP + E   F+ YR AG+NR+S+G+
Sbjct: 80  GGTPSLLSAEAFDRLLSGVRARLKLDPQAEITLEANPGTAEAGRFREYRAAGINRLSIGI 139

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS +++ L  LGR H+  EA  A  LA + F   + DL+YALP QT+ + + ++  A+++
Sbjct: 140 QSFDDRFLHALGRVHDGKEAHLAADLAADTFDTFNLDLMYALPGQTLAEAQADVTAAVAH 199

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS Y LT+E  TLF      G   LP ++ + D+    ++  +  G   YE S  +
Sbjct: 200 RPTHLSCYHLTLEPNTLFAAAPPAG---LPDDDTSADMQEAIEARLAEAGFCHYETSAFA 256

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNLNYW +GDY+GIG GAH ++      V     K P+++L+ V + G AV  
Sbjct: 257 RPGFESRHNLNYWTFGDYLGIGAGAHGKISFADRIVRQMKHKQPQAYLEAVAR-GQAVQN 315

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQFS 374
           +  ++   +  EF+M  LRL  G+    +    G  L     R L    RQG ++    +
Sbjct: 316 EHEIAVVDRPFEFMMNALRLTGGVPTPLFSERTGVPL-ARISRELAEAVRQGLLD-ADPA 373

Query: 375 RLRCTQRGMTMLDSVI 390
           RL  T +G   L+ ++
Sbjct: 374 RLAPTPQGQRFLNDLL 389


>gi|300703569|ref|YP_003745171.1| coproporphyrinogen dehydrogenase [Ralstonia solanacearum CFBP2957]
 gi|299071232|emb|CBJ42550.1| Coproporphyrinogen dehydrogenase [Ralstonia solanacearum CFBP2957]
          Length = 425

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/384 (37%), Positives = 222/384 (57%), Gaps = 14/384 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH    + + +  F+ +   +++    +   R + +
Sbjct: 41  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPDQGIPEARFLAAVRQDLEAALPMVWGRRVHT 100

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 101 IFIGGGTPSLLSAQGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 160

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  LR LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 161 SIGIQSFNDAHLRALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 220

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 221 ALSFETSHVSLYHLTLEPNTYFAKYPP----ALPDDDTAFGMQDWIHARLAAAGYEHYEV 276

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRK-N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++    HRV   +  +HPE++L+     +
Sbjct: 277 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSF-PHRVLREMRHRHPETYLRQAETAS 335

Query: 312 GHAVV-EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGF 367
           G AVV E+  + +     EF++  LRL  G  V  ++   G   R ++ E +   QR G 
Sbjct: 336 GAAVVQEQREVDAADLPFEFMLNALRLTGGFPVTLFQERTGLPLRAIERELDAAEQR-GL 394

Query: 368 IERVQFSRLRCTQRGMTMLDSVIA 391
           + R   + +R T+ G   L+ + A
Sbjct: 395 LARDHVA-IRPTELGQRFLNDLQA 417


>gi|261250158|ref|ZP_05942734.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio
           orientalis CIP 102891]
 gi|260939274|gb|EEX95260.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio
           orientalis CIP 102891]
          Length = 391

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 197/341 (57%), Gaps = 21/341 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLT-GPRSISS 73
           +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L +++      QL   PR + S
Sbjct: 8   ALSLYVHIPWCVQKCPYCDFNSHALKAEIPEQEYIAALLQDLEADIERYQLNDNPRLLHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI  + IA +L GI        ++EIT+EANP ++E   F GY+KAGV RI
Sbjct: 68  IFIGGGTPSLISAEGIANLLAGIEARLPFKPDIEITMEANPGTIEAERFAGYQKAGVTRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS E+  L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L+
Sbjct: 128 SVGVQSFEQTKLERLGRIHGQDEAVKAAKLAHQIGLKSFNLDLMHGLPDQSVDQALADLE 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++ L     +  G   YE
Sbjct: 188 KAIELDPPHLSWYQLTIEPNTMFYYKQP----TLPDDDDLWDIFELGHKKLAEAGYVQYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + + KHP+ +L      
Sbjct: 244 ISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFSDGRIVRTTKIKHPKGYLA----- 298

Query: 312 GHAVVEKEFLSSEQQ-AD-----EFLMMGLRLREGISVKDW 346
            +  + K +L+SE+  AD     EF M   RL E    +D+
Sbjct: 299 AYDNMVKPYLNSEEHVADQDRPFEFFMNRFRLIEACPKQDF 339


>gi|126438587|ref|YP_001059968.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 668]
 gi|167720745|ref|ZP_02403981.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei DM98]
 gi|217420410|ref|ZP_03451915.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 576]
 gi|237813384|ref|YP_002897835.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei MSHR346]
 gi|254181026|ref|ZP_04887624.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1655]
 gi|254298854|ref|ZP_04966304.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 406e]
 gi|126218080|gb|ABN81586.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 668]
 gi|157808917|gb|EDO86087.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 406e]
 gi|184211565|gb|EDU08608.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1655]
 gi|217395822|gb|EEC35839.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 576]
 gi|237505440|gb|ACQ97758.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei MSHR346]
          Length = 405

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 199/341 (58%), Gaps = 11/341 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISS 73
            L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + +
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSH--EWKDGGALPERDYLDALRADLEHALPLVWGRQVHT 85

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+
Sbjct: 86  VFIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRL 145

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ 
Sbjct: 146 SIGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLET 205

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+
Sbjct: 206 ALAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEV 261

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G 
Sbjct: 262 SAYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGT 320

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            V E+  +       EF++  LRL +G+    +E   G +L
Sbjct: 321 PVQEEREVGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSL 361


>gi|326570282|gb|EGE20327.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis BC8]
 gi|326571019|gb|EGE21043.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis BC7]
          Length = 391

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 202/362 (55%), Gaps = 18/362 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CVKKCPYCDFNSH    +V  EN+I++ L++    + L   R I ++F G
Sbjct: 12  PLSLYIHMPWCVKKCPYCDFNSHALPSQVPFENYIEALLSDAVSQQSLVSNRQIDTVFIG 71

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  ++   + DG+   +  +   EIT+EANP ++E + F  Y   G+NR+S+GV
Sbjct: 72  GGTPSLLPIESFKRLFDGLRLIYDFAPTCEITLEANPGTLEHSPFDEYLTIGINRLSIGV 131

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +  +L  LGR HN  +A  AI  AR   F R++ DL+Y LP Q  ++   ++Q A+ 
Sbjct: 132 QSFDHNALTVLGRIHNPDQASNAIRAARIAGFDRVNADLMYGLPNQNPSKAVNDIQTAID 191

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN- 255
               HLS YQLTIE  T FY+        LP E +  ++  L QS+ + HG + YE+S  
Sbjct: 192 AGATHLSWYQLTIEPNTTFYRTPPQ----LPDEEIMAEIETLGQSVLTKHGFYNYEVSAW 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHR------VAISIEKHPESWLKMVR 309
           H    A   HNLNYW++GDY+ IG GAH ++ + +H             + P+ +L    
Sbjct: 248 HGPNDAPCQHNLNYWQFGDYLAIGAGAHGKLTLKNHPDYQDGIYRYQKSRQPKDYLAF-- 305

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQG 366
           ++   +V  E +S +    EF+M  LRL++G+S   +E   G     +D E    LQ QG
Sbjct: 306 EDAPKMVNFERISDDNLPFEFMMNALRLKDGVSTDVFETRTGLLISTIDNEM-LPLQHQG 364

Query: 367 FI 368
            +
Sbjct: 365 LM 366


>gi|167903811|ref|ZP_02491016.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei NCTC
           13177]
          Length = 405

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 199/341 (58%), Gaps = 11/341 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISS 73
            L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + +
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSH--EWKDGGALPERDYLDALRADLEHALPLVWGRQVHT 85

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+
Sbjct: 86  VFIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRL 145

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ 
Sbjct: 146 SIGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLET 205

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+
Sbjct: 206 ALAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEV 261

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G 
Sbjct: 262 SAYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGT 320

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            V E+  +       EF++  LRL +G+    +E   G +L
Sbjct: 321 PVQEEREVGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSL 361


>gi|76808674|ref|YP_334428.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 1710b]
 gi|126453675|ref|YP_001067260.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 1106a]
 gi|167825333|ref|ZP_02456804.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 9]
 gi|167846835|ref|ZP_02472343.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei B7210]
 gi|167895427|ref|ZP_02482829.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 7894]
 gi|167920051|ref|ZP_02507142.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei BCC215]
 gi|226193887|ref|ZP_03789489.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pakistan 9]
 gi|242315904|ref|ZP_04814920.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1106b]
 gi|254191872|ref|ZP_04898375.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254258471|ref|ZP_04949525.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1710a]
 gi|76578127|gb|ABA47602.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1710b]
 gi|126227317|gb|ABN90857.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1106a]
 gi|157939543|gb|EDO95213.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|225934192|gb|EEH30177.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pakistan 9]
 gi|242139143|gb|EES25545.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1106b]
 gi|254217160|gb|EET06544.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1710a]
          Length = 405

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 199/341 (58%), Gaps = 11/341 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISS 73
            L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + +
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSH--EWKDGGALPERDYLDALRADLEHALPLVWGRQVHT 85

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+
Sbjct: 86  VFIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRL 145

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ 
Sbjct: 146 SIGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLET 205

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+
Sbjct: 206 ALAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEV 261

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G 
Sbjct: 262 SAYTKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGT 320

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            V E+  +       EF++  LRL +G+    +E   G +L
Sbjct: 321 PVQEEREVGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSL 361


>gi|134280350|ref|ZP_01767061.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 305]
 gi|134248357|gb|EBA48440.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 305]
          Length = 405

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 199/341 (58%), Gaps = 11/341 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISS 73
            L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + +
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSH--EWKDGGALPERDYLDALRADLEHALPLVWGRQVHT 85

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+
Sbjct: 86  VFIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRL 145

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ 
Sbjct: 146 SIGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLET 205

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+
Sbjct: 206 ALAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEV 261

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G 
Sbjct: 262 SAYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGT 320

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            V E+  +       EF++  LRL +G+    +E   G +L
Sbjct: 321 PVQEEREVGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSL 361


>gi|332994273|gb|AEF04328.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alteromonas sp. SN2]
          Length = 379

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 133/385 (34%), Positives = 221/385 (57%), Gaps = 26/385 (6%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+CV+KCPYCDFNSH  +  + ++ ++   L ++    +  G R++ +IF GG
Sbjct: 6   LSLYVHIPWCVQKCPYCDFNSHGLKSALPEKEYVAHLLDDLAIDAKRIGDRTVETIFIGG 65

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL   + I+ ++ GI +   ++ N EIT+EANP +VE   F G+ +AG+NRIS+G+Q
Sbjct: 66  GTPSLFSAEAISDLVKGIRERVNLADNAEITMEANPGTVESGRFAGFYQAGINRISVGIQ 125

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S +   L+ LGR H+ ++AI AI+ A +   P  + DL++ LP+Q++     ++ +AL+ 
Sbjct: 126 SFQPAHLKVLGRIHDDTQAIEAINQAHSAGLPTFNLDLMHGLPEQSVENAMSDVDKALAL 185

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  T FY    +    LP +++  D+     +   A G   YEIS ++
Sbjct: 186 SPYHLSWYQLTIEPNTPFYSRPPE----LPDDDILWDIQEQGHARLKAAGYEQYEISAYA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRV-KVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
             G +  HNLNYWR+GDY+GIG GAH ++  + +  +  +++ KHP  ++++ R      
Sbjct: 242 KAGHQCQHNLNYWRFGDYLGIGCGAHGKITDIATGTITRTVKIKHPRGYMEISRP----- 296

Query: 316 VEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQG 366
               +L +E Q        EF M   RL E   ++D+  L G  L  E +  L   Q +G
Sbjct: 297 ----YLDTETQVPAEDLPFEFFMNRFRLVEPCPIEDYPALTGVELTKEYQDALDDAQAKG 352

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIA 391
            ++ +  +  + T +G   L+++++
Sbjct: 353 LLD-ITDTHWQVTAKGRRYLNTLLS 376


>gi|167036140|ref|YP_001671371.1| coproporphyrinogen III oxidase [Pseudomonas putida GB-1]
 gi|166862628|gb|ABZ01036.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           putida GB-1]
          Length = 391

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 214/379 (56%), Gaps = 16/379 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFFG
Sbjct: 18  PLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    + ++EIT+EANP + E + F+ YR+ G+NR+S+GV
Sbjct: 78  GGTPSLFSANALGRLLRGVEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIGV 137

Query: 138 QSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+ 
Sbjct: 138 QSFQPAKLEALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAID 197

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S +
Sbjct: 198 LGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMTEHGYRQYEVSAY 253

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR--KNGH 313
           +  G  + HNLNYWR+GD+IGIG GAH ++     R+  + + + P+ +L + +  K G 
Sbjct: 254 AQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLAKPFKAG- 312

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERV 371
               ++ L  ++   EFLM  LRL +G+  + +    G  L+   E  R  +++G ++ V
Sbjct: 313 ----EKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLEQLREARRAAEQKGLLQ-V 367

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +  RL  T RG   L+ ++
Sbjct: 368 EPDRLVATPRGQLFLNDLL 386


>gi|47215409|emb|CAG01106.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 412

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/325 (36%), Positives = 201/325 (61%), Gaps = 6/325 (1%)

Query: 23  VHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPS 82
           + WP+C+++C YC+FN ++ R    +    +    E + + +L+    I+S+FFGGGTPS
Sbjct: 1   LQWPYCLRRCTYCNFNKYISREN-NESIMAECLQKEAESLLKLSQVSCITSVFFGGGTPS 59

Query: 83  LIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEE 142
           L  P  IA +L+ ++++ +++ + E+T+E NP+ V  +  + Y++AGVNR S+GVQSL++
Sbjct: 60  LAHPSTIAALLETVSRHASLTGDAEVTLEVNPTPVGTSKLEDYQQAGVNRFSIGVQSLQD 119

Query: 143 QSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAVDH 201
             L+ LGR+H + +A+  +  AR + P R+S D+++  PKQ++  WE EL   L    DH
Sbjct: 120 DDLKLLGRDHTSRQALQTLDKARRLCPGRVSVDVLFGRPKQSVESWEEELSELLGVCDDH 179

Query: 202 LSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGA 261
           +SLYQLT+E+GT  ++  + G++ LP+E V  ++Y   ++I    G   YE+SN +   A
Sbjct: 180 VSLYQLTLERGTQLFRQVEGGEVTLPAEEVTAEMYERARAILHRRGFLQYEVSNFARNNA 239

Query: 262 ESLHNLNYWRYGDYIGIGPGAHSRVKVGSH----RVAISIEKHPESWLKMVRKNGHAVVE 317
            S HN++YW+   YIG+GPGAH R  +G+     R A +    P++W++ V++ GH    
Sbjct: 240 VSHHNMSYWQGRQYIGVGPGAHGRFVLGAQGGAVREARTQTLEPDAWIREVQQRGHGTRR 299

Query: 318 KEFLSSEQQADEFLMMGLRLREGIS 342
           +  L   +  +E L MG+R  EGIS
Sbjct: 300 RIQLDHLELLEEVLAMGMRTTEGIS 324


>gi|257092564|ref|YP_003166205.1| coproporphyrinogen III oxidase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045088|gb|ACV34276.1| oxygen-independent coproporphyrinogen III oxidase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 417

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/399 (36%), Positives = 218/399 (54%), Gaps = 21/399 (5%)

Query: 5   SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHV---------RRYKVGQENFIQSF 55
           SA  N +  +    L +YVH P+CV+KCPYCDFNSH          R+  + + +++ + 
Sbjct: 19  SAAGNPVEFRNPPPLALYVHVPWCVQKCPYCDFNSHALPVGSSIGQRQTAIPESDYLAAL 78

Query: 56  LTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPS 115
           + +++    L   R + S+F GGGTPSL+  + +  +L  +     +  N EIT+EANP 
Sbjct: 79  IADLESALPLVWGRRVDSVFIGGGTPSLLSGEGVDELLAAVRSRLPLLPNAEITLEANPG 138

Query: 116 SVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDL 175
           +VE   F  +R AGVNR+SLG+QS   + L  LGR H+  +A  AI +A + F   + DL
Sbjct: 139 TVEAGKFAAFRAAGVNRLSLGIQSFNSRHLTALGRIHDDRDARLAIGIAASHFDNFNLDL 198

Query: 176 IYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDL 235
           +Y LP QT+ +   ++  AL+ A  HLS YQLTIE  T F          LP  +   D+
Sbjct: 199 MYGLPGQTLAEALADVDAALACAPPHLSCYQLTIEANTAFAARPP----ALPDPDTCADM 254

Query: 236 YNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAI 295
            +  ++  +A G   YEIS  +  G E  HNLNYW++GDY+GIG GAH ++ +   RV  
Sbjct: 255 QDAIETKLAAAGYRHYEISAFARAGQECRHNLNYWQFGDYLGIGAGAHGKLTL-HDRVQR 313

Query: 296 SIE-KHPESWLKMVRKNGHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDWEMLAGRN 353
            +  K PE +L  V       V++EF ++  +   EF+M  LRL EG +   +EM     
Sbjct: 314 QMRWKRPEQYLAKVAAG--TPVQQEFTVAPAELPCEFMMNALRLVEGFAAPLFEMRTALP 371

Query: 354 L-DIECE-RNLQRQGFIERVQFSRLRCTQRGMTMLDSVI 390
           L  IE + R  +R G ++R Q  R+  ++RG   L+ ++
Sbjct: 372 LISIESQLRQAERDGLLQR-QGQRIAPSERGRRFLNQLV 409


>gi|327482669|gb|AEA85979.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri DSM 4166]
          Length = 392

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/399 (35%), Positives = 221/399 (55%), Gaps = 25/399 (6%)

Query: 4   LSAYENNMTGQGS---NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           ++A     TGQG      L  YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++
Sbjct: 2   IAASPAPATGQGRFELPPLAAYVHIPWCVRKCPYCDFNSHTAGPELPEEAYVAALLADLR 61

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
              +    R +SSIFFGGGTPSL   + +A I++G+      + ++EIT+EANP + E  
Sbjct: 62  ADLEHVQGRRLSSIFFGGGTPSLFSARALAAIVEGLEHLVGFADDIEITLEANPGTFEQA 121

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYAL 179
            F+ YR+ G++R+S+GVQS +   L+ LGR H+  EAI A  +AR   F   + DL++ L
Sbjct: 122 KFRDYRQLGIDRLSIGVQSFQAAKLKALGRIHDGDEAIRAADMARAAGFENFNLDLMHGL 181

Query: 180 PKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLT 239
           P Q++     +L+ A++    HLS YQLT+E  TLF+         LP +++  D+    
Sbjct: 182 PDQSLEDALSDLRTAIAQQPTHLSWYQLTLEPNTLFWSQPPQ----LPEDDILWDIQEAG 237

Query: 240 QSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEK 299
           Q++   HG   YE S ++  G ++ HNLNYW +GD++GIG GAH+++     R+      
Sbjct: 238 QALLGEHGYRQYETSAYAQPGRQARHNLNYWTFGDFLGIGAGAHAKLSHADGRIL----- 292

Query: 300 HPESWLKMVRKNGHAVVEKEFLSSEQQ--AD----EFLMMGLRLREGISVKDWEMLAGRN 353
              SW   + K+ +    K F + E+Q  AD    EFLM  LRL +G+    +    G  
Sbjct: 293 --RSWKTRLPKD-YLDPGKAFRAGEKQLTADELPFEFLMNVLRLTDGVPAVLFTQRTGLA 349

Query: 354 LD--IECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVI 390
           LD   +  RN + +G +     +RL  T +G   L+ ++
Sbjct: 350 LDAIAKPRRNAEARGLLSN-DPARLVATPKGQLFLNDLL 387


>gi|145630358|ref|ZP_01786139.1| coproporphyrinogen III oxidase [Haemophilus influenzae R3021]
 gi|144984093|gb|EDJ91530.1| coproporphyrinogen III oxidase [Haemophilus influenzae R3021]
          Length = 383

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 201/340 (59%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +A G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTAAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +S   +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVSEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|293391741|ref|ZP_06636075.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952275|gb|EFE02394.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 389

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 202/344 (58%), Gaps = 17/344 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH ++  + +++++Q  L ++       ++    R + S
Sbjct: 13  PLSLYVHIPWCVQKCPYCDFNSHAQKGAIPEQDYVQHLLADLTADLARYQESVQQRPLHS 72

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL     IA +L  I +    + N+EIT+E NP +VE   F+GY +AGVNRI
Sbjct: 73  IFIGGGTPSLFSSDTIAYLLAQIEQRIPFAPNIEITLETNPGTVEAARFRGYVQAGVNRI 132

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQ 192
           S+G+QS  ++ L+ LGR HNA EA +A+  A     R  + DL++ LP QT+ +   +L+
Sbjct: 133 SMGIQSFSDEKLQKLGRIHNAEEAKSAVGFAGVSHLRSFNLDLMHGLPNQTLNEALDDLR 192

Query: 193 RALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           +A++ A  HLS YQLTIE  T+F Y+       +LP ++   D++     + +A G   Y
Sbjct: 193 QAIALAPPHLSWYQLTIEPNTMFAYR-----PPMLPDDDELWDIFEQGHQLLTAAGYQQY 247

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRK 310
           E S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +++    
Sbjct: 248 ETSAYAKAGFQCQHNLNYWRFGDYLAIGCGAHGKLSFPNGNILRYSKTKHPKGYMR---- 303

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            G  + E+  +S+E +  EF M   RL E +   D+E L G  L
Sbjct: 304 -GEYLYEERLVSAEDRPFEFFMNRFRLLEPVPKSDFEQLTGLPL 346


>gi|254468648|ref|ZP_05082054.1| putative oxygen-independent coproporphyrinogen III oxidase [beta
           proteobacterium KB13]
 gi|207087458|gb|EDZ64741.1| putative oxygen-independent coproporphyrinogen III oxidase [beta
           proteobacterium KB13]
          Length = 381

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 217/381 (56%), Gaps = 12/381 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSH---VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           S+GVYVH P+C+ KCPYCDFNSH     + +  +E ++ + + E  + + L   R I+SI
Sbjct: 7   SVGVYVHLPWCIHKCPYCDFNSHEASQEKVRSLEEEYVDTLIEEFNFYQDLIKERIITSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSLI P+     +  I KN+ +S   EIT+EANP ++++  FQ Y   G+NR+S
Sbjct: 67  FFGGGTPSLISPKLFEKFITAIHKNFDLSK-TEITLEANPGTIDIKYFQSYADLGINRVS 125

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LG+QS  +  L+ L R H++ EA  AI + +  F   + DL++ LP Q++ +   ++  A
Sbjct: 126 LGIQSFNDNHLQSLERIHSSEEAKQAIVVVKKYFKNFNLDLMFGLPNQSLAELTEDIDTA 185

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLT-QSITSAHGLHAYEI 253
           +S+  +HLS Y LTIE  T F+K   +    +PS++ A ++ +L  + + ++H  H YE 
Sbjct: 186 ISFNPNHLSFYHLTIEPQTRFFKSKPE----IPSDDDAYEMLSLVLKQLKNSHFDH-YET 240

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S  +    +  HNLNYW +GDY+GIG GAHS++   +    +   K+P+ ++  V K   
Sbjct: 241 SAFAQPDHQCRHNLNYWTFGDYLGIGAGAHSKLTHENEIFRMDNTKNPKQYITEVAKQN- 299

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERNLQRQGFIERVQ 372
               K  +  +    EFLM  LRL  G + + +    G +L D++ + +   Q  +    
Sbjct: 300 FFPNKTLIPQQDLPFEFLMNALRLTHGFTKETYSQRTGLSLDDVKSKLHPSFQQDLLYED 359

Query: 373 FSRLRCTQRGMTMLDSVIANL 393
              L+ T++G+  L+ ++ NL
Sbjct: 360 HEILKPTEKGVLFLNEILHNL 380


>gi|262147277|ref|ZP_06028076.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio cholerae
           INDRE 91/1]
 gi|262031271|gb|EEY49886.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio cholerae
           INDRE 91/1]
          Length = 375

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 188/335 (56%), Gaps = 11/335 (3%)

Query: 29  VKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISSIFFGGGTPSLI 84
           ++KCPYCDFNSH ++ ++ ++ ++ + L ++       QL G PR + SIF GGGTPSLI
Sbjct: 1   MQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLHSIFIGGGTPSLI 60

Query: 85  EPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQS 144
             + IA +L G+A+       +EIT+EANP ++E   F GYR AGV RIS+GVQS E + 
Sbjct: 61  SAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTRISIGVQSFEPEK 120

Query: 145 LRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
           L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L +A++    HLS
Sbjct: 121 LARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADLDQAIALNPPHLS 180

Query: 204 LYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAES 263
            YQLTIE  TLFY         LP E+   D++ L     S  G   YEIS +S  G + 
Sbjct: 181 WYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQYEISGYSKPGYQC 236

Query: 264 LHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVVEKEFLS 322
            HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +     A ++ E L 
Sbjct: 237 QHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNLAKAYLDSEQLV 296

Query: 323 SEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
           ++Q    EF M   RL E     D+    G  +D+
Sbjct: 297 ADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDV 331


>gi|312883843|ref|ZP_07743560.1| coproporphyrinogen III oxidase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368301|gb|EFP95836.1| coproporphyrinogen III oxidase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 389

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 196/349 (56%), Gaps = 21/349 (6%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWM----RQLTGPRSISSI 74
           L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L +++      R    PR + SI
Sbjct: 7   LSLYVHIPWCVQKCPYCDFNSHTLKAEIPEDEYIAALLQDLRDDLLRYRLNDSPRVLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSLI P+ IA +L+GI +  +   ++EIT+EANP ++E   F GY+KAGV RIS
Sbjct: 67  FIGGGTPSLISPRGIAALLNGIEQQISFQPDIEITMEANPGTIEAERFAGYQKAGVTRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQR 193
           +GVQS E   L  LGR H   EAI A  LA  I     + DL++ LP QT+ Q   +L +
Sbjct: 127 IGVQSFEAAKLSRLGRIHGQEEAINAARLAHKIGLKSFNLDLMHGLPDQTIEQALADLDQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A+  +  HLS YQLTIE  TLFY         LP ++   D++ +     +  G   YE 
Sbjct: 187 AIELSPPHLSWYQLTIEPNTLFYYKQPQ----LPDDDDLWDIFEIGHQKLTEAGYVQYET 242

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNG 312
           S +S    +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP+ +L       
Sbjct: 243 SGYSKPEYQCQHNLNYWRFGDYLGIGCGAHGKLSFSDGRIIRTTKIKHPKGYLAAFDN-- 300

Query: 313 HAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLD 355
              + K +LSSE   +      EF M   RL E     D+    G +L+
Sbjct: 301 ---MVKPYLSSEHNVEDAERPFEFFMNRFRLTEACPKNDFISTTGLSLN 346


>gi|269838405|ref|YP_003320633.1| oxygen-independent coproporphyrinogen III oxidase [Sphaerobacter
           thermophilus DSM 20745]
 gi|269787668|gb|ACZ39811.1| oxygen-independent coproporphyrinogen III oxidase [Sphaerobacter
           thermophilus DSM 20745]
          Length = 393

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/383 (36%), Positives = 210/383 (54%), Gaps = 14/383 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            LGVY+H PFC + CPYCDFN++ R+  +  E ++++ + EM       GPR   SIFFG
Sbjct: 10  PLGVYIHIPFCTRICPYCDFNTYARQEHLIPE-YVEALIGEMDLTLAAIGPRPAQSIFFG 68

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D + + + +  + E+++EANP +++     G+ +AGVNRISLGV
Sbjct: 69  GGTPSLLPPELVARLIDAVRERFPLPDDAEVSLEANPETIDAATLDGFLQAGVNRISLGV 128

Query: 138 QSLEEQSLRFLGRNH--NASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           Q+ + + L+ LGR H  +  E   A   A  +    S D I+  P QTM +WE +L   L
Sbjct: 129 QTQQARGLKVLGRAHKPDVPERALAAARAAGV-DNFSVDFIFGWPNQTMAEWEDDLDSIL 187

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +  DHLSLY L +E GT + +  + G L +P E+   D+Y       +A G H YEISN
Sbjct: 188 RWQPDHLSLYSLIVEPGTPYERAVQRGILTVPDEDTTADMYERALDRLAAAGWHHYEISN 247

Query: 256 HSFLGA-ESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            +      S HNL YWR G Y+G+G GAH+ +      V  S  + P  ++  VR+    
Sbjct: 248 WARTPEHRSRHNLLYWRNGHYLGLGAGAHAHLD----NVRSSNIRLPAKYIAAVREGRLP 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRL-REGISVKDWEMLAGRNLDIECER---NLQRQGFIER 370
           + E+E L       E +M+GLRL  EG+S   +    GR L+    R   +L   G +  
Sbjct: 304 IDEREELDETTAMAETMMLGLRLPEEGVSAAAFAARHGRELEEIYGRELTDLTDAGLL-Y 362

Query: 371 VQFSRLRCTQRGMTMLDSVIANL 393
              + +R T+RG+ + + V A  
Sbjct: 363 WDGAHVRLTRRGLLLANEVAARF 385


>gi|192362341|ref|YP_001980647.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Cellvibrio japonicus Ueda107]
 gi|190688506|gb|ACE86184.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Cellvibrio japonicus Ueda107]
          Length = 393

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/387 (36%), Positives = 207/387 (53%), Gaps = 20/387 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+C++KCPYCDFNSH     + + ++I +   ++   + L   R I+SIFFGG
Sbjct: 8   LALYIHVPWCIRKCPYCDFNSHQANNDIPEADYIAALRQDLACDQSLAQGRKITSIFFGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  Q I  IL    +      ++EIT+EANP + E   F G+R AGVNR+S+G+Q
Sbjct: 68  GTPSLLSAQAIGQILVDAEQLIGFEPHIEITLEANPGTFEQEKFSGFRAAGVNRLSIGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S  +Q L  LGR H   EA+ A+++AR   F  ++ DL++ LP Q++   + +LQ+A+  
Sbjct: 128 SFNDQQLHLLGRVHGRDEALRAVNVARKAGFDNINLDLMHGLPGQSVGDAQADLQQAIEL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +HLS YQLTIE+ T FY        VLP E +  D+ +  Q + +A G   YEIS ++
Sbjct: 188 EPEHLSWYQLTIEQNTAFYSAPP----VLPEEEILADIQDAGQLLLAAAGYEHYEISAYA 243

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRK----- 310
                S HNLNYW +GDY+GIG GAH +V +   +  + + K   P+ +L          
Sbjct: 244 RAKQFSRHNLNYWEFGDYLGIGAGAHGKVTLPEQQNILRLWKTRLPKHYLDAATSARIST 303

Query: 311 --NGHAVV---EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQ 363
              GH        + L  E    EF+M  LRL  G+  + +    G +      C   L 
Sbjct: 304 NLQGHQNPFGGGSDLLGEESLPLEFMMNALRLHRGVPEQYFAQRTGLDFSAIASCWDELA 363

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVI 390
           R+  +E      LR T  G   L+ V+
Sbjct: 364 RKKLVELAD-GALRPTPLGRRFLNRVL 389


>gi|331005485|ref|ZP_08328863.1| coproporphyrinogen III oxidase [gamma proteobacterium IMCC1989]
 gi|330420677|gb|EGG94965.1| coproporphyrinogen III oxidase [gamma proteobacterium IMCC1989]
          Length = 399

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 201/343 (58%), Gaps = 15/343 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYK---VGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           L +Y+H P+CV+KCPYCDFNSH    K   + + +++++   ++Q   Q T  R +SSIF
Sbjct: 9   LSLYIHIPWCVQKCPYCDFNSHQAEQKNNTLNELDYVETLKNDLQLESQFTYGRKLSSIF 68

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPS+    +IA ILD   K      ++EIT+EANP + E   F G+  AGVNR+S+
Sbjct: 69  FGGGTPSIFSAHSIAAILDHAKKIIGFEDDIEITLEANPGTFEQEKFAGFYAAGVNRLSI 128

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQS  E+ L+ LGR HN+ EA  AI +A+   F  ++ D+++ LP+Q++     +LQ+A
Sbjct: 129 GVQSFNEKHLQTLGRIHNSDEAKRAISIAKKAGFSNINIDIMHGLPQQSVDDAMKDLQQA 188

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +  +  H+S YQLTIE  T FY+        LP++++  D+      + + +G   YEIS
Sbjct: 189 IDCSPQHISWYQLTIEANTAFYRQPP----TLPNDDILADIQERGSLLLTDNGFAQYEIS 244

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRKNG 312
             S     SLHNLNYW++GDY+G+G GAH ++   S+   I  +K   P+ +L    KN 
Sbjct: 245 AFSKNNQRSLHNLNYWQFGDYLGVGAGAHGKITDISNGRIIRRQKTRLPDHYL----KNA 300

Query: 313 HAVVEKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNL 354
            A   K+   +  + + EF+M  LRL EG+    +E   G  L
Sbjct: 301 KAPKTKQHTVATHELNIEFMMNALRLIEGVPSDFFEKRTGLAL 343


>gi|187478425|ref|YP_786449.1| coproporphyrinogen III oxidase [Bordetella avium 197N]
 gi|115423011|emb|CAJ49541.1| putative oxygen-independent coprophorphyrinogen III oxidasee
           [Bordetella avium 197N]
          Length = 405

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/374 (33%), Positives = 213/374 (56%), Gaps = 7/374 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           L VYVH P+CV+KCPYCDFNSH    + + +  ++ +   +++    L   R + S+F G
Sbjct: 31  LSVYVHVPWCVRKCPYCDFNSHAMPGQDIPERAYLDALRADLEQAVPLVWGRQVISVFIG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +L  +     +  + EIT+EANP + E + F  Y  +GV R SLG+
Sbjct: 91  GGTPSLLSAAGLDELLAMLRACLNLLPDAEITMEANPGTAEASRFLDYAASGVTRFSLGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS ++  L  LGR H++++A AAI +A+    R++ D+++ALP Q +     +L+ ALS+
Sbjct: 151 QSFDDAQLHKLGRIHDSAQARAAIEMAQRAVSRVNLDVMFALPGQDINACVADLREALSF 210

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++  +  GL  YE+S ++
Sbjct: 211 GTEHLSLYHLTLEPNTVFAKYPPE----LPDDDDSAAMQDAVEATLADAGLARYEVSAYA 266

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL-KMVRKNGHAVV 316
             GA   HN+NYW +GDY+G+GPGAH ++      V  +  ++PESW+ + + ++G  V 
Sbjct: 267 RQGARCKHNVNYWEFGDYLGLGPGAHGKLSFHDRIVREARHRNPESWMQRAMARDGSHVA 326

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECERNLQRQGFIERVQFSR 375
           E   +  ++   EF++  LRL++G++   +    G +L  I  + +   Q  +     +R
Sbjct: 327 ENRQVGPDELPFEFMLNALRLKDGVAASSFSERTGLSLAAIAHQLDAASQRGLLDADPTR 386

Query: 376 LRCTQRGMTMLDSV 389
           LR T  G   L+ +
Sbjct: 387 LRATALGWRFLNDL 400


>gi|294341382|emb|CAZ89799.1| putative Coproporphyrinogen III oxidase [Thiomonas sp. 3As]
          Length = 400

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/339 (38%), Positives = 199/339 (58%), Gaps = 12/339 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRY--KVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
            L +YVH P+C+K+CPYCDFNSH  R    + ++ ++ +   ++     L   R + S+F
Sbjct: 17  PLSLYVHLPWCLKQCPYCDFNSHEWRAGGSIPEQAYLAALRADLDAALPLVWGRRVISVF 76

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P+ I  ++  +     + ++ EIT+EANP + E + F  + +AGVNR+S+
Sbjct: 77  IGGGTPSLFSPEAIDQLITDVRARLPLVADAEITLEANPGTFERDRFAAFAQAGVNRLSI 136

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS ++  LR LGR H+A +A  A+  A   F   + DL++ALP+Q M   + ++  AL
Sbjct: 137 GVQSFDDDRLRALGRVHDARQAHDAVAEAARHFASFNLDLMFALPQQDMAGCKADVHEAL 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++   HLSLYQLT+E  TLF +        LP +++A D+ +    +  A GL  YE+S 
Sbjct: 197 AHQPPHLSLYQLTLEPNTLFARQPPK----LPDDDLAADMQHAVADLAEAAGLQRYEVSA 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
           ++  G    HNLNYW++GDYIGIG GAHS++   +HRV      +HP+ +++     G A
Sbjct: 253 YAAPGHRCRHNLNYWQFGDYIGIGAGAHSKLTF-AHRVVRQTRWRHPQRYMEQA-AQGLA 310

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN 353
           V  +  +S      EF++  LRLREG+ V   E+ A R 
Sbjct: 311 VETEVEVSRSDLPFEFMLNALRLREGVRV---ELFAQRT 346


>gi|37525144|ref|NP_928488.1| coproporphyrinogen III oxidase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784570|emb|CAE13470.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 376

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/377 (35%), Positives = 215/377 (57%), Gaps = 16/377 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L +++    +   R +++IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLKTDLPMVNGREVTTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  Q +  +LDG+     VS   EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSSQAMQQLLDGVRALLPVSPQAEITMEANPGTVEADRFSGYQQAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L  LGR H   EA  A HLA ++  R  + DL++ LP Q++ +   +L++A+  
Sbjct: 127 SFSPDKLVRLGRIHGPDEAKRAAHLAASLGLRSFNLDLMHGLPNQSLDEALDDLRQAIEL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  T F         VLP ++   D+++    + +A G   YE S ++
Sbjct: 187 SPPHLSWYQLTIEPNTSFGSRPP----VLPDDDALWDIFSQGHQLLTAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFEDGRILRTVKTKHPRGYMQ-----GRYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERVQF 373
           ++  + +E +  EF M   RL E +  +D+    G    ++  + ++ L   G++     
Sbjct: 298 KQHQVENEDRPFEFFMNRFRLLEAMPKQDFSDFTGLSETSIRTQIKQALA-AGYLSETA- 355

Query: 374 SRLRCTQRGMTMLDSVI 390
           +  + TQ+G   L+S++
Sbjct: 356 THWQITQKGKLFLNSLL 372


>gi|53720178|ref|YP_109164.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei K96243]
 gi|53726004|ref|YP_103674.1| coproporphyrinogen III oxidase [Burkholderia mallei ATCC 23344]
 gi|67643941|ref|ZP_00442684.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei GB8 horse 4]
 gi|121598921|ref|YP_992154.1| coproporphyrinogen III oxidase [Burkholderia mallei SAVP1]
 gi|124383729|ref|YP_001028599.1| coproporphyrinogen III oxidase [Burkholderia mallei NCTC 10229]
 gi|126448733|ref|YP_001081502.1| coproporphyrinogen III oxidase [Burkholderia mallei NCTC 10247]
 gi|166998296|ref|ZP_02264156.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei PRL-20]
 gi|167739727|ref|ZP_02412501.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 14]
 gi|167816930|ref|ZP_02448610.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 91]
 gi|167912077|ref|ZP_02499168.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 112]
 gi|254175530|ref|ZP_04882190.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei ATCC 10399]
 gi|254196044|ref|ZP_04902469.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei S13]
 gi|254202372|ref|ZP_04908735.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei FMH]
 gi|254207706|ref|ZP_04914056.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei JHU]
 gi|254356394|ref|ZP_04972670.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei 2002721280]
 gi|52210592|emb|CAH36575.1| putative coproporphyrinogen III oxidase family protein
           [Burkholderia pseudomallei K96243]
 gi|52429427|gb|AAU50020.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Burkholderia mallei ATCC 23344]
 gi|121227731|gb|ABM50249.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei SAVP1]
 gi|124291749|gb|ABN01018.1| coproporphyrinogen dehydrogenase [Burkholderia mallei NCTC 10229]
 gi|126241603|gb|ABO04696.1| coproporphyrinogen dehydrogenase [Burkholderia mallei NCTC 10247]
 gi|147746619|gb|EDK53696.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei FMH]
 gi|147751600|gb|EDK58667.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei JHU]
 gi|148025391|gb|EDK83545.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei 2002721280]
 gi|160696574|gb|EDP86544.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei ATCC 10399]
 gi|169652788|gb|EDS85481.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei S13]
 gi|238525410|gb|EEP88838.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei GB8 horse 4]
 gi|243065371|gb|EES47557.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei PRL-20]
          Length = 405

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 198/341 (58%), Gaps = 11/341 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISS 73
            L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + +
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSH--EWKDGGALPERDYLDALRADLEHALPLVWGRQVHT 85

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+
Sbjct: 86  VFIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRL 145

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ 
Sbjct: 146 SIGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLET 205

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+
Sbjct: 206 ALAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEV 261

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++     S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G 
Sbjct: 262 SAYAKPHRRSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGT 320

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            V E+  +       EF++  LRL +G+    +E   G +L
Sbjct: 321 PVQEEREVGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSL 361


>gi|197284233|ref|YP_002150105.1| coproporphyrinogen III oxidase [Proteus mirabilis HI4320]
 gi|227357864|ref|ZP_03842212.1| oxygen-independent coproporphyrinogen III oxidase [Proteus
           mirabilis ATCC 29906]
 gi|194681720|emb|CAR40866.1| putative oxygen-independent coproporphyrinogen III oxidase [Proteus
           mirabilis HI4320]
 gi|227161974|gb|EEI46992.1| oxygen-independent coproporphyrinogen III oxidase [Proteus
           mirabilis ATCC 29906]
          Length = 376

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 125/335 (37%), Positives = 199/335 (59%), Gaps = 11/335 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  + ++Q  L ++       G R + +IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHTLKGEVPHQEYVQHLLNDLDADLTHVGSREVQTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  +++A +L G+ +   V+ + EIT+EANP +VE   F G+++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAESMADLLYGVKERIAVAPDAEITMEANPGTVEAERFAGFQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L  LGR H+A EA  A  LA+ +  R  + DL++ LP Q+++Q   +LQ+A++ 
Sbjct: 127 SFGNDKLIRLGRIHDADEAKNAARLAKELGLRSFNLDLMHGLPDQSLSQALSDLQQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  T F          LP +++  D+++    + +A G   YE S + 
Sbjct: 187 SPPHLSWYQLTIEPNTQFGSRPPK----LPDDDMLWDIFSEGDKLLTAAGYQQYETSAYC 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ KHP+ ++      G  + 
Sbjct: 243 KPGFQCQHNLNYWRFGDYLGIGCGAHGKISFADGRIMRTVKTKHPKGFMA-----GRYLH 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           ++ ++ ++ +  EF M   RL E    +D+    G
Sbjct: 298 QQNWVDNDDRPFEFFMNRFRLLEAFPRQDFSDYTG 332


>gi|104779591|ref|YP_606089.1| coproporphyrinogen III oxidase [Pseudomonas entomophila L48]
 gi|95108578|emb|CAK13272.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas entomophila L48]
          Length = 386

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 215/378 (56%), Gaps = 14/378 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLTGPRSISSIFF 76
            L +Y+H P+CV+KCPYCDFNSH     + ++ +I + L ++ Q M  + G R IS+IFF
Sbjct: 13  PLSLYIHIPWCVRKCPYCDFNSHQAGPSLPEDEYIDALLADLDQEMPAVQG-RPISTIFF 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    + ++EIT+EANP + E   F+ YR+ G+NR+S+G
Sbjct: 72  GGGTPSLFSADALDRLLRGVEQRIPFAPDIEITLEANPGTFEQEKFKAYRQTGINRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 132 VQSFQPAKLERLGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAI 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 192 ELAPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHA 314
           ++     + HNLNYWR+GD+IGIG GAH ++     R+  + + + P+ +L   +   + 
Sbjct: 248 YAQADRAARHNLNYWRFGDFIGIGAGAHGKLSFPDGRILRTWKTRLPKDYLNPSKP--YK 305

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
             EK  L +++   EFLM  LRL +G+  + + +  G  L    E  R  +++G + RV+
Sbjct: 306 AGEK-LLPADELPFEFLMNALRLTDGVEAELFSLRTGLPLAQLTEARREAEQKGLL-RVE 363

Query: 373 FSRLRCTQRGMTMLDSVI 390
             RL  T RG   L+ ++
Sbjct: 364 PDRLAATPRGQLFLNDLL 381


>gi|109899593|ref|YP_662848.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudoalteromonas atlantica T6c]
 gi|109701874|gb|ABG41794.1| coproporphyrinogen III oxidase, anaerobic [Pseudoalteromonas
           atlantica T6c]
          Length = 396

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/355 (36%), Positives = 203/355 (57%), Gaps = 14/355 (3%)

Query: 8   ENNMTGQGSNSL---GVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMR 63
           E N  G+ + +L    +Y+H P+CV+KCPYCDFNSH ++   + +  ++   L ++    
Sbjct: 6   EMNDAGETNTTLPPVALYIHIPWCVQKCPYCDFNSHGQKQDSLPEAEYVSHLLDDLAQDA 65

Query: 64  QLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQ 123
            L G R + SIF GGGTPSL  P  I  +L G+ +   ++ + EIT+EANP +VE   F 
Sbjct: 66  NLIGDRPVHSIFIGGGTPSLFSPDAIGRLLTGVRERVNLAVDAEITLEANPGTVESERFN 125

Query: 124 GYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQ 182
           G+ +AGVNRIS+GVQS +++ L  LGR H+  +A+ A   ARN      + DL++ LP+Q
Sbjct: 126 GFAQAGVNRISIGVQSFQQEKLERLGRIHDEQQALNAAGYARNAGLNSFNLDLMHGLPEQ 185

Query: 183 TMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI 242
           ++     +L++ ++    HLS YQLTIE  T F+         LP +++  D+      I
Sbjct: 186 SIDDALFDLRQGIAQQPPHLSWYQLTIEPNTQFHSKPP----TLPEDDILWDIQEQGHDI 241

Query: 243 TSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV-GSHRVAISIE-KH 300
            +A G   YEIS +S  G +  HNLNYWR+GDY+GIG GAH ++ +  S ++  +++ KH
Sbjct: 242 LTAAGYEQYEISGYSLAGQQCQHNLNYWRFGDYLGIGCGAHGKITLKDSGQILRTVKVKH 301

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
           P+ ++ + R   H   ++  +  E+   EF M  LRL E    +D+    G   D
Sbjct: 302 PKGYMDLTRSYMH---QQHTVQDEELPFEFFMNRLRLLEPCPKQDFSAFTGLVFD 353


>gi|161525575|ref|YP_001580587.1| coproporphyrinogen III oxidase [Burkholderia multivorans ATCC
           17616]
 gi|189349697|ref|YP_001945325.1| coproporphyrinogen III oxidase [Burkholderia multivorans ATCC
           17616]
 gi|160343004|gb|ABX16090.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           multivorans ATCC 17616]
 gi|189333719|dbj|BAG42789.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           multivorans ATCC 17616]
          Length = 404

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 210/376 (55%), Gaps = 11/376 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEHALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS +E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT  +   +++ ALS
Sbjct: 148 IQSFDEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTFDECRADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        +P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----AVPDDDASADMQEWIHARTAEAGYERYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +       HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHRCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEHALA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQF 373
           E+  + +     EF++  LRL EG  V  +    G  +    E  LQ   R+G I R  F
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFVERTGLPIST-IEPALQEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSV 389
           +R+  T  G   L+ +
Sbjct: 381 TRIAPTPLGQRFLNDL 396


>gi|255021076|ref|ZP_05293129.1| hypothetical protein ACA_2803 [Acidithiobacillus caldus ATCC 51756]
 gi|254969490|gb|EET26999.1| hypothetical protein ACA_2803 [Acidithiobacillus caldus ATCC 51756]
          Length = 399

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 137/371 (36%), Positives = 208/371 (56%), Gaps = 7/371 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           + +L VYVH P+C+ KCPYCDFNS+    +   E+++ + + +++        R + SIF
Sbjct: 7   APALSVYVHLPWCLAKCPYCDFNSYAAP-EFPAEHYVDALIADLERELPRIWGRPVHSIF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P++IA +L  +     +   +E+++EANP + E   F+ +R+AG+ R+SL
Sbjct: 66  LGGGTPSLFPPESIARLLSELRARLRLMPGLEVSLEANPGASEAARFRAFRQAGITRLSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIH-LARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQS ++  L  LGR H+   A+AA+  +    F   + DLI+ALP Q +     +L+RA
Sbjct: 126 GVQSFDDGFLARLGRIHDGRAAMAAVSAILEAGFASWNLDLIFALPGQDLAAALADLERA 185

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L+YA  HLSLYQLT+E GT F +    G   LP E++A D+    +      GL  YEIS
Sbjct: 186 LAYAPPHLSLYQLTLEAGTPFARQAPSG---LPGEDLAADMELALRERLQEAGLARYEIS 242

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEK-HPESWLKMVRKNGH 313
            H+  G E  HN NYWR+GDY+GIG GAH ++ +    +  S +   PES+L        
Sbjct: 243 AHARPGQECWHNRNYWRFGDYVGIGAGAHGKITLPGQGIWRSQKPARPESYLSDALGPAA 302

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-RNLDIECERNLQRQGFIERVQ 372
            +    +++  ++  EFL+  LRL EG S   +E   G   L IE +    R+  +   +
Sbjct: 303 QIGRGHWVAPAERPFEFLLNTLRLLEGFSCAQFEAGTGLPCLQIEPQLRRARKEGLLTFE 362

Query: 373 FSRLRCTQRGM 383
             R R T+ G+
Sbjct: 363 DGRWRPTRFGL 373


>gi|56476730|ref|YP_158319.1| coproporphyrinogen III oxidase [Aromatoleum aromaticum EbN1]
 gi|56312773|emb|CAI07418.1| Oxygen-independent coprophorphyrinogen III oxidase [Aromatoleum
           aromaticum EbN1]
          Length = 407

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 145/381 (38%), Positives = 203/381 (53%), Gaps = 11/381 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQ---ENFIQSFLTEMQWMRQLTGPRSI 71
            S  L +YVH+P+CVKKCPYCDFNSH  R   G+   + +I + L +++        R +
Sbjct: 27  ASPPLALYVHYPWCVKKCPYCDFNSHASRGGPGEIPEQAYIDALLADIETALPQVWGRRV 86

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            S+F GGGTPSL+    +  +L G+     +    EIT+EANP +VE   F+ Y  AGVN
Sbjct: 87  LSVFIGGGTPSLMSAAALDRLLTGVRMLLQLDPLAEITLEANPGTVEAGRFRDYCAAGVN 146

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLG+QS ++  L  LGR H+  EA  AI  A   F R++ DL+YALP+QT  Q   +L
Sbjct: 147 RLSLGIQSFDDAQLVRLGRIHDGREARVAIDTALANFDRVNLDLMYALPEQTPEQALADL 206

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
             AL+    HLS YQLT+E  T F+         LP  + A D+ +  ++     G   Y
Sbjct: 207 DTALATGATHLSCYQLTLEPNTPFHHAPPP----LPDTDTAADMQDAIEARLGGAGFRHY 262

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           E S  +  G E  HNLNYW +GDY+GIG GAH ++      V     KHP  +L    K+
Sbjct: 263 ETSAFARPGEECRHNLNYWTFGDYLGIGAGAHGKLSSFEGIVREMRHKHPGRYLDAA-KS 321

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD-IECERNLQR-QGFIE 369
              V E+  +   +   EF+M  LRL  G+  + +    G  L  IE E    R QG +E
Sbjct: 322 REFVQERRTIGVTELPFEFMMNALRLSGGVPRRLFAERTGLPLAVIEDELKAAREQGLVE 381

Query: 370 RVQFSRLRCTQRGMTMLDSVI 390
            V    +R T+RG   L+ ++
Sbjct: 382 -VTPELIRPTERGRHFLNDLL 401


>gi|167580994|ref|ZP_02373868.1| coproporphyrinogen III oxidase [Burkholderia thailandensis TXDOH]
          Length = 405

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/340 (35%), Positives = 199/340 (58%), Gaps = 11/340 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISSI 74
           L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + ++
Sbjct: 29  LALYVHFPWCVRKCPYCDFNSH--EWKDGGALPEHDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LTFAPPHLSLYHLTLEPNTYFAKFPP----AVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++   K G A
Sbjct: 263 AYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGAA 321

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V E+  +       EF++  LRL +G+    +    G +L
Sbjct: 322 VQEEREVGPRDLPFEFMLNALRLVDGVPTHSFAERTGMSL 361


>gi|329901885|ref|ZP_08272972.1| Radical SAM family enzyme, coproporphyrinogen III oxidase-like
           protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327548977|gb|EGF33594.1| Radical SAM family enzyme, coproporphyrinogen III oxidase-like
           protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 418

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 200/341 (58%), Gaps = 9/341 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSH----VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H+P+CVKKCPYCDFNSH      +    +E ++ +   +++    L   R I +I
Sbjct: 41  LALYIHFPWCVKKCPYCDFNSHEVAGQSQSGFPEEAYLDAVRADLESALPLIWGRKIYTI 100

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  ++  +     +    EIT+EANP + EV  F+ YR +G+NR+S
Sbjct: 101 FIGGGTPSLMSAAGLDRLMSDVRTLLPLDGAAEITMEANPGTFEVEKFRSYRASGINRLS 160

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS   + LR LGR H+  EA  A+ +A + F   + DL+YALP QT+ +   +++ A
Sbjct: 161 IGIQSFNGEHLRALGRIHDHDEARRAVDIAHSTFDNFNLDLMYALPSQTLAEATQDIRTA 220

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L YA  HLSLY LT+E  T+F K        LP ++++ D+ ++  + T A G   YE+S
Sbjct: 221 LGYAPPHLSLYHLTMEPNTVFAKFPP----ALPDDDLSADMQDMIAAETGAAGYGHYEVS 276

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++  G +S HNLNYW++GDY+G+G GAHS++      +  +  K P+S+++ + + G A
Sbjct: 277 AYAQPGRQSRHNLNYWQFGDYLGVGAGAHSKLSFPHRIIRQARFKQPKSYMENMAR-GSA 335

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
           + E+  ++  +   EF++  LRL  G  V  +    G  L+
Sbjct: 336 IQEENEIARGELGFEFMLNTLRLTSGFQVNLFAERTGLGLN 376


>gi|269101810|ref|ZP_06154507.1| coproporphyrinogen III oxidase, oxygen-independent [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161708|gb|EEZ40204.1| coproporphyrinogen III oxidase, oxygen-independent [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 386

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 199/344 (57%), Gaps = 15/344 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT----GPRSISS 73
            L +YVH P+CV+KCPYCDFNSH  + ++ + ++I + L ++           G R + S
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHALKAEIPELDYIDALLDDLSTDLLAYHLEHGERKLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P+ IA +L GI      S ++EIT+EANP +VE   FQ Y++AGVNRI
Sbjct: 66  IFIGGGTPSLISPEEIARLLQGIEARIPFSDDIEITMEANPGTVEAGRFQAYQQAGVNRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+G+QS +++ L+ LGR H A EAI A  LA        + DL++ LP Q++     +L 
Sbjct: 126 SIGIQSFQDEKLKRLGRIHGAQEAITAAKLAAEAGLNSFNIDLMHGLPDQSINDALADLA 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  TLFY         LP ++   D++     + +  G   YE
Sbjct: 186 QAIGLNPPHLSWYQLTIEPNTLFYSQPP----TLPDDDDLWDIFEQGHKMLTYAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  +I+ KHP  +L   +  
Sbjct: 242 ISGYSKPGKQCQHNLNYWRFGDYLGIGCGSHGKISFDDGRIVRTIKVKHPRGYLNPEK-- 299

Query: 312 GHAVVEKE-FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
             A +++E  ++++++  EF M   RL E    +D+    G  L
Sbjct: 300 --AYLDQETIVANDERPFEFFMNRFRLLEACPKQDFVARTGLPL 341


>gi|146284286|ref|YP_001174439.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri A1501]
 gi|145572491|gb|ABP81597.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas stutzeri A1501]
          Length = 392

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 138/394 (35%), Positives = 220/394 (55%), Gaps = 15/394 (3%)

Query: 4   LSAYENNMTGQGS---NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           ++A     TGQG      L  YVH P+CV+KCPYCDFNSH     + +E ++ + L +++
Sbjct: 2   IAASPAPATGQGRFELPPLAAYVHIPWCVRKCPYCDFNSHTAGPALPEEAYVAALLADLR 61

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
              +    R +SSIFFGGGTPSL   + +A I++G+      +  +EIT+EANP + E  
Sbjct: 62  ADLEHVQGRRLSSIFFGGGTPSLFSARALAAIVEGLEHLVGFADGIEITLEANPGTFEQA 121

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYAL 179
            F+ YR+ G+NR+S+GVQS +   L+ LGR H+  EAI A  +AR   F   + DL++ L
Sbjct: 122 KFRDYRQLGINRLSIGVQSFQAAKLKALGRIHDGDEAIRAADMARAAGFENFNLDLMHGL 181

Query: 180 PKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLT 239
           P Q++     +L+ A++    HLS YQLT+E  TLF+         LP +++  D+    
Sbjct: 182 PDQSLEDALSDLRTAIAQQPTHLSWYQLTLEPNTLFWSQPPQ----LPEDDILWDIQEAG 237

Query: 240 QSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE- 298
           Q++   HG   YE S ++  G ++ HNLNYW +GD++GIG GAH+++     R+  S + 
Sbjct: 238 QALLGEHGYRQYETSAYAQPGRQARHNLNYWTFGDFLGIGAGAHAKLSHADGRILRSWKT 297

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--I 356
           + P+ +L   +       EK+ L++++   EFLM  LRL +G+    +    G  LD   
Sbjct: 298 RLPKDYLDPAK--AFRAGEKQ-LTADELPFEFLMNVLRLTDGVPAVLFTQRTGLALDAIA 354

Query: 357 ECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVI 390
           +  R+ + +G +      RL  T +G   L+ ++
Sbjct: 355 KPRRDAEARGLLSN-DPDRLVATPKGQLFLNDLL 387


>gi|221201199|ref|ZP_03574239.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2M]
 gi|221206347|ref|ZP_03579360.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2]
 gi|221213627|ref|ZP_03586601.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD1]
 gi|221166416|gb|EED98888.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD1]
 gi|221173656|gb|EEE06090.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2]
 gi|221179049|gb|EEE11456.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2M]
          Length = 404

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 209/376 (55%), Gaps = 11/376 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEHALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT  +   +++ ALS
Sbjct: 148 IQSFNEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTFDECRADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        +P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----AVPDDDASADMQEWIHARTAEAGYERYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +       HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHRCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFMEQALA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQF 373
           E+  + +     EF++  LRL EG  V  +    G  +    E  LQ   R+G I R  F
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFVERTGLPIST-IEPALQEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSV 389
           +R+  T  G   L+ +
Sbjct: 381 TRIAPTPLGQRFLNDL 396


>gi|50122553|ref|YP_051720.1| coproporphyrinogen III oxidase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49613079|emb|CAG76530.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 379

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 214/378 (56%), Gaps = 16/378 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L ++     L G R++ SIF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLDADLPLAGGRALHSIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GV
Sbjct: 66  GGTPSLLSAEAMQALLDGVRARIPLTPDAEITMEANPGTVEADRFSGYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR H   EA  A  LA  +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFDPQKLTRLGRIHGPEEAKRAAQLATGLKLRSFNLDLMHGLPDQSLDEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF          LP ++   D+Y    ++ SA G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFSSRPP----TLPDDDALWDIYEQGHALLSAAGYEQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++      +  +++ +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGHILRTVKVRHPRGYMQ-----GTYM 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERVQ 372
            ++  ++++ +  EF M   RL E     D+    G    ++  + ++ L  QG++    
Sbjct: 297 DKQHDVANDDRPFEFFMNRFRLLEAAPRADFTAYTGLEEHSIRPQLDQALA-QGYLTETA 355

Query: 373 FSRLRCTQRGMTMLDSVI 390
            +  + T+ G   L+S++
Sbjct: 356 -THWQITEHGKLFLNSLL 372


>gi|253990758|ref|YP_003042114.1| coproporphyrinogen III oxidase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211639089|emb|CAR67701.1| Hypothetical protein yggW [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782208|emb|CAQ85372.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 376

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 125/335 (37%), Positives = 196/335 (58%), Gaps = 11/335 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L +++    +   R +++IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLKTDLPMVKGREVTTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  Q +  +LDG+     VS+  EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSSQGMQQLLDGVRTLLPVSTQAEITMEANPGTVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFSPDKLVRLGRIHGPDEAKRAARLAASLGLRSFNLDLMHGLPNQSLNEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  T F         VLP ++   D+++    + +A G   YE S ++
Sbjct: 187 SPPHLSWYQLTIEPNTRFGSRPP----VLPDDDALWDIFSQGHQLLTAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFEDGRILRTVKTKHPRGYMQ-----GRYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           ++  + +E +  EF M   RL E +  +D+    G
Sbjct: 298 KQNQVENEDRPFEFFMNRFRLLEAMPKQDFSNFTG 332


>gi|90580279|ref|ZP_01236086.1| coproporphyrinogen III oxidase [Vibrio angustum S14]
 gi|90438581|gb|EAS63765.1| coproporphyrinogen III oxidase [Vibrio angustum S14]
          Length = 387

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 196/349 (56%), Gaps = 25/349 (7%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH  +  + + ++I + +    T++   + + G R + S
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHALKTDLPELDYIDALIDDLETDLSAYQLINGARPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P  I  +L  I +    S ++EIT+EANP +VE   F+ Y +AGVNRI
Sbjct: 66  IFIGGGTPSLISPSEIGRLLKAIEQRIPFSDDIEITMEANPGTVEAGRFEAYSQAGVNRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+G+QS + + L  LGR H A EAI A  LA+       + DL++ LP Q++     +L+
Sbjct: 126 SIGIQSFQNEKLERLGRIHGADEAIRAAGLAKKAGLNSFNVDLMHGLPDQSVNDAISDLK 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  TL+Y         LP ++   D++     +    G   YE
Sbjct: 186 QAIALDPPHLSWYQLTIEPNTLYYSKPP----TLPDDDDLWDIFEQGHQLLKEAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH ++     ++  +++ KHP  +L+     
Sbjct: 242 ISGYSKQGKQCQHNLNYWRFGDYLGIGCGAHGKISFADGQIIRTVKVKHPRGYLQ----- 296

Query: 312 GHAVVEKEFLSSEQQ-AD-----EFLMMGLRLREGISVKDWEMLAGRNL 354
                +K +L+ E + AD     EF M   RL E    +D+    G  L
Sbjct: 297 ----ADKPYLTQENKVADGERPFEFFMNRFRLLESCPKQDFVARTGLAL 341


>gi|26991777|ref|NP_747202.1| coproporphyrinogen III oxidase [Pseudomonas putida KT2440]
 gi|24986887|gb|AAN70666.1|AE016710_11 oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas putida KT2440]
          Length = 391

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 211/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFFG
Sbjct: 18  PLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    + ++EIT+EANP + E + F+ YR+ G+NR+S+GV
Sbjct: 78  GGTPSLFSASALGRLLRGVEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIGV 137

Query: 138 QSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+ 
Sbjct: 138 QSFQPAKLEALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAID 197

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S +
Sbjct: 198 LGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSAY 253

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYWR+GD+IGIG GAH ++     R+  + + + P+ +L + +      
Sbjct: 254 AQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLAKP---FR 310

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
             ++ L  ++   EFLM  LRL +G+  + +    G  L    E  R  +++G ++ V+ 
Sbjct: 311 AGEKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLAQLQEARRAAEQKGLLQ-VEP 369

Query: 374 SRLRCTQRGMTMLDSVI 390
            RL  T RG   L+ ++
Sbjct: 370 DRLVATPRGQLFLNDLL 386


>gi|313501077|gb|ADR62443.1| Coproporphyrinogen III oxidase [Pseudomonas putida BIRD-1]
          Length = 388

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 211/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFFG
Sbjct: 15  PLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFFG 74

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    + ++EIT+EANP + E + F+ YR+ G+NR+S+GV
Sbjct: 75  GGTPSLFSASALGRLLRGVEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIGV 134

Query: 138 QSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+ 
Sbjct: 135 QSFQPAKLEALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAID 194

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S +
Sbjct: 195 LGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSAY 250

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYWR+GD+IGIG GAH ++     R+  + + + P+ +L + +      
Sbjct: 251 AQAGRAAQHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLAKP---FR 307

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
             ++ L  ++   EFLM  LRL +G+  + +    G  L    E  R  +++G ++ V+ 
Sbjct: 308 AGEKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLSQLQEARRAAEQKGLLQ-VEP 366

Query: 374 SRLRCTQRGMTMLDSVI 390
            RL  T RG   L+ ++
Sbjct: 367 DRLVATPRGQLFLNDLL 383


>gi|254252977|ref|ZP_04946295.1| Coproporphyrinogen III oxidase [Burkholderia dolosa AUO158]
 gi|124895586|gb|EAY69466.1| Coproporphyrinogen III oxidase [Burkholderia dolosa AUO158]
          Length = 404

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 211/376 (56%), Gaps = 11/376 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  + +++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPESDYLDALRADLEHALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT  +   +++ ALS
Sbjct: 148 IQSFNEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTFDECRADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  TLF K        +P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTLFAKFPP----AVPDDDASADMQEWIHARTAEAGYERYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNRQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPAAFIEHAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERVQF 373
           E+  + +     EF++  LRL +G  V  +    G  +    E  LQ   R+G I R  F
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVDGFPVHSFIERTGLPMST-IEPALQEAERRGLIVR-DF 380

Query: 374 SRLRCTQRGMTMLDSV 389
           +R+  T  G   L+ +
Sbjct: 381 TRIAPTPLGQRFLNDL 396


>gi|332305441|ref|YP_004433292.1| oxygen-independent coproporphyrinogen III oxidase [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172770|gb|AEE22024.1| oxygen-independent coproporphyrinogen III oxidase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 407

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 201/341 (58%), Gaps = 11/341 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSH-VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           + +Y+H P+CV+KCPYCDFNSH  ++  + +  ++   L ++    QL G R++ SIF G
Sbjct: 31  VSLYIHIPWCVQKCPYCDFNSHGQKQATLPEAEYVSHLLDDLAHDAQLIGDRAVHSIFIG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ I  +L G+ +   ++++ EIT+EANP +VE   F+G+ KAGVNRIS+GV
Sbjct: 91  GGTPSLFSPEAIGRLLSGVRQRVNLAADAEITLEANPGTVESERFKGFAKAGVNRISIGV 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +++ L  LGR H+  +A+ A   AR+      + DL++ LP+Q++     +L++ + 
Sbjct: 151 QSFQQEKLERLGRIHDEQQALNAASYARDAGLNSFNLDLMHGLPEQSIEDALFDLRQGID 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  T F+         LP +++  D+      +  A G   YEIS +
Sbjct: 211 QQPPHLSWYQLTIEPNTQFHSKPP----TLPEDDILWDIQEQGHDMLIAAGYEQYEISGY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV-GSHRVAISIE-KHPESWLKMVRKNGHA 314
           S  G +  HNLNYWR+GDY+GIG GAH ++ +  + ++  +++ KHP+ ++ + R   H 
Sbjct: 267 SLAGQQCRHNLNYWRFGDYLGIGCGAHGKITMKDTGQILRTVKVKHPKGYMDLTRPYLH- 325

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
             ++  +  E+   EF M  LRL E    +D+    G  L+
Sbjct: 326 --QQHNVQDEELPFEFFMNRLRLLEPCPKQDFTDFTGLKLE 364


>gi|261868181|ref|YP_003256103.1| coproporphyrinogen III oxidase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413513|gb|ACX82884.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 389

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 202/344 (58%), Gaps = 17/344 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH ++  + +++++Q  L ++       ++    R + S
Sbjct: 13  PLSLYVHIPWCVQKCPYCDFNSHAQKGVIPEQDYVQHLLADLTADLARYQESVQQRPLHS 72

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL  P  IA +L  I ++   + N+EIT+EANP + E   F+GY +AGVNRI
Sbjct: 73  IFIGGGTPSLFSPDTIAYLLAQIEQHIPFAPNIEITLEANPGTAEAARFRGYVQAGVNRI 132

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQ 192
           S+G+QS  ++ L+ LGR HNA EA +A+  A     R  + DL++ LP QT+ +   +L+
Sbjct: 133 SMGIQSFSDEKLQKLGRIHNAEEAKSAVGFAGVSHLRSFNLDLMHGLPNQTLNEALDDLR 192

Query: 193 RALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           +A+  A  HLS YQLTIE  T+F Y+        LP ++   D++     + +A G   Y
Sbjct: 193 QAIVLAPPHLSWYQLTIEPNTMFAYR-----PPTLPDDDELWDIFEQGHQLLTAAGYQQY 247

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRK 310
           E S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +++    
Sbjct: 248 ETSAYAKAGFQCQHNLNYWRFGDYLAIGCGAHGKLSFPNGNILRYSKTKHPKGYMR---- 303

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
            G  + E++ +S + +  EF M   RL E +   D+E L G  L
Sbjct: 304 -GEYLYEEQQVSVKDRPFEFFMNRFRLLEPVPKSDFEQLTGLPL 346


>gi|300718250|ref|YP_003743053.1| coproporphyrinogen III oxidase [Erwinia billingiae Eb661]
 gi|299064086|emb|CAX61206.1| coproporphyrinogen III oxidase [Erwinia billingiae Eb661]
          Length = 382

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 135/377 (35%), Positives = 209/377 (55%), Gaps = 20/377 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + ++Q  L ++     LT  R +S+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVQHLLADLDADLHLTSGREVSTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + + ++LDG+     +S+  EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSSEAMQMLLDGVRARLPLSATAEITMEANPGAVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   Q L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFSAQKLERLGRIHGPEEAKRAAQLATDLNLRSFNLDLMHGLPDQSLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF          LP ++   D++     + +A G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTLFASRPPK----LPDDDALWDIFEQGDRLLTAAGYVQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G    HNLNYWR+GDY+GIG GAH ++     R+  + + +HP  ++      G  + 
Sbjct: 243 KPGYRCEHNLNYWRFGDYLGIGCGAHGKLTQNDGRIIRTTKTRHPRGFMA-----GKYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ-----RQGFIERV 371
            ++ +S   +  EF M   RL E     ++ +  G +   EC    Q      +G++   
Sbjct: 298 RQQEVSDSDKPFEFFMNRFRLLEAAPRAEYPLYTGLD---ECSIRPQIDRALSEGYLTET 354

Query: 372 QFSRLRCTQRGMTMLDS 388
             S  + T++G   L+S
Sbjct: 355 AES-WQVTEKGKLFLNS 370


>gi|261822849|ref|YP_003260955.1| coproporphyrinogen III oxidase [Pectobacterium wasabiae WPP163]
 gi|261606862|gb|ACX89348.1| oxygen-independent coproporphyrinogen III oxidase [Pectobacterium
           wasabiae WPP163]
          Length = 379

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 125/335 (37%), Positives = 193/335 (57%), Gaps = 11/335 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L ++     L   R + SIF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLDADLPLASGRELHSIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQALLDGVRARIPLTPDAEITMEANPGTVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S + Q L  LGR H   EA  A  LA  +  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFDAQKLTRLGRIHGPDEAKRAAQLATGLGLRSFNLDLMHGLPDQSLDEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF          LP ++   D+Y    ++ SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTLFSSRPP----TLPDDDALWDIYEQGHALLSAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTVKVRHPRGYMQ-----GTYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           ++  ++++ +  EF M   RL E     D+    G
Sbjct: 298 KQHDVANDDRPFEFFMNRFRLLEAAPRADFTAYTG 332


>gi|170719551|ref|YP_001747239.1| coproporphyrinogen III oxidase [Pseudomonas putida W619]
 gi|169757554|gb|ACA70870.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           putida W619]
          Length = 395

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 211/379 (55%), Gaps = 16/379 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + +E ++ + LT++         R ISSIFFG
Sbjct: 22  PLALYIHIPWCVRKCPYCDFNSHAAGPDLPEEAYVDALLTDLDQELPAVQGRPISSIFFG 81

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +      ++EIT+EANP + E   F+ YR+ G+NR+S+GV
Sbjct: 82  GGTPSLFSANALGRLLRGVEQRIPFEPDIEITLEANPGTFEQEKFKAYRQTGINRLSIGV 141

Query: 138 QSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +   L+ LGR HN  E   AA       F   + DL++ LP Q++     +L++A+ 
Sbjct: 142 QSFQPAKLQALGRIHNGDEAIRAAGMARAAGFDNFNMDLMHGLPDQSLNDALGDLRQAID 201

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLT+E  T+F+    +    LP +++  D+    Q++ +AHG   YE+S +
Sbjct: 202 LGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAAHGYKQYEVSAY 257

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVR--KNGH 313
           +  G  + HNLNYW +GD+IGIG GAH +      R+  + + + P+ +L + +  K G 
Sbjct: 258 AQPGRAAKHNLNYWCFGDFIGIGAGAHGKQTFADGRILRTWKTRLPKDYLNLAKPFKAG- 316

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
               ++ L  ++   EFLM  LRL +G+  + +    G  L    E  R  +++G ++ V
Sbjct: 317 ----EKLLPVDELPFEFLMNALRLTDGVEAELFSQRTGLPLVQLAEARRAAEQKGLLQ-V 371

Query: 372 QFSRLRCTQRGMTMLDSVI 390
           +  RL  T RG   L+ ++
Sbjct: 372 EPDRLVATPRGQLFLNDLL 390


>gi|262172431|ref|ZP_06040109.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio mimicus
           MB-451]
 gi|261893507|gb|EEY39493.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio mimicus
           MB-451]
          Length = 378

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 189/335 (56%), Gaps = 11/335 (3%)

Query: 29  VKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW---MRQLTG-PRSISSIFFGGGTPSLI 84
           ++KCPYCDFNSH ++  + ++ ++ + L ++       QL G PR + SIF GGGTPSLI
Sbjct: 1   MQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLHSIFIGGGTPSLI 60

Query: 85  EPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQS 144
             + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV RIS+GVQS + + 
Sbjct: 61  SAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTRISIGVQSFDPEK 120

Query: 145 LRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
           L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L +A++    HLS
Sbjct: 121 LVRLGRIHGQQEAVRAAQLAHQIGLTSFNLDLMHGLPDQTPEQALADLDQAIALNPPHLS 180

Query: 204 LYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAES 263
            YQLTIE  TLFY         LP E+   D++ L     S  G   YEIS +S  G + 
Sbjct: 181 WYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQYEISGYSKPGYQC 236

Query: 264 LHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVVEKEFLS 322
            HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L  +     A ++ E L 
Sbjct: 237 QHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNNLAKAYLDSEQLV 296

Query: 323 SEQQAD-EFLMMGLRLREGISVKDWEMLAGRNLDI 356
           ++Q    EF M   RL E     D+    G  +++
Sbjct: 297 ADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEV 331


>gi|222054203|ref|YP_002536565.1| oxygen-independent coproporphyrinogen III oxidase [Geobacter sp.
           FRC-32]
 gi|221563492|gb|ACM19464.1| oxygen-independent coproporphyrinogen III oxidase [Geobacter sp.
           FRC-32]
          Length = 387

 Score =  243 bits (619), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 127/327 (38%), Positives = 198/327 (60%), Gaps = 3/327 (0%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW-MRQLTGPRSISSIFFGGG 79
           +Y+H+PFC+KKC YCDF+S V    V  + ++ + + EM+    +L  P S  +++FGGG
Sbjct: 11  LYIHFPFCLKKCLYCDFDS-VAGSLVSPDEYVAAVVREMELRAAKLAAPVSAPTLYFGGG 69

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ PQ +  I+D  A+ + ++S+ EITIEANP +V      GYR AG+NR+SLGVQ+
Sbjct: 70  TPSLMAPQLVGRIIDTAARLYGLNSDGEITIEANPGTVTAEKLAGYRAAGINRLSLGVQA 129

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           L++  L+ LGR H+  E++AA   AR + F  +  DLI++LP Q++T WE  L  A+   
Sbjct: 130 LDDALLQQLGRVHSVEESLAAYKAARKVGFDNIGIDLIHSLPGQSLTMWEKALDEAIRLG 189

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +H+S Y L++E+GT F  M + GDL LP E+ A  ++  T+ + + HG   YEISN + 
Sbjct: 190 PEHISAYSLSVEEGTPFAAMFEAGDLSLPHEDEATAMFEATRYLLALHGYEHYEISNFAR 249

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
               S HN  YWR G+Y+G G GAHS ++     +     ++  ++L  ++++     E 
Sbjct: 250 PLFRSRHNQVYWRRGNYLGFGAGAHSFLREPGWGLRWVNPRNHTAYLAAMQQDHLQEEEL 309

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKD 345
           + L+      E   +GLRL +GI + D
Sbjct: 310 QQLARRDALAEVFFLGLRLLKGIDMLD 336


>gi|301169184|emb|CBW28781.1| predicted oxidoreductase [Haemophilus influenzae 10810]
          Length = 383

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 127/340 (37%), Positives = 200/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +A G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTAAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|239995547|ref|ZP_04716071.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alteromonas macleodii ATCC 27126]
          Length = 379

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 211/381 (55%), Gaps = 18/381 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  + ++ ++   L ++    +    R + +IF GG
Sbjct: 6   LSLYIHIPWCVQKCPYCDFNSHGLKSDLPEKEYVAHLLDDLAIDAKRIADRPVETIFIGG 65

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL   + +A IL G+ +   +S   EIT+EANP +VE   F G+ +AG+NRIS+G+Q
Sbjct: 66  GTPSLFSSEAMADILKGVKQRVNLSDTAEITMEANPGTVEAGKFAGFYQAGINRISVGIQ 125

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S + + L+ LGR HN S+A  A+  A +   P  + DL++ LP+Q++     +L++ +  
Sbjct: 126 SFQPKHLKVLGRIHNESQAENAVKQAHSAGLPTFNLDLMHGLPEQSVENAMGDLKQGIEL 185

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T FY    +    LP +++  ++     S+    G H YEIS ++
Sbjct: 186 DPYHLSWYQLTIEPNTPFYSKPPE----LPDDDILWEIQEKGHSLLERAGYHQYEISGYA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS----HRVAISIEKHPESWLKMVRKNGH 313
             G +  HNLNYWR+GDY+GIG GAH ++   +    HR      KHP  +++M R    
Sbjct: 242 KAGHQCRHNLNYWRFGDYLGIGCGAHGKITDAANGTIHRTVKV--KHPRGYMEMSRP--- 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIER 370
            +  +  +S++    EF M   RL E   + D+    G  L  + +R L     QG +  
Sbjct: 297 YLDTQTLVSADDLPFEFFMNRFRLVEPCPMSDFSDFTGTELTDDVKRALSDAHHQGLLS- 355

Query: 371 VQFSRLRCTQRGMTMLDSVIA 391
           +  S  + T +G   L+S+++
Sbjct: 356 ISDSHWQVTAKGRRYLNSLLS 376


>gi|212709351|ref|ZP_03317479.1| hypothetical protein PROVALCAL_00387 [Providencia alcalifaciens DSM
           30120]
 gi|212688263|gb|EEB47791.1| hypothetical protein PROVALCAL_00387 [Providencia alcalifaciens DSM
           30120]
          Length = 379

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 197/335 (58%), Gaps = 11/335 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + ++ Q  +++  L ++    +L G R + +IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHTLKGEIPQTEYVEHLLNDLDKDAELIGSRPVKTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  +++ +++DG+ +   +  N E+T+EANP +VE + F GY+ +G+NRIS+GVQ
Sbjct: 67  GTPSLLSAESMQMLMDGVRQRVNLDPNAEVTMEANPGTVEADRFSGYQTSGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S  +  L  LGR H  +EA  A  LA N+  R  + DL++ LP QT  +   +L++A+  
Sbjct: 127 SFGDDKLIMLGRIHGPNEAKRAAQLATNLHLRSFNLDLMHGLPSQTRDEGLSDLRQAIEL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  T F          LP ++   D+Y     + +A G   YE S ++
Sbjct: 187 SPPHLSWYQLTIEPNTQFGSRPPR----LPDDDTLWDIYTEGHKLLTAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     ++  +++ KHP  +++     G  + 
Sbjct: 243 KAGYQCEHNLNYWRFGDYLGIGCGAHGKITSTDGQILRTVKTKHPRGYME-----GRYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            +  + +E +  E+ M   RL E ++ +++    G
Sbjct: 298 NRYNVENEDRPFEYFMNRFRLLEAMTRREFTEYTG 332


>gi|296113214|ref|YP_003627152.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis RH4]
 gi|295920908|gb|ADG61259.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis RH4]
 gi|326560207|gb|EGE10595.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis 7169]
 gi|326562766|gb|EGE13062.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis 103P14B1]
 gi|326564945|gb|EGE15147.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis 46P47B1]
 gi|326567876|gb|EGE17977.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis 12P80B1]
 gi|326573317|gb|EGE23285.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis 101P30B1]
 gi|326575787|gb|EGE25710.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis CO72]
 gi|326576867|gb|EGE26773.1| oxygen-independent coproporphyrinogen III oxidase-like protein YggW
           [Moraxella catarrhalis O35E]
          Length = 391

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 201/362 (55%), Gaps = 18/362 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CVKKCPYCDFNSH    +V  EN+I++ L++    + L   R I ++F G
Sbjct: 12  PLSLYIHIPWCVKKCPYCDFNSHALPSQVPFENYIEALLSDAVSQQSLVSNRQIDTVFIG 71

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  ++   + DG+   +  +   EIT+EANP ++E + F  Y   G+NR+S+GV
Sbjct: 72  GGTPSLLPIESFKRLFDGLRLIYDFAPTCEITLEANPGTLEHSPFDEYLTIGINRLSIGV 131

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +  +L  LGR HN  +A  AI  AR   F R++ DL+Y LP Q  ++   ++Q A+ 
Sbjct: 132 QSFDHNALTVLGRIHNPDQASNAIRAARIAGFDRVNADLMYGLPNQNPSKAVNDIQTAID 191

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN- 255
               HLS YQLTIE  T FY         LP E +  ++  L QS+ + HG + YE+S  
Sbjct: 192 AGATHLSWYQLTIEPNTTFYCTPPQ----LPDEEIMAEIETLGQSVLTKHGFYNYEVSAW 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHR------VAISIEKHPESWLKMVR 309
           H    A   HNLNYW++GDY+ IG GAH ++ + +H             + P+ +L    
Sbjct: 248 HGPNDAPCQHNLNYWQFGDYLAIGAGAHGKLTLKNHPDYQDGIYRYQKSRQPKDYLAF-- 305

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQG 366
           ++   +V  E +S +    EF+M  LRL++G+S   +E   G     +D E    LQ QG
Sbjct: 306 EDAPKMVNFERISDDNLPFEFMMNALRLKDGVSTDVFETRTGLLISTIDNEM-LPLQHQG 364

Query: 367 FI 368
            +
Sbjct: 365 LM 366


>gi|325524720|gb|EGD02707.1| coproporphyrinogen III oxidase [Burkholderia sp. TJI49]
          Length = 404

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 210/375 (56%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRADIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  T+F K        +P ++ + D+     + T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTMFAKFPP----AVPDDDASADMQEWIHARTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPISTIEPALKEAERRGLIAR-DFA 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|291550851|emb|CBL27113.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ruminococcus torques L2-14]
          Length = 385

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 137/384 (35%), Positives = 219/384 (57%), Gaps = 13/384 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           +L +Y+H PFCV+KC YCDF S     +  Q  ++ + + E+Q  ++L+G   + +IF G
Sbjct: 5   NLELYLHIPFCVRKCNYCDFFS-ASGTEEEQAAYVSAMVQEIQSYQELSGEYEVQTIFLG 63

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ I  I + I   ++V+ N EIT+E NP +V++      + AGVNR+S+G+
Sbjct: 64  GGTPSLLTPEQIEQIFNAIYHTFSVNENAEITMEMNPGTVDIEKLHAMKAAGVNRLSIGL 123

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS + + L+ LGR H   E +    L     F   + DL+ ALP QT+  +E  L + L+
Sbjct: 124 QSAQNEELKMLGRIHTFEEFLETWKLIEQAGFKNRNIDLMSALPGQTIESYEDTLSKVLA 183

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDL-----VLPSENVAVDLYNLTQSITSAHGLHAY 251
              +H+S Y L +E+GT+FY  ++ G L      LPSE     +  LT    +  G++ Y
Sbjct: 184 LEPEHISAYSLILEEGTVFYDWYEKGKLDRGAWKLPSEEEEYAMGELTILRLAEAGMYRY 243

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISN++  G E  HNL YW   +Y+GIG G+ S +K G     I   K   ++++ +R  
Sbjct: 244 EISNYAKPGKECRHNLGYWDRVEYLGIGAGSSSLIK-GERFDHIRDRK---AYIEKIRNG 299

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
              ++++E LS E Q +EF+ +GLR  EG+S  D++   G+N+D    + L +    + +
Sbjct: 300 ESILIDREILSVESQMEEFMYLGLRKVEGVSRTDFQNCFGKNVDDVYGKILDKLEEEQLL 359

Query: 372 QFS--RLRCTQRGMTMLDSVIANL 393
           +FS  R+R T RGM + + V+A  
Sbjct: 360 EFSGDRIRLTHRGMDVSNCVLAEF 383


>gi|148827660|ref|YP_001292413.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittGG]
 gi|148718902|gb|ABR00030.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittGG]
          Length = 383

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKSDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGVQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|317049431|ref|YP_004117079.1| oxygen-independent coproporphyrinogen III oxidase [Pantoea sp.
           At-9b]
 gi|316951048|gb|ADU70523.1| oxygen-independent coproporphyrinogen III oxidase [Pantoea sp.
           At-9b]
          Length = 379

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 194/331 (58%), Gaps = 11/331 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L +++    LT  R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHIEYVQHLLHDLEQDLPLTSGREVRTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    + +++DG+     ++++ EIT+EANP +VE + F GY++AG+NRIS+GV
Sbjct: 66  GGTPSLLSSNAMQMLMDGVRARLPLAADAEITMEANPGTVEADRFSGYQQAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS   Q L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFSPQKLERLGRIHGPEEAQRAAHLAAGLGLRSFNLDLMHGLPDQSLEEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 186 LHPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G    HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  ++K     G+ +
Sbjct: 242 AKPGYRCEHNLNYWRFGDYLGIGCGAHGKLTQPDGRIVRTVKTRHPRGFMK-----GNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDW 346
            ++  ++   +  EF M   RL E     D+
Sbjct: 297 DKQHDVADADKPFEFFMNRFRLLEAAPRADF 327


>gi|319898018|ref|YP_004136215.1| fe-s oxidoreductase [Haemophilus influenzae F3031]
 gi|317433524|emb|CBY81907.1| predicted Fe-S oxidoreductase [Haemophilus influenzae F3031]
          Length = 383

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 200/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKSDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKISGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +A G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTAAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG G+H ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGSHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|260582271|ref|ZP_05850064.1| coproporphyrinogen III oxidase [Haemophilus influenzae NT127]
 gi|260094639|gb|EEW78534.1| coproporphyrinogen III oxidase [Haemophilus influenzae NT127]
          Length = 383

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 200/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKSDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    ++ EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRSFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|78484462|ref|YP_390387.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thiomicrospira crunogena XCL-2]
 gi|78362748|gb|ABB40713.1| coproporphyrinogen III oxidase, anaerobic [Thiomicrospira crunogena
           XCL-2]
          Length = 382

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 215/378 (56%), Gaps = 13/378 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH+P+C++KCPYCDFNSH    +  ++ +IQ+ + +++        R I SIFFG
Sbjct: 8   PLSLYVHYPWCIQKCPYCDFNSHTLG-EDQEQRYIQALIRQLEQTLPDIWGRPIQSIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    + + L           ++EIT+EANP +V+   F G+R+AG+NR+S+G+
Sbjct: 67  GGTPSLMSEAGLDMFLSQARALLGFQPDIEITLEANPGTVDFEKFSGFRQAGINRLSMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +++ LR LGR H++ EA  A+  AR+  F   + DL++ALP QT+ Q   +++ AL+
Sbjct: 127 QSFDDEKLRDLGRIHSSDEAYKAVEAARSAGFDNFNLDLMFALPSQTLKQAIHDVETALA 186

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S YQLT+E  T FYK       VLP E++A ++    Q++ S  G H YE+S +
Sbjct: 187 LEPTHISHYQLTLEPNTPFYK----NPPVLPEEDLAWEMQLACQTVLSETGYHHYEVSAY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGS--HRVAISIEKHPESWLKMVRKNGHA 314
           +       HNLNYW++GDYIG+G GAH ++            +   P  ++ M+      
Sbjct: 243 AKKNQACRHNLNYWQFGDYIGLGAGAHGKITQPPLGEIWRTQMPASPGGYMNMIESGDMG 302

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
              +  LS +    EF++  LRL++G  +  + +  G  L +     +++  +G+ E+ Q
Sbjct: 303 --RRHILSDDDALFEFMLNALRLQDGFPLALFTVRTGLPLQVIDPQLKSMISKGWAEQDQ 360

Query: 373 FSRLRCTQRGMTMLDSVI 390
              L+ TQ G T L+ V+
Sbjct: 361 -DNLQLTQTGKTYLNEVL 377


>gi|298485015|ref|ZP_07003112.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160425|gb|EFI01449.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 404

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 211/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L  V+      
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSNPDGRIMRTWKTRLPKDYLNPVKP---FQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|197334831|ref|YP_002155180.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           fischeri MJ11]
 gi|197316321|gb|ACH65768.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           fischeri MJ11]
          Length = 386

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 194/344 (56%), Gaps = 13/344 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
            L +Y+H P+C++KCPYCDFNSH  + ++ +  +I + +    T++      + PR + S
Sbjct: 6   PLSLYIHIPWCIQKCPYCDFNSHALKAEIPEAQYISALIDDLDTDLARYDMQSEPRKLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI    I  +L  + K    + ++EIT+EANP +VE   F  YR+AGVNRI
Sbjct: 66  IFIGGGTPSLITGPEIKRLLSEVEKRLPFADDIEITMEANPGTVEAGRFVEYRQAGVNRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS +++ L  LGR H   EAI A HLA        + DL++ LP Q++     +LQ
Sbjct: 126 SIGVQSFQQEKLEKLGRIHGKDEAIRAAHLAHEAQLNSFNLDLMHGLPNQSIEDALSDLQ 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++     + +  G   YE
Sbjct: 186 QAIDLNPPHLSWYQLTIEPNTVFYYKPP----TLPDDDDLWDIFEQGHQMLAKAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S +G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L + +  
Sbjct: 242 ISGYSKVGYQCRHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKIKHPRGFLDLTKP- 300

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
            + + E+E +  ++   EF M   RL E    +D+    G   D
Sbjct: 301 -YLIDEQEVMDHDRPF-EFFMNRFRLLEACPKQDFIDKTGLGFD 342


>gi|302186237|ref|ZP_07262910.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           642]
          Length = 404

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/377 (35%), Positives = 210/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS EE  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L +A++
Sbjct: 151 QSFEESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLHQAIT 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +AHG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQEAGQQLLAAHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L     +    
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMRTWKTRLPKDYLN---PDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|297272555|ref|XP_001093983.2| PREDICTED: radical S-adenosyl methionine domain-containing protein
           1, mitochondrial [Macaca mulatta]
          Length = 420

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 195/331 (58%), Gaps = 6/331 (1%)

Query: 24  HWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSL 83
            WP+C K+C YC+FN ++ R  V +    +  +TE Q + +L+G + + S+FFGGGTPSL
Sbjct: 23  QWPYCEKRCSYCNFNKYIPR-GVEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGTPSL 81

Query: 84  IEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQ 143
             P  +A +L+ +A+   + ++ E+T+EANP+S   +    +  AGVNR+S+G+QSL+  
Sbjct: 82  ASPHTVAAVLEAVAQTAHLPADSEVTLEANPTSTPGSRLAEFGAAGVNRLSIGLQSLDNT 141

Query: 144 SLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAVDHL 202
            LR LGR H+A +A+  +  AR +FP R+S DL+  LP Q +  W  +LQ  L +  DHL
Sbjct: 142 ELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCDDHL 201

Query: 203 SLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAE 262
           SLYQL++E+GT  +   + G L  P   +A ++Y   +++    G   YE+SN +  GA 
Sbjct: 202 SLYQLSLERGTALFAQVQQGVLPAPDPELAAEMYQRGRAVLREAGFRQYEVSNFARNGAL 261

Query: 263 SLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEK-HPESWLKMVRKNGHAVVEK 318
           S HN  YW+ G Y+GIGPGAH R      GSH     I+   P++W+K V   GH   ++
Sbjct: 262 STHNWTYWQCGQYLGIGPGAHGRFMPQGAGSHTREARIQTLEPDNWMKEVMMFGHGTRKR 321

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEML 349
             L   +  +E L +GLR   GI+ + W+  
Sbjct: 322 VPLGRLELLEEVLALGLRTDVGITHQHWQQF 352


>gi|257453736|ref|ZP_05619017.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enhydrobacter aerosaccus SK60]
 gi|257448828|gb|EEV23790.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enhydrobacter aerosaccus SK60]
          Length = 382

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 204/378 (53%), Gaps = 15/378 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CVKKCPYCDFNSH  R  +    ++ + L +++        R IS+IF G
Sbjct: 8   PLSLYIHIPWCVKKCPYCDFNSHESRTPIDFVGYVDALLDDLKSQLSFVQGRKISTIFIG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+       +  GI    T++ + EIT+EANP++VE   F  Y   G+NR+SLGV
Sbjct: 68  GGTPSLLPIAQYQQLFAGINAQLTLTEDCEITMEANPATVEHAPFHEYLAVGINRLSLGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR HN  +A+ AI  A+   F +++ DL++ LP QT+T    +LQ+A+ 
Sbjct: 128 QSFQAQKLAALGRIHNPQQALFAIQNAQQAGFKKLNVDLMHGLPNQTLTDALSDLQQAID 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V H+S YQLTIE  T+FY+       +LP + + VD++     +  A+G   YE+S  
Sbjct: 188 LGVSHISWYQLTIEPNTVFYR----NTPILPDDEILVDIFEQGAELLQANGFVQYEVSAW 243

Query: 257 SFLG--AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           S       S HNLNYW++GDY+ IG GAH +V         S  + P+ +     +   A
Sbjct: 244 SRQADFQPSQHNLNYWQFGDYLAIGAGAHGKVTRPDGIYRFSKSRLPKDY-----RVNQA 298

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGFIERVQ 372
            +  + +       EF+M GLRL+ G+  + W    G    +   +   L  +G +E + 
Sbjct: 299 AIGWQAIEPSDLPFEFMMNGLRLKNGVPKQFWTQRTGLAWSVIEPQLIQLHNRGLVE-LS 357

Query: 373 FSRLRCTQRGMTMLDSVI 390
              + CT +G   L+ V+
Sbjct: 358 GDHIHCTAQGFLFLNQVL 375


>gi|15603534|ref|NP_246608.1| coproporphyrinogen III oxidase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12722075|gb|AAK03753.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 384

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 203/355 (57%), Gaps = 22/355 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL----TGPRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++++I   L ++   RQ        RS+ S
Sbjct: 8   PLSLYIHIPWCVQKCPYCDFNSHAQKGHIPEQDYIAHLLQDLHQDRQRFQDSIQDRSLHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL   + I  +L G+A+      ++EIT+EANP + E   F+GY +AGV RI
Sbjct: 68  IFIGGGTPSLFSAEGIHTLLSGVAQCLPFQPDIEITLEANPGTAEAERFKGYVQAGVTRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQ 192
           S+G+QS  +  L  LGR HNA EA +A+  A+ +     + DL++ LP QT+ +   +LQ
Sbjct: 128 SMGIQSFNDDKLVRLGRIHNAQEAKSAVGFAKLSGLKSFNLDLMHGLPNQTLEEALSDLQ 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           +A++    HLS YQLTIE  T+F Y+       VLP ++   D++     + +  G   Y
Sbjct: 188 QAIALEPPHLSWYQLTIEPNTMFAYR-----PPVLPDDDALWDIFEQGHQLLTEAGYVQY 242

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRK 310
           E S ++    +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +++    
Sbjct: 243 ETSAYAKPAFQCRHNLNYWRFGDYLAIGCGAHGKITQPNGEIKRYSKTKHPKGYMR---- 298

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQ 365
            G  + E++ +++E  A EF M   RL E +   D+  L G      CE ++Q Q
Sbjct: 299 -GDYLYEEKTVATEDLAFEFFMNRFRLLEAVPKTDFTRLTGL-----CEESIQPQ 347


>gi|319775609|ref|YP_004138097.1| Fe-S oxidoreductase [Haemophilus influenzae F3047]
 gi|329122343|ref|ZP_08250930.1| oxygen-independent coproporphyrinogen III oxidase [Haemophilus
           aegyptius ATCC 11116]
 gi|317450200|emb|CBY86416.1| predicted Fe-S oxidoreductase [Haemophilus influenzae F3047]
 gi|327473625|gb|EGF19044.1| oxygen-independent coproporphyrinogen III oxidase [Haemophilus
           aegyptius ATCC 11116]
          Length = 383

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDAIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|59711031|ref|YP_203807.1| coproporphyrinogen III oxidase [Vibrio fischeri ES114]
 gi|59479132|gb|AAW84919.1| predicted oxidoreductase [Vibrio fischeri ES114]
          Length = 386

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 194/344 (56%), Gaps = 13/344 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSISS 73
            L +Y+H P+C++KCPYCDFNSH  + ++ +  +I + +    T++      + PR + S
Sbjct: 6   PLSLYIHIPWCIQKCPYCDFNSHALKAEIPEAQYISALIDDLDTDLARYDMQSEPRKLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI    I  +L  + K    + ++EIT+EANP +VE   F  YR+AGVNRI
Sbjct: 66  IFIGGGTPSLITAPEIKRLLSEVEKRLPFAGDIEITMEANPGTVEAGRFVKYRQAGVNRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS +++ L  LGR H   EAI A HLA        + DL++ LP Q++     +LQ
Sbjct: 126 SIGVQSFQQEKLEKLGRIHGKDEAIRAAHLAHEAQLNSFNLDLMHGLPNQSIEDALSDLQ 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+     HLS YQLTIE  T+FY         LP ++   D++     + +  G   YE
Sbjct: 186 QAIDLNPPHLSWYQLTIEPNTVFYYKPP----TLPDDDDLWDIFEQGHQMLAKAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S +G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +L + +  
Sbjct: 242 ISGYSKVGYQCRHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKIKHPRGFLDLTKP- 300

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD 355
            + + E+E +  ++   EF M   RL E    +++    G   D
Sbjct: 301 -YLIDEQEVMDHDRPF-EFFMNRFRLLEACPKQEFLDTTGLGFD 342


>gi|71735003|ref|YP_272765.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555556|gb|AAZ34767.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 404

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 211/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAHS++     R+  + + + P+ +L   +      
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHSKLSHPDGRIMRTWKTRLPKDYLNPDKPFQAGA 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 327 ---KLLPLDELPFEFLMNALRLTNGVDAALFRKRTGLSLDSLTEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|330899343|gb|EGH30762.1| HemN family oxidoreductase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 404

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 210/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS EE  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFEESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L     +    
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMRTWKTRLPKDYLN---PDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|90412034|ref|ZP_01220041.1| coproporphyrinogen III oxidase [Photobacterium profundum 3TCK]
 gi|90327012|gb|EAS43391.1| coproporphyrinogen III oxidase [Photobacterium profundum 3TCK]
          Length = 384

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 138/358 (38%), Positives = 196/358 (54%), Gaps = 26/358 (7%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ---WMRQL-TGPRSISS 73
            L +YVH P+CV+KCPYCDFNSH  + ++ + ++I + L ++       QL  G R + S
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHALKAEIPELDYIDALLEDLDIDLAKYQLEAGVRPLHS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSLI P  I  +L GI      S ++EIT+EANP +VE   F  Y++ G+NRI
Sbjct: 66  IFIGGGTPSLISPPEIGRLLKGIEARIPFSHDIEITMEANPGTVEAGRFVAYQEVGINRI 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQS +++ L  LGR H + EA  A  LA        + DL++ LP Q++     +L+
Sbjct: 126 SIGVQSFQDEKLTRLGRIHGSDEARKAAKLATEAGLNSFNIDLMHGLPDQSIDDAMYDLK 185

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A++    HLS YQLTIE  T+FY         LP ++   D++     I +  G   YE
Sbjct: 186 QAIALNPPHLSWYQLTIEPNTMFYSKPP----TLPDDDDLWDIFEQGHQILADAGYVQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKN 311
           IS +S  G +  HNLNYWR+GDY+GIG GAH +V      +  +++ KHP  +L      
Sbjct: 242 ISGYSKPGLQCRHNLNYWRFGDYLGIGCGAHGKVSFADGNITRTVKVKHPRGYLNPT--- 298

Query: 312 GHAVVEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ 363
                 K +L  E Q D      EF M   RL E    +D+    G +LD   + N+Q
Sbjct: 299 ------KPYLDKETQVDAAERPFEFFMNRFRLLEACPKQDYMDRTGLSLDT-IDTNIQ 349


>gi|329296968|ref|ZP_08254304.1| HemN family oxidoreductase [Plautia stali symbiont]
          Length = 376

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 193/336 (57%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L ++     L+  R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHGEYVQHLLNDLDQDLPLSAGREVRTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  ++DG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GV
Sbjct: 66  GGTPSLLSSEAMQQLMDGVRARLPLAMDAEITMEANPGTVEADRFSGYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS   Q L  LGR H   EA  A  LA  +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFSPQKLTRLGRIHGPDEARRAAQLAAGLGLRSFNLDLMHGLPDQSLEEAPDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + SA G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLSAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G    HNLNYWR+GDY+GIG GA+ ++     R+  +++ +HP  ++K     G+ +
Sbjct: 242 AKPGYRCEHNLNYWRFGDYLGIGCGAYGKLTQPDGRIVRTVKTRHPRGFMK-----GNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            ++  +  E +  EF M   RL E     D++   G
Sbjct: 297 DKQHDVPDEDKPFEFFMNRFRLLEAAPRADFQRYTG 332


>gi|237798168|ref|ZP_04586629.1| HemN family oxidoreductase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021020|gb|EGI01077.1| HemN family oxidoreductase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 404

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 209/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYDRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L     +    
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIIRTWKTRLPKDYLN---PDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G +     
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHEDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           SRL  T +G   L+ ++
Sbjct: 383 SRLIATPQGQLFLNDLL 399


>gi|223041937|ref|ZP_03612122.1| oxygen-independent coproporphyrinogen III oxidase-like protein
           [Actinobacillus minor 202]
 gi|223017291|gb|EEF15718.1| oxygen-independent coproporphyrinogen III oxidase-like protein
           [Actinobacillus minor 202]
          Length = 385

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/389 (34%), Positives = 208/389 (53%), Gaps = 23/389 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++ +IQ  L ++       ++  G R I SI
Sbjct: 8   LSLYIHIPWCVQKCPYCDFNSHAQKGVIPEKEYIQHLLADLSQDLTAYQKAIGERKIHSI 67

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   + I  +L  + K       +EIT+EANP + E   F GY + GVNRIS
Sbjct: 68  FIGGGTPSLFSAEGIQYLLAEVQKRIAFEDQIEITLEANPGTAEAERFLGYVQGGVNRIS 127

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI----FPRMSFDLIYALPKQTMTQWEME 190
           +G+QS E + L  LGR HN  EAI A+  A+N         + DL++ LP Q+++Q   +
Sbjct: 128 MGIQSFEPEKLLKLGRIHNREEAIQAVEFAKNAASLGLRSFNLDLMHGLPNQSVSQALSD 187

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A+     HLS YQLTIE  T+FY         LP ++   D++     + ++ G   
Sbjct: 188 LKQAIVLNPPHLSWYQLTIEPNTMFYYRQP----TLPDDDELWDIFEQGHQLLTSAGYEQ 243

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVR 309
           YE S ++    +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +++   
Sbjct: 244 YETSAYAKKDYQCQHNLNYWRFGDYLAIGCGAHGKITYPTGEIYRFSKTKHPKGYMR--- 300

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQG 366
             G     +E ++ E +  EF M   RL E     D+E L G   ++++    + +++  
Sbjct: 301 --GEYRYSQELIALEDRPFEFFMNRFRLLEATPKTDFEQLTGLTIKSIEPIISQAIEKNY 358

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
             E  Q    + TQ G   L+ ++    V
Sbjct: 359 LTETTQ--HWQITQHGKLFLNELLEGFLV 385


>gi|251794011|ref|YP_003008743.1| coproporphyrinogen III oxidase [Aggregatibacter aphrophilus NJ8700]
 gi|247535410|gb|ACS98656.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Aggregatibacter aphrophilus NJ8700]
          Length = 384

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 203/345 (58%), Gaps = 19/345 (5%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQ----SFLTEMQWMRQLTGPRSISS 73
            L +Y+H P+CV+KCPYCDFNSH ++  + ++++++      + ++   ++    R + S
Sbjct: 8   PLSLYIHIPWCVQKCPYCDFNSHAQKGAIPEQDYVRHLIADLMADLAHYQESVQQRPLHS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL     IA +L  I +    + N+EIT+EANP +VE   F GY +AGVNRI
Sbjct: 68  IFIGGGTPSLFSADTIAYLLQQIEQRIPFAPNIEITLEANPGTVEAERFLGYAQAGVNRI 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSF--DLIYALPKQTMTQWEMEL 191
           S+G+QS  ++ L+ LGR HNA+EA +A+ LA ++ P  SF  DL++ LP QT+ +   +L
Sbjct: 128 SMGIQSFSDEKLQKLGRIHNAAEAKSAVKLA-SVSPLRSFNLDLMHGLPNQTLNEALDDL 186

Query: 192 QRALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           ++A+  A  HLS YQLTIE  T+F Y+  K     LP ++   D++     + +A G   
Sbjct: 187 RQAIELAPPHLSWYQLTIEPNTMFAYRPPK-----LPDDDELWDIFEQGHQLLTAAGYQQ 241

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVR 309
           YE S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +++   
Sbjct: 242 YETSAYAKPGFQCQHNLNYWRFGDYLAIGCGAHGKLSFQNGNILRYSKTKHPKGYMR--- 298

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
             G    E+  +S + +  EF M   RL E +   ++E   G  L
Sbjct: 299 --GEYRYEEREVSVQDRPFEFFMNRFRLLEAVPKIEFEQFTGLPL 341


>gi|145634540|ref|ZP_01790249.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittAA]
 gi|145268085|gb|EDK08080.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittAA]
          Length = 383

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|229844377|ref|ZP_04464517.1| coproporphyrinogen III oxidase [Haemophilus influenzae 6P18H1]
 gi|229812626|gb|EEP48315.1| coproporphyrinogen III oxidase [Haemophilus influenzae 6P18H1]
          Length = 383

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|170698510|ref|ZP_02889581.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria IOP40-10]
 gi|170136594|gb|EDT04851.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria IOP40-10]
          Length = 404

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 208/375 (55%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSASGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTMFAKFPP----AVPDDDASADMQEWIHERTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  +       EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGPRDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALKEAERRGLITR-DFA 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|242238222|ref|YP_002986403.1| coproporphyrinogen III oxidase [Dickeya dadantii Ech703]
 gi|242130279|gb|ACS84581.1| oxygen-independent coproporphyrinogen III oxidase [Dickeya dadantii
           Ech703]
          Length = 378

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 135/384 (35%), Positives = 208/384 (54%), Gaps = 30/384 (7%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+C++KCPYCDFNSH  +  V  + ++   L ++     L G R + SIF GG
Sbjct: 7   LSLYIHIPWCIQKCPYCDFNSHALKGDVPHDEYVSHLLADLDADLPLAGHRPLHSIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     +  + EIT+EANP +VE + F GY++AGVNRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQRLLDGVRARLPLEDDAEITMEANPGTVEADRFNGYQQAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H   EA  A  LA  +     + DL++ LP+Q++ +   +L++A+  
Sbjct: 127 SFSAEKLTRLGRIHGPEEAKRAAQLAAGLGLGSFNLDLMHGLPEQSLDEALDDLRQAIEL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           +  HLS YQLTIE  TLF          LP ++   D++     + SA G   YE S ++
Sbjct: 187 SPPHLSWYQLTIEPNTLFGSRPP----RLPDDDALWDIFEQGHQLLSAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK---MVRKNGH 313
             G    HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  +++   + + N  
Sbjct: 243 KPGYRCRHNLNYWRFGDYLGIGCGAHGKLSFADGRILRTVKTRHPRGYMQGNYLHQSNEV 302

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG-------RNLDIECERNLQRQG 366
           A+ ++ F        E+ M   RL E     D+  L G       R +D     +  RQG
Sbjct: 303 AMADRPF--------EYFMNRFRLLEAAPRDDFTALTGLPESAVRRQID-----DALRQG 349

Query: 367 FIERVQFSRLRCTQRGMTMLDSVI 390
           ++        + TQ G   L+S++
Sbjct: 350 YLTESA-DHWQITQHGKLFLNSLL 372


>gi|119503512|ref|ZP_01625595.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2080]
 gi|119460574|gb|EAW41666.1| coproporphyrinogen III oxidase [marine gamma proteobacterium
           HTCC2080]
          Length = 384

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 210/379 (55%), Gaps = 12/379 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +YVH P+C +KCPYCDFNSH +     +  +I + LT+++      G R + S+F GG
Sbjct: 8   LALYVHLPWCERKCPYCDFNSHEQFDSSLETGYIDALLTDLRQQLVSVGSRPLFSVFLGG 67

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL    +IA +L+GI + W++    EIT+EANP S E + F  YR AGVNR+SLG+Q
Sbjct: 68  GTPSLFSGASIARLLNGIDQIWSIGLTTEITMEANPGSAEASRFADYRSAGVNRLSLGIQ 127

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S  +  L  LGR H++++A+ AIHLA+  F R + D+++ LP Q +     +L+RA+ ++
Sbjct: 128 SFADAQLMALGRVHDSAQAMQAIHLAKQHFDRFNLDIMHGLPGQKIETALDDLERAIDHS 187

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             H+S YQLTIE  T F+         LP++++  D+ +  ++     GL  YE+S  + 
Sbjct: 188 QGHVSWYQLTIEPNTTFWSRPPR----LPNDDILTDIQDAGEARFLESGLTQYEVSAWAS 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRV-KVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
               S HNLNYW +GDYIGIG GAH ++ K     +     + P  +L  + +       
Sbjct: 244 HQQMSQHNLNYWTFGDYIGIGAGAHGKITKENGSIIRTRRSRSPRDYLTGIAEG--VPPH 301

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFS 374
           ++ L   +   EF++  LRL+ G+    ++   G  L +  E  +++    G +      
Sbjct: 302 QQQLPQTELPVEFMLNALRLKNGVPASLFKANTGLELAV-VEPQIEKLVANGLLS-ADTE 359

Query: 375 RLRCTQRGMTMLDSVIANL 393
           R+  T  G   L+ V+A+ 
Sbjct: 360 RIGTTDHGYRFLNDVVASF 378


>gi|221133358|ref|ZP_03559663.1| oxygen-independent coproporphyrinogen III oxidase [Glaciecola sp.
           HTCC2999]
          Length = 382

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 201/339 (59%), Gaps = 12/339 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  + ++ ++   L +++    L   RSI +IF GG
Sbjct: 10  LSLYIHVPWCVQKCPYCDFNSHTLKGGIPEKEYVAHLLDDLRADAHLAQGRSIRTIFIGG 69

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+ P+ + ++L+G+ +   V+ + EIT+EANP +VE   F G+   GVNR+S+GVQ
Sbjct: 70  GTPSLLSPEALTILLNGVKQIIPVTLDAEITLEANPGTVEAGKFAGFVAGGVNRLSIGVQ 129

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L+ LGR H+  +A  AI  A +      + D+++ LP+QT+     +L++A+ +
Sbjct: 130 SFHPRQLKALGRIHDDQQAHHAIAQAHDAGLHSFNIDIMHGLPEQTVVHGLDDLRQAIHH 189

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              H+S YQLTIE  T F+         LP ++   D+    + + +  G   YEIS ++
Sbjct: 190 QSKHISWYQLTIEPNTSFHSKPPQ----LPDDDTLWDIQEQGEVLLAEAGFEQYEISGYA 245

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAHS++   SH +  + + KHP+ ++ +    G + V
Sbjct: 246 QSGFQCQHNLNYWRFGDYLGIGCGAHSKITT-SHGIQRTEKIKHPKGYMNI----GQSYV 300

Query: 317 EKEFLSSEQQAD-EFLMMGLRLREGISVKDWEMLAGRNL 354
            K++L  +     EF M  LRL E   V ++EML G  L
Sbjct: 301 FKQWLVDKDDYPFEFFMNRLRLVEACGVDEYEMLTGMKL 339


>gi|114321595|ref|YP_743278.1| coproporphyrinogen III oxidase, anaerobic [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114227989|gb|ABI57788.1| coproporphyrinogen III oxidase, anaerobic [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 398

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 151/402 (37%), Positives = 213/402 (52%), Gaps = 29/402 (7%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHV-----RRYK------VGQENFIQSFLT 57
           N   G     LGVY+H P+CV+KCPYCDFNSH      RR        +  E + ++ LT
Sbjct: 2   NPQAGTPPPPLGVYLHLPWCVQKCPYCDFNSHAPARADRRADASTLPAIPHERYTRAVLT 61

Query: 58  EMQWMRQLTGP---RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANP 114
           ++       GP   R + ++F GGGTPSL  P+ I  +L+ + +   ++ + EIT+EANP
Sbjct: 62  DLA---SAAGPLQGRRVETVFIGGGTPSLFPPEAIGGLLEALDRRLGLTGDAEITLEANP 118

Query: 115 SSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSF 173
            +VE   F GYR AGVNR+S+GVQS +  +LR LGR H   E   A     R  F R++ 
Sbjct: 119 GTVEQGRFHGYRAAGVNRLSIGVQSFDAGALRRLGRIHGPEEARRAVRAARRAGFRRINL 178

Query: 174 DLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAV 233
           DL+YALP QT  Q   +++ AL+ A +H+S YQLT+E GT F   H      LP E   +
Sbjct: 179 DLMYALPGQTTAQALADVEAALALAPEHISHYQLTLEPGTPF---HSRPPADLPDEARLL 235

Query: 234 DLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV 293
            L    +   +A GL  YE+S  +  G    HNLNYWR+GDY+G+G GAH ++   + R 
Sbjct: 236 ALEAACRERLAAAGLTRYEVSAWAHPGEACRHNLNYWRFGDYLGLGAGAHGKLSDPA-RD 294

Query: 294 AISIE---KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLA 350
            I  E   + P +++        A+ E   L +     EF+M  LRL EG    DW    
Sbjct: 295 EIRREARVRMPGTYMAQAGTPA-AIAELRRLQNGDIVLEFMMNALRLAEGFHRDDWRRHT 353

Query: 351 GRNLDIECERNLQ--RQGFIERVQFSRLRCTQRGMTMLDSVI 390
           GR   +  +R  +    G +      R+R TQRG  +LD ++
Sbjct: 354 GRPTTLFEDRVAEAVTDGLLSD-DGGRIRPTQRGWQLLDGLL 394


>gi|16272411|ref|NP_438624.1| coproporphyrinogen III oxidase [Haemophilus influenzae Rd KW20]
 gi|260580474|ref|ZP_05848302.1| oxygen-independent coproporphyrinogen III oxidase-like protein
           [Haemophilus influenzae RdAW]
 gi|1170234|sp|P43899|Y463_HAEIN RecName: Full=Oxygen-independent coproporphyrinogen-III
           oxidase-like protein HI_0463
 gi|1573441|gb|AAC22122.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Haemophilus influenzae Rd KW20]
 gi|260092816|gb|EEW76751.1| oxygen-independent coproporphyrinogen III oxidase-like protein
           [Haemophilus influenzae RdAW]
          Length = 383

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKSDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGIMRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|172059922|ref|YP_001807574.1| coproporphyrinogen III oxidase [Burkholderia ambifaria MC40-6]
 gi|171992439|gb|ACB63358.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria MC40-6]
          Length = 404

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 208/375 (55%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTMFAKFPP----AVPDDDASADMQEWIHERTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPDHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-TAGTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  +       EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGPRDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALKEAERRGLITR-DFA 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|167619071|ref|ZP_02387702.1| coproporphyrinogen III oxidase [Burkholderia thailandensis Bt4]
          Length = 405

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 198/340 (58%), Gaps = 11/340 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG----QENFIQSFLTEMQWMRQLTGPRSISSI 74
           L +YVH+P+CV+KCPYCDFNSH   +K G    + +++ +   +++    L   R + ++
Sbjct: 29  LALYVHFPWCVRKCPYCDFNSH--EWKDGGALPEHDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LTFAPPHLSLYHLTLEPNTYFAKFPP----AVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYW +GDY+GIG GAH+++   +  +  +  KHP ++++   K G A
Sbjct: 263 AYAKPHRQSKHNLNYWCFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA-KAGAA 321

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL 354
           V E+  +       EF++  LRL +G+    +    G +L
Sbjct: 322 VQEEREVGPRDLPFEFMLNALRLVDGVPTHSFAERTGMSL 361


>gi|82523718|emb|CAI78499.1| coproporphyrinoben III oxidase and related Fe-S oxidoreductase
           [uncultured beta proteobacterium]
          Length = 391

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 195/349 (55%), Gaps = 6/349 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S  L +Y+H P+CVKKCPYCDFNSH  +  + +  +I + L +++        R I ++F
Sbjct: 16  SPPLSLYIHLPWCVKKCPYCDFNSHASQV-IPEAAYIDALLLDLERALPDIWGRRIHTVF 74

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL     I  IL G+     +  N EIT+EANP +VE   F G+R+AGV R+SL
Sbjct: 75  FGGGTPSLFSAAGIDRILTGVRTLTQLLPNAEITLEANPGTVEAEKFAGFREAGVTRVSL 134

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS   Q L+ LGR H+ SEA  A  LA   F   + DL++ALP QT+ +   ++  AL
Sbjct: 135 GIQSFNSQHLKALGRIHDDSEARRAAELAATHFDTFNLDLMFALPGQTLDEALTDIDTAL 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++   HLS Y LT+E  T F          LP ++VA D++   ++  +  G+  YE S 
Sbjct: 195 AFRPPHLSAYHLTLEPNTPFGHTAPPN---LPDDDVAADMHQAIEARLTEAGMQHYETSA 251

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++     S HNLNYW++GDY+GIG GAHS++      +     KHP+ ++  V +  H +
Sbjct: 252 YARPQHASRHNLNYWQFGDYLGIGAGAHSKLSFHDRILRQMRTKHPQQYMDAVAQGTH-I 310

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR 364
            +   L+      EF+M  LRL EG+    +E   G  L I C   L++
Sbjct: 311 ADARTLTRSDLPFEFMMNALRLNEGVPSALFEERTGLPL-IVCTAGLEQ 358


>gi|330972625|gb|EGH72691.1| HemN family oxidoreductase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 404

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 210/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFQESKLKALGRIHNGDEAIRAADMARRAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQEAGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L     +    
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIVRTWKTRLPKDYLN---PDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|115350909|ref|YP_772748.1| coproporphyrinogen III oxidase [Burkholderia ambifaria AMMD]
 gi|115280897|gb|ABI86414.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia ambifaria AMMD]
          Length = 404

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 208/375 (55%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ ALS
Sbjct: 148 IQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTMFAKFPP----AVPDDDASADMQEWIHERTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  +       EF++  LRL EG  V  +    G  +       +  +R+G I R  F+
Sbjct: 323 EEREVGPRDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALKEAERRGLITR-DFA 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|238026482|ref|YP_002910713.1| coproporphyrinogen III oxidase [Burkholderia glumae BGR1]
 gi|237875676|gb|ACR28009.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia glumae BGR1]
          Length = 406

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/375 (32%), Positives = 209/375 (55%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +Y+H+P+CV+KCPYCDFNSH  +  +  ++ ++ +   +++        R + ++F 
Sbjct: 28  PLALYIHFPWCVRKCPYCDFNSHEWKGERFPEQEYLDALRADLEQALPFVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSIG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H++++A AA+ +A + F   + DL++ALP Q++ +   +++ AL+
Sbjct: 148 IQSFNEAHLKALGRIHDSAQARAAVEIAASRFDNFNLDLMFALPNQSLDECRADIETALA 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           YA  HLSLY LT+E  T+F K        +P ++ + D+ +     T+  G   YE+S +
Sbjct: 208 YAPPHLSLYHLTLEPNTMFAKFPP----AVPDDDASADMQDWIHERTAEAGYGHYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AQPHRQCRHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E+  +       EF++  LRL EG  V  +    G             +R+G I+R  F 
Sbjct: 323 EEREVGPRDLPFEFMLNTLRLVEGFPVASYAERTGLPFSTIEPALAEAERRGLIQR-DFE 381

Query: 375 RLRCTQRGMTMLDSV 389
           R+  T  G   L+ +
Sbjct: 382 RIAPTPLGQRFLNDL 396


>gi|311106530|ref|YP_003979383.1| oxygen-independent coproporphyrinogen III oxidase 2 [Achromobacter
           xylosoxidans A8]
 gi|310761219|gb|ADP16668.1| oxygen-independent coproporphyrinogen III oxidase 2 [Achromobacter
           xylosoxidans A8]
          Length = 406

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 217/375 (57%), Gaps = 9/375 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L VYVH P+CV+KCPYCDFNSH    ++ +  ++ +  ++++        R + S+F GG
Sbjct: 32  LSVYVHVPWCVRKCPYCDFNSHAAPGEIPERAYLDALRSDLEQALPSIWGRQVVSVFIGG 91

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +L  +     +  + EIT+EANP + E   F+ Y  +GV R SLG+Q
Sbjct: 92  GTPSLLSSEGLDELLAMLRACLNLWPDAEITMEANPGTAEAGRFRDYAASGVTRFSLGIQ 151

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           S ++  L+ LGR H++++A AAI +A+    R++ D+++ALP QT+     +L++A+++ 
Sbjct: 152 SFDDAQLKKLGRIHDSAQARAAIEMAQRAVSRVNLDMMFALPGQTLEACVADLRQAVAFG 211

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++  +A GL  YE+S ++ 
Sbjct: 212 TEHLSLYHLTMEPNTVFAKFPPED---LPDDDTSAAMQDAVEAELAAAGLARYEVSAYAK 268

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK--MVRKNGHAVV 316
            GA   HNLNYW +GDY+G+GPGAH ++      +  +  + P+SW++  M R   H + 
Sbjct: 269 PGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRILREARLRSPDSWMQAAMARDGSH-IA 327

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGFIERVQFS 374
           E   +  ++   EF++  LRL++G++   +    G +L     +     ++G ++    +
Sbjct: 328 ESRQVGPDELPFEFMLNALRLKDGVAATAFNERTGLSLAAIAHQLEAASKRGLLD-ADPT 386

Query: 375 RLRCTQRGMTMLDSV 389
           RLR T  G   L+ +
Sbjct: 387 RLRATPLGWRFLNDL 401


>gi|283835284|ref|ZP_06355025.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Citrobacter youngae ATCC 29220]
 gi|291068442|gb|EFE06551.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Citrobacter youngae ATCC 29220]
          Length = 378

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/376 (35%), Positives = 207/376 (55%), Gaps = 14/376 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDSEVAHAQGREVKTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +  +LDG+     ++++ EIT+EANP +VE N F  Y++AGVNRIS+GVQ
Sbjct: 67  GTPSLLSGPAMQTLLDGVRARLKLAADAEITMEANPGTVEANRFVDYQRAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L  LGR H   EA  A HLA  +  R  + DL++ LP QT+ +   +LQ+A++ 
Sbjct: 127 SFSSAKLERLGRIHGPEEAKRAAHLASGLGLRSFNLDLMHGLPDQTLDEALGDLQQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH +V     R+  + + +HP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPDGRILRTTKTRHPRGYMQ-----GRYLE 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGFIERVQFS 374
            +  ++   +  EF M   RL E     ++    G   D+  ++      QG++      
Sbjct: 298 SQRDVAEADKPFEFFMNRFRLLEAAPRAEFTQYTGLAEDVIRQQIDEAIAQGYLSECD-E 356

Query: 375 RLRCTQRGMTMLDSVI 390
             + TQ G   L+S++
Sbjct: 357 YWQITQHGKLFLNSLL 372


>gi|325576990|ref|ZP_08147561.1| coproporphyrinogen dehydrogenase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160948|gb|EGC73067.1| coproporphyrinogen dehydrogenase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 382

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 200/345 (57%), Gaps = 17/345 (4%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPR 69
           Q    L +YVH P+CV+KCPYCDFNSH ++  + ++ ++Q  + +++      +     R
Sbjct: 2   QKFPPLSLYVHIPWCVQKCPYCDFNSHAQKGAIPEQEYVQHLIADLEADLEKYQASIQNR 61

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + SIF GGGTPSL   ++I L+L  I +    S N+EIT+EANP +VE   F+GY  AG
Sbjct: 62  PLHSIFIGGGTPSLFSAESIKLLLAEIQRRIPFSENIEITMEANPGTVEAERFKGYVDAG 121

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWE 188
           V RIS+G+QS  +  L+ LGR HNA+EA +A+ LA+ +     + DL++ LP QT+ +  
Sbjct: 122 VTRISMGIQSFNDDKLQRLGRIHNAAEAKSAVSLAKVSGLKSFNLDLMHGLPNQTLEEAL 181

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHG 247
            +L++A+  A  HLS YQLTIE  T+F Y+        LP ++   D++     + +  G
Sbjct: 182 DDLRQAIELAPPHLSWYQLTIEPNTMFAYR-----PPTLPDDDELWDIFEQGHQLLTEAG 236

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLK 306
              YE S ++  G +  HNLNYWR+GDY+ IG GAH ++     ++   S  KHP+ +L+
Sbjct: 237 YQQYETSAYAKPGFQCQHNLNYWRFGDYLAIGCGAHGKLTFSDGKILRFSKTKHPKGYLR 296

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
                G  + E++ +    +A EF M   RL E +  +++E   G
Sbjct: 297 -----GEYLYEEKNVEKNDRAFEFFMNRFRLLEAVPKQEFEHYTG 336


>gi|309972380|gb|ADO95581.1| Putative oxidase [Haemophilus influenzae R2846]
          Length = 383

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +      YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMADYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +S   +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVSEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|229846549|ref|ZP_04466657.1| coproporphyrinogen III oxidase [Haemophilus influenzae 7P49H1]
 gi|229810642|gb|EEP46360.1| coproporphyrinogen III oxidase [Haemophilus influenzae 7P49H1]
          Length = 383

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGIMRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|296137100|ref|YP_003644342.1| oxygen-independent coproporphyrinogen III oxidase [Thiomonas
           intermedia K12]
 gi|295797222|gb|ADG32012.1| oxygen-independent coproporphyrinogen III oxidase [Thiomonas
           intermedia K12]
          Length = 429

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/326 (37%), Positives = 191/326 (58%), Gaps = 7/326 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRY--KVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
            L +YVH P+C+KKCPYCDFNSH  R    + ++ ++ +   ++     L   R + S+F
Sbjct: 46  PLSLYVHLPWCLKKCPYCDFNSHEWRAGGSIPEQAYLAALRADLDAALPLVWGRRVISVF 105

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P+ I  ++  +     + ++ EIT+EANP + E + F  + +AGVNR+S+
Sbjct: 106 IGGGTPSLFSPEAIDQLITDVRARLPLVADAEITLEANPGTFERDRFAAFAQAGVNRLSI 165

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS ++  LR LGR H+A +A  A+  A   F   + DL++ALP+Q M   + ++  AL
Sbjct: 166 GVQSFDDDRLRALGRVHDARQAHDAVAEAARHFASFNLDLMFALPQQDMPGCKADVHEAL 225

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++   HLSLYQLT+E  TLF +        LP +++  D+ +    +  A GL  YE+S 
Sbjct: 226 AHQPPHLSLYQLTLEPNTLFARHPPP----LPDDDLTADMQHAVADLAEAAGLQRYEVSA 281

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G    HNLNYW++GDY+GIG GAHS++      V  +  +HP+ +++     G AV
Sbjct: 282 YAAPGHRCRHNLNYWQFGDYVGIGAGAHSKLTFAHRIVRQTRWRHPQRYMEQA-AQGLAV 340

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGI 341
             +  +S      EF++  LRLREG+
Sbjct: 341 ETEVEVSRSDLPFEFMLNALRLREGV 366


>gi|168236172|ref|ZP_02661230.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194737657|ref|YP_002116052.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194713159|gb|ACF92380.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290675|gb|EDY30029.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 378

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 191/324 (58%), Gaps = 11/324 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDADVAWAQGREVKTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    + ++LDG+     ++++ EIT+EANP +VE + F  Y++AGVNRIS+GV
Sbjct: 66  GGTPSLLSGPAMQMLLDGVRARLNLAADAEITMEANPGTVEADRFIDYQRAGVNRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS  E  L+ LGR H   EA+ A  LA  +  R  + DL++ LP QT+ +   +L++A++
Sbjct: 126 QSFSEPKLKRLGRIHGPQEAMRAARLANGLGLRSFNLDLMHGLPDQTLEEALNDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH +V     R+  + + +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPGGRILRTTKTRHPRGYMQ-----GRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLRE 339
             +  +S + +  EF M   RL E
Sbjct: 297 ESQRDVSDDDKPFEFFMNRFRLLE 320


>gi|320539541|ref|ZP_08039208.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Serratia symbiotica str. Tucson]
 gi|320030394|gb|EFW12406.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Serratia symbiotica str. Tucson]
          Length = 392

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 138/380 (36%), Positives = 211/380 (55%), Gaps = 22/380 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   + ++     L G R IS++F GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLMADLNADLPLAGDREISTLFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V+ + EIT+EANP +VE + F GY+ AGVNRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQSLLDGVRSRIRVADDAEITMEANPGTVEADRFSGYQHAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H A EA  + HLA  +  R  + DL++ LP Q++     +L++A++ 
Sbjct: 127 SFNAEMLIRLGRIHGAEEAKRSAHLATGLGLRSFNLDLMHGLPDQSLEDALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF         VLP ++   D++     + S  G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFEQGHQLLSDAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLK-MVRKNGHAV 315
             G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +++   R   H V
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTAKTKHPRGFMQGKYRDKQHEV 302

Query: 316 V--EKEFLSSEQQADEFLMMGLRLREGISVKD---WEMLAGRNLDIECERNLQRQGFIER 370
           V  ++ F        EF M   RL E     D   +  LA   +  + E  L +    E 
Sbjct: 303 VLADRPF--------EFFMNRFRLLEAAPRADFVNYTGLAESAIRAQLEEALMKGYLKET 354

Query: 371 VQFSRLRCTQRGMTMLDSVI 390
            ++ ++  T++G   L++++
Sbjct: 355 PEYWQI--TEQGKLFLNALL 372


>gi|237745874|ref|ZP_04576354.1| coproporphyrinogen III oxidase [Oxalobacter formigenes HOxBLS]
 gi|229377225|gb|EEO27316.1| coproporphyrinogen III oxidase [Oxalobacter formigenes HOxBLS]
          Length = 402

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 209/375 (55%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+C++KCPYCDF SH +   + +  +++    +++    L   R ISSIF G
Sbjct: 27  PLSLYIHIPWCIRKCPYCDFYSHEKTSVLPENEYLKVLRRDLELSLPLIENRKISSIFIG 86

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     I  +L  + +   V  + EI++EANP + E   FQ YR++G+NR+S+GV
Sbjct: 87  GGTPSLFSAGGIDKLLSFVRELLPVLPDAEISLEANPGTFEAGKFQSYRRSGINRLSIGV 146

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS  ++ L  LGR H+A EA AA+  A + F   + DL+Y LP QT+ Q + ++  ALSY
Sbjct: 147 QSFTQERLHELGRIHDADEARAAVETAGHYFDNFNLDLMYGLPFQTLDQLKDDVSIALSY 206

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T ++K       VLP E+   ++    ++ T+A G   YE+S ++
Sbjct: 207 KPAHLSFYQLTIEPNTYYFKHPP----VLPDEDAIDEMQTWIETSTAATGYEHYEVSAYA 262

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G + LHN NYW +GDY+GIG  AHS++ +   R+   +  ++P  +++ + K G  + 
Sbjct: 263 RSGRQCLHNRNYWLFGDYLGIGAAAHSKITLPDQRIIRQMRLRNPHLYMQGI-KQGIPLE 321

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           E+  +       EF++  LRL +G S   +    G  L +  +  L R   +  +  S L
Sbjct: 322 EQFEVPVSDLGFEFMLNALRLTDGFSPALFRERTGLPLSV-IDEGLARAAHLGLLHISPL 380

Query: 377 --RCTQRGMTMLDSV 389
             R T+ G   L+ +
Sbjct: 381 HIRPTELGKRFLNDL 395


>gi|332162816|ref|YP_004299393.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667046|gb|ADZ43690.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 376

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 212/377 (56%), Gaps = 16/377 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLDVDVPLVSGREISTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQQLLDGVRARLPLAIDAEITMEANPGAVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFSAEKLTRLGRIHGPDEAKRAAELATSLELRSFNLDLMHGLPDQSLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T F          LP ++   D++     + SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTGFSSRPP----TLPDDDALWDIFQQGHQLLSAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +I+ KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFRDGRILRTIKTKHPRGFMQ-----GKYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERVQF 373
           ++  + +  +  EF M   RL E     D+    G     +  + +  L ++  IE  ++
Sbjct: 298 KQYEVEAADRPFEFFMNRFRLLEAAPRADFTHFTGLAESTIRPQLDEALAKEYLIETEEY 357

Query: 374 SRLRCTQRGMTMLDSVI 390
            ++  T++G   L+S++
Sbjct: 358 WQI--TEKGKLFLNSLL 372


>gi|301155284|emb|CBW14750.1| predicted oxidoreductase [Haemophilus parainfluenzae T3T1]
          Length = 382

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 200/345 (57%), Gaps = 17/345 (4%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQW----MRQLTGPR 69
           Q    L +YVH P+CV+KCPYCDFNSH ++  + ++ ++Q  + +++      +     R
Sbjct: 2   QKFPPLSLYVHIPWCVQKCPYCDFNSHAQKGAIPEQEYVQHLIADLEAGLDKYQASIQNR 61

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            + SIF GGGTPSL   ++I L+L  I +    S N+EIT+EANP +VE   F+GY  AG
Sbjct: 62  PLHSIFIGGGTPSLFSAESIKLLLAEIQRRIPFSENIEITMEANPGTVEAERFKGYVDAG 121

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWE 188
           V RIS+G+QS  +  L+ LGR HNA+EA +A+ LA+ +     + DL++ LP QT+ +  
Sbjct: 122 VTRISMGIQSFNDDKLQRLGRIHNAAEAKSAVSLAKVSGLKSFNLDLMHGLPNQTLEEAL 181

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHG 247
            +L++A+  A  HLS YQLTIE  T+F Y+  K     LP ++   D++     + +  G
Sbjct: 182 DDLRQAIELAPPHLSWYQLTIEPNTMFAYRPPK-----LPDDDELWDIFEQGHQLLTEAG 236

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLK 306
              YE S ++  G +  HNLNYWR+GDY+ IG GAH ++      +   S  KHP+ +L+
Sbjct: 237 YQQYETSAYAKPGFQCQHNLNYWRFGDYLAIGCGAHGKLTFPDGDILRFSKTKHPKGYLR 296

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
                G  + E++ +    +A EF M   RL E +  +++E   G
Sbjct: 297 -----GEYLYEEKNVEKNDRAFEFFMNRFRLLEAVPKQEFEHYTG 336


>gi|68249065|ref|YP_248177.1| coproporphyrinogen III oxidase [Haemophilus influenzae 86-028NP]
 gi|68057264|gb|AAX87517.1| predicted Fe-S oxidoreductase [Haemophilus influenzae 86-028NP]
          Length = 383

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGIMRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|254237379|ref|ZP_04930702.1| hypothetical protein PACG_03453 [Pseudomonas aeruginosa C3719]
 gi|126169310|gb|EAZ54821.1| hypothetical protein PACG_03453 [Pseudomonas aeruginosa C3719]
          Length = 384

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 134/383 (34%), Positives = 217/383 (56%), Gaps = 24/383 (6%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLTGPRSISSIFF 76
            L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L ++ Q +R + G R + SIFF
Sbjct: 11  PLALYVHIPWCVRKCPYCDFNSHAAGTELPEEAYVDALLADLEQDLRHVHG-RRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++  AHG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDAHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+         +W   + K+ +  
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIV-------RTWKTRLPKD-YLN 297

Query: 316 VEKEFLSSE---QQAD---EFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGF 367
            +K F + E   + AD   EF+M  LRL +G+    +    G+ L    +     +  G 
Sbjct: 298 PQKAFQAGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGL 357

Query: 368 IERVQFSRLRCTQRGMTMLDSVI 390
           +      RLR ++RG   L+ ++
Sbjct: 358 LAD-DPQRLRPSERGQLFLNDLL 379


>gi|268593076|ref|ZP_06127297.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Providencia rettgeri DSM 1131]
 gi|291311345|gb|EFE51798.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Providencia rettgeri DSM 1131]
          Length = 379

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 192/335 (57%), Gaps = 11/335 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + ++ Q+ ++   L ++    +L   RS+ +IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHTLKGEIPQQEYVAHLLADLDIDAKLVAGRSVKTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  +++  ++DG+ +   +  + E+T+EANP +VE   F GY+ AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAESMQALMDGVRQRVDLDPHAEVTMEANPGTVEAGRFAGYQAAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S     L  LGR H A EA  A  LA N+  R  + DL++ LP QT  +   +L++A+  
Sbjct: 127 SFGNDKLITLGRIHGADEAKRAAQLATNLNLRSFNLDLMHGLPAQTQVEGLSDLRQAIEL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A  HLS YQLTIE  T F         VLP ++   D+Y     + SA G   YE S ++
Sbjct: 187 APPHLSWYQLTIEPNTQFGSRPP----VLPDDDTLWDIYTEGHKLLSAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     ++  +++ KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKISFEDGQILRTVKTKHPRGYME-----GRYMH 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +   + +  +  E+ M   RL E +   ++    G
Sbjct: 298 QSYDVDASDRPFEYFMNRFRLLEAMPRAEFTQYTG 332


>gi|213424104|ref|ZP_03356997.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 573

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 190/323 (58%), Gaps = 11/323 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF GG
Sbjct: 202 LSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDADVAWAQGREVKTIFIGG 261

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+    +  +LDG+     ++++ EIT+EANP +VE + F  Y++AGVNRIS+GVQ
Sbjct: 262 GTPSLLSGPAMQTLLDGVRARLNLAADAEITMEANPGTVEADRFIDYQRAGVNRISIGVQ 321

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S  E  L+ LGR H   EA+ A  LA  +  R  + DL++ LP QT+ +   +L++A++ 
Sbjct: 322 SFSEPKLKRLGRIHGPQEAMRAARLANGLGLRSFNLDLMHGLPDQTLEEALNDLRQAIAL 381

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S ++
Sbjct: 382 NPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAYA 437

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH +V     R+  + + +HP  +++     G  + 
Sbjct: 438 KPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPDGRILRTTKTRHPRGYMQ-----GRYLE 492

Query: 317 EKEFLSSEQQADEFLMMGLRLRE 339
            +  +S + +  EF M   RL E
Sbjct: 493 SQRDVSDDDKPFEFFMNRFRLLE 515


>gi|145632729|ref|ZP_01788463.1| coproporphyrinogen III oxidase [Haemophilus influenzae 3655]
 gi|144986924|gb|EDJ93476.1| coproporphyrinogen III oxidase [Haemophilus influenzae 3655]
          Length = 383

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 127/340 (37%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +YVH P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     R + SI
Sbjct: 7   LSLYVHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKNSIQQRKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSSESIAHLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVLAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|327395109|dbj|BAK12531.1| oxygen-independent coproporphyrinogen III oxidase- like protein
           YggW [Pantoea ananatis AJ13355]
          Length = 379

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 123/336 (36%), Positives = 195/336 (58%), Gaps = 11/336 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L +++    L   R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKDEVPHVEYVQHLLRDLEHDLPLIQGREVRTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    + +++DG+ +  T++++ E+T+EANP +VE + F  Y++AG+NRIS+GV
Sbjct: 66  GGTPSLLSSSAMQMLMDGVRERLTLTADAEVTMEANPGTVEADRFSAYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS   Q L  LGR H   EA  A  LA+ +  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFSPQKLERLGRIHGPEEAKRAAALAQGLGLRSFNLDLMHGLPDQSLAEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF          LP ++   D++     + +A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----TLPDDDALWDIFEQGHQLLTAAGYEQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G    HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  ++K     G+ +
Sbjct: 242 AKPGYRCEHNLNYWRFGDYLGIGCGAHGKLTQPDGRIVRTVKVRHPRGFMK-----GNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            ++  ++ E +  EF M   RL E     D+    G
Sbjct: 297 DKQYDVADEDKPFEFFMNRFRLLEAAPRADFSRYTG 332


>gi|304396762|ref|ZP_07378642.1| oxygen-independent coproporphyrinogen III oxidase [Pantoea sp. aB]
 gi|304355558|gb|EFM19925.1| oxygen-independent coproporphyrinogen III oxidase [Pantoea sp. aB]
          Length = 379

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 195/337 (57%), Gaps = 13/337 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L +++    L G R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKDEVPHVEYVQHLLRDLEIDLPLIGDREVRTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    + +++DG+    T+S + E+T+EANP +VE + F  Y++AG+NRIS+GV
Sbjct: 66  GGTPSLLSSSAMQMLMDGVRARLTLSPDAEVTMEANPGTVEADRFSAYQRAGINRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS   Q L+ LGR H   EA+ A  LA ++  R  + DL++ LP Q++ +   +L++A++
Sbjct: 126 QSFSPQKLQRLGRIHGPEEAVRAAELAESLSLRSFNLDLMHGLPDQSLEEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     +  A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGDQLLQAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G    HNLNYWR+GDY+GIG GAH ++     R+  +++ +HP  +++   +     
Sbjct: 242 AKPGYRCEHNLNYWRFGDYLGIGCGAHGKLTQPDGRIVRTVKTRHPRGFMQGNYR----- 296

Query: 316 VEKEF-LSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            EK++ ++   +  E+ M   RL E     ++    G
Sbjct: 297 -EKQYDVADSDKPFEYFMNRFRLLEAAPRDEFSRYTG 332


>gi|157372269|ref|YP_001480258.1| coproporphyrinogen III oxidase [Serratia proteamaculans 568]
 gi|157324033|gb|ABV43130.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Serratia proteamaculans 568]
          Length = 379

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 126/324 (38%), Positives = 188/324 (58%), Gaps = 11/324 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   L ++     L   R +S+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLLADLDADLPLVAGREVSTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     V    EIT+EANP +VE + F GY++AGVNRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQSLLDGVRARIHVVDGAEITMEANPGTVEADRFSGYQRAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFSAEKLTRLGRIHGPEEAKRAAHLATGLGLRSFNLDLMHGLPDQSLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  TLF         VLP ++   D++     + SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFERGHELLSAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTAKTKHPRGFMQ-----GKYMD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREG 340
           ++  +++  +  EF M   RL E 
Sbjct: 298 KQHEVTTADRPFEFFMNRFRLLEA 321


>gi|66043738|ref|YP_233579.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254445|gb|AAY35541.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas syringae pv. syringae B728a]
          Length = 404

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 210/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFQESKLKALGRIHNGDEAIRAADMARRAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L     +    
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIVRTWKTRLPKDYLN---PDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|238918242|ref|YP_002931756.1| coproporphyrinogen III oxidase [Edwardsiella ictaluri 93-146]
 gi|238867810|gb|ACR67521.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 376

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 213/378 (56%), Gaps = 16/378 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH ++ ++ Q+ ++   L ++         R+IS++F G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHAQKGEIPQQAYVDHLLADLDQELPRVAGRTISTLFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+  + +  +LDG+     ++++ EIT+EANP +VE   F  Y++AGVNRIS+GV
Sbjct: 66  GGTPSLLSGEALQHLLDGVRARLPLAADAEITMEANPGTVEAERFSAYQRAGVNRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS     L+ LGR H   EAIAA  LAR +  R  + DL++ LP+Q+  +   +L++A++
Sbjct: 126 QSFSADKLQRLGRIHGPQEAIAAARLARTLGLRSFNLDLMHGLPQQSREEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF          LP ++   +++     +    G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPPR----LPDDDALWEIFEQGDRLLRESGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+    + +HP  +++     G+ +
Sbjct: 242 ALPGRQCQHNLNYWRFGDYLGIGCGAHGKLTFADGRIERHAKTRHPRGYMQ-----GNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN---LDIECERNLQRQGFIERVQ 372
            +++ ++  ++  EF M   RL E     D+    G +   +  + E  L  QG+I R  
Sbjct: 297 DQRQQVAMAERPFEFFMNRFRLLEPAPRADFSAYTGVDQATIRPQLEAALT-QGYI-RET 354

Query: 373 FSRLRCTQRGMTMLDSVI 390
            S  + T  G   L+S++
Sbjct: 355 PSHWQVTPHGKLFLNSLL 372


>gi|317403014|gb|EFV83552.1| porphyrin oxidoreductase [Achromobacter xylosoxidans C54]
          Length = 407

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 215/375 (57%), Gaps = 8/375 (2%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
           L VYVH P+CV+KCPYCDFNSH     ++ +  ++ +  ++++        R + S+F G
Sbjct: 32  LSVYVHVPWCVRKCPYCDFNSHAAPGGEIPERAYLDALRSDLEQALPSIWGRQVVSVFIG 91

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +L  +     V  + EIT+EANP + E   F+ Y  +GV R SLG+
Sbjct: 92  GGTPSLLSAAGLDELLAMLRACLNVWPDAEITMEANPGTAEAGRFRDYAASGVTRFSLGI 151

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS ++  L+ LGR H++++A AAI +A+   PR++ D+++ALP QT+     +L++A+ +
Sbjct: 152 QSFDDAQLKKLGRIHDSAQARAAIEMAQRAAPRVNLDMMFALPGQTLAACVDDLRQAIGF 211

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++  +A GL  YE+S ++
Sbjct: 212 GTEHLSLYHLTMEPNTVFAKFPPED---LPDDDTSAAMQDAVEAELAAAGLARYEVSAYA 268

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK-MVRKNGHAVV 316
             GA   HNLNYW +GDY+G+GPGAH ++      V  +  + PESWL+    ++G  + 
Sbjct: 269 RPGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRIVREARLRSPESWLRAAAARDGSHLA 328

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER--NLQRQGFIERVQFS 374
           E   +  ++   EF++  LRL++G++   +    G +L     +      +G ++    +
Sbjct: 329 ESRQVGPDELPFEFMLNALRLKDGVAATLFNERTGLSLAAIAHQLEAASAKGLLD-ADPT 387

Query: 375 RLRCTQRGMTMLDSV 389
           RLR T  G   L+ +
Sbjct: 388 RLRATPLGWRFLNDL 402


>gi|304309823|ref|YP_003809421.1| Oxygen-independent coproporphyrinogen III oxidase [gamma
           proteobacterium HdN1]
 gi|301795556|emb|CBL43754.1| Oxygen-independent coproporphyrinogen III oxidase [gamma
           proteobacterium HdN1]
          Length = 396

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 141/381 (37%), Positives = 208/381 (54%), Gaps = 14/381 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH +   V + ++I   L ++         R + SIF G
Sbjct: 13  PLSLYVHIPWCVRKCPYCDFNSH-QAIDVNEPHYIDCLLDDLDRDLHWVQERPLHSIFIG 71

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL   ++I  ++ GI +   +  ++EIT+EANP + E   F GYR+ GVNR+S+GV
Sbjct: 72  GGTPSLFSAESITRLIKGIQQRIALEPSIEITLEANPGTAEQARFYGYREGGVNRLSIGV 131

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS     L+ LGR HN   A AAI LAR+  F   + DL++ LP Q++     +LQ AL 
Sbjct: 132 QSFNTDHLQRLGRIHNGDNAKAAIQLARDAGFENFNIDLMHGLPGQSLNHALDDLQTALQ 191

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLS YQLTIE  T+FY         LP ++   D+     ++   +G++ YE+S +
Sbjct: 192 FQPPHLSWYQLTIEPNTVFYNAPPK----LPEDDTLWDIQQAGIALLEQYGMNHYEVSAY 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH--PESWLKMVRK-NGH 313
           +  G  S HNLNYW++GDY+GIG GAH ++ V      +   K   P  ++  +      
Sbjct: 248 AKAGRRSRHNLNYWQFGDYLGIGAGAHGKITVRDRGEILRYRKTRLPRDYMAGIDPAKAS 307

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQ---GFIER 370
            +   E + + +   EF M  LRLREG+  K +E   G +L  E    L++    G +E 
Sbjct: 308 YLAATEAVPAPELPFEFFMNALRLREGVPTKLFEQRTGLDLR-EIAPTLEKALALGLLES 366

Query: 371 VQFSRLRCTQRGMTMLDSVIA 391
              S+L  T +G   L+ + A
Sbjct: 367 SP-SQLAPTPQGWLFLNDLTA 386


>gi|321478940|gb|EFX89896.1| hypothetical protein DAPPUDRAFT_299799 [Daphnia pulex]
          Length = 429

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 139/412 (33%), Positives = 227/412 (55%), Gaps = 23/412 (5%)

Query: 2   KYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRR----YKVGQENFIQSFLT 57
           K+ S    ++         +Y HWPFC   C +C FN + +      K+  E   +  + 
Sbjct: 6   KFFSPCSTDILENLKTEATMYFHWPFCKNICTFCSFNKYKKVENSFSKIIDERMEKCLIK 65

Query: 58  EMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSV 117
           E + +   TG + I+SI+FGGGTPSL     I+ I++ + +   V    EITIE NPSS+
Sbjct: 66  ETETILGFTGIKKINSIYFGGGTPSLAPTTTISRIINCVKQLTNVDEQAEITIECNPSSL 125

Query: 118 EVN-NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIF--PRMSFD 174
            +    + Y K G+NR+S+GVQSL++ +L+ LGR+H+A++++  +  A ++F    +S D
Sbjct: 126 SMTKTLEEYFKFGINRVSVGVQSLDDGTLKVLGRDHSANDSVMLLKSALDVFGSDAVSVD 185

Query: 175 LIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVD 234
           L++  P  T+  W+ EL   LSY   H+SLY+LT E+GT  ++  + G +VLP+E+ A  
Sbjct: 186 LLFRKPGDTIQSWKNELNEILSYKPHHISLYELTPERGTPLFRQLQSGTVVLPNEDDAAS 245

Query: 235 LYNLTQSITSAHGLHAYEISNHSFLG--AESLHNLNYWRYGDYIGIGPGAHSR-VKVGSH 291
           +Y L   +   +G   YEISN +  G  A+S HN++YW    Y+GIGPGAHSR   +G++
Sbjct: 246 MYILALELLKEYGFERYEISNFARAGSCAQSSHNMSYWNGTQYVGIGPGAHSRFFPLGAN 305

Query: 292 RVAISIEK-HPESWLKMVRKNGHAVVEKEFLSSEQQAD---EFLMMGLRLREGISVKDWE 347
                ++   P+SW  +V +NGHA         + Q D   E +   LR  +GI  K W 
Sbjct: 306 SRESRVQALDPKSWQDLVERNGHAT---RLCRQQSQIDVLSELVATSLRTTKGIQPKRWL 362

Query: 348 MLAGRN--LDI-ECERNLQRQGFIERVQFS---RLRCTQRGMTMLDSVIANL 393
           +       +D+ E   ++Q       +Q+S    L+ T++G+ ++DS++ N+
Sbjct: 363 IFQPEYSLVDVFEQAPSIQMLFLSGNLQWSVDGSLQATEKGLNVVDSILPNI 414


>gi|330951370|gb|EGH51630.1| HemN family oxidoreductase [Pseudomonas syringae Cit 7]
 gi|330984663|gb|EGH82766.1| HemN family oxidoreductase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 404

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 210/377 (55%), Gaps = 12/377 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFFG
Sbjct: 31  PLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFFG 90

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G+
Sbjct: 91  GGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIGI 150

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A++
Sbjct: 151 QSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAIA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S +
Sbjct: 211 LAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G  + HNLNYW +GD+IGIG GAH ++     R+  + + + P+ +L     +    
Sbjct: 267 AQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMRTWKTRLPKDYLN---PDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQDP- 382

Query: 374 SRLRCTQRGMTMLDSVI 390
           +RL  T +G   L+ ++
Sbjct: 383 TRLIATPQGQLFLNDLL 399


>gi|237729886|ref|ZP_04560367.1| coproporphyrinogen III oxidase [Citrobacter sp. 30_2]
 gi|226908492|gb|EEH94410.1| coproporphyrinogen III oxidase [Citrobacter sp. 30_2]
          Length = 382

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 206/378 (54%), Gaps = 16/378 (4%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF G
Sbjct: 10  PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDTEVAHARGREVKTIFIG 69

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +LDG+     ++ + EIT+EANP +VE + F  Y++AGVNRIS+GV
Sbjct: 70  GGTPSLLSGPAMQTLLDGVRARLNLAEDAEITMEANPGTVEADRFVDYQRAGVNRISIGV 129

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS     L  LGR H   EA  A HLA  +  R  + DL++ LP QT+ +   +LQ+A++
Sbjct: 130 QSFSSAKLERLGRIHGPEEAKRAAHLASGLGLRSFNLDLMHGLPDQTLEEALGDLQQAIA 189

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 190 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAY 245

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + +HP  +++     G  +
Sbjct: 246 ARPGYQCQHNLNYWRFGDYLGIGCGAHGKITFPDGRILRTTKTRHPRGYMQ-----GRYL 300

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQ 372
             +  ++   +  EF M   RL E     ++    G   D+   R +     QG++    
Sbjct: 301 ESQRDVAEADKPFEFFMNRFRLLEAAPRAEFTQYTGLTEDV-IRRQIDEAISQGYLSECD 359

Query: 373 FSRLRCTQRGMTMLDSVI 390
               + TQ G   L+S++
Sbjct: 360 -EYWQITQHGKLFLNSLL 376


>gi|171315532|ref|ZP_02904768.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria MEX-5]
 gi|171099369|gb|EDT44107.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria MEX-5]
          Length = 404

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 126/375 (33%), Positives = 211/375 (56%), Gaps = 9/375 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            L +YVH+P+CV+KCPYCDFNSH  +  +  +  ++ +   +++    L   R + ++F 
Sbjct: 28  PLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVFI 87

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 88  GGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSVG 147

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP Q++ +   +++ ALS
Sbjct: 148 IQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQSLDECRTDIETALS 207

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S +
Sbjct: 208 FAPPHLSLYHLTLEPNTMFAKFPP----AVPDDDASADMQEWIHERTAEAGYGRYEVSAY 263

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++     G  V 
Sbjct: 264 AKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMA-GTPVQ 322

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-DIECE-RNLQRQGFIERVQFS 374
           E+  + +     EF++  LRL EG  V  +    G  +  IE   +  +R+G I R  F+
Sbjct: 323 EEREVGARDLPFEFMLNTLRLVEGFPVHSFVERTGLPIGTIEPALKEAERRGLITR-DFA 381

Query: 375 RLRCTQRGMTMLDSV 389
           ++  T  G   L+ +
Sbjct: 382 QIAPTPLGQRFLNDL 396


>gi|145636269|ref|ZP_01791938.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittHH]
 gi|145270434|gb|EDK10368.1| coproporphyrinogen III oxidase [Haemophilus influenzae PittHH]
          Length = 383

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 125/340 (36%), Positives = 199/340 (58%), Gaps = 17/340 (5%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFI----QSFLTEMQWMRQLTGPRSISSI 74
           L +Y+H P+CV+KCPYCDFNSH ++  + ++++I    Q    ++Q  +     + + SI
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQDLQADLQRFKDSIQQQKLHSI 66

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL   ++IA +L  I K      N+EIT+EANP +VE   F+GY  AG+ RIS
Sbjct: 67  FIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEANPGTVEAERFKGYVSAGITRIS 126

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQR 193
           +G+QS  +  L+ LGR HNA+EA +A++LA+ +     + DL++ LP QT+ +   +L++
Sbjct: 127 MGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFNLDLMHGLPNQTLEEALDDLRQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLF-YKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           A+  +  H+S YQLTIE  T+F Y+  K     LP ++   D++     + +  G   YE
Sbjct: 187 AIELSPPHISWYQLTIEPNTMFAYRPPK-----LPDDDALWDIFEQGHQLLTMAGYQQYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVA-ISIEKHPESWLKMVRKN 311
            S ++  G +  HNLNYWR+GDY+ IG GAH ++   +  +   S  KHP+ +L+     
Sbjct: 242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLR----- 296

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           G  + E++ +    +  EF M   RL E +  +++E   G
Sbjct: 297 GEYLYEEKNVPEIDRPFEFFMNRFRLLEAVPKQEFEDYTG 336


>gi|16761879|ref|NP_457496.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143366|ref|NP_806708.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415042|ref|YP_152117.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197363971|ref|YP_002143608.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|213051776|ref|ZP_03344654.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213580617|ref|ZP_03362443.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213609097|ref|ZP_03368923.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648210|ref|ZP_03378263.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213850156|ref|ZP_03381054.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289825936|ref|ZP_06545095.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25284568|pir||AH0878 probable oxygen-independent coproporphyrinogen III oxidase
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16504181|emb|CAD02928.1| possible oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139000|gb|AAO70568.1| possible oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56129299|gb|AAV78805.1| possible oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197095448|emb|CAR61007.1| possible oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
          Length = 378

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 190/324 (58%), Gaps = 11/324 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDADVAWAQGREVKTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +LDG+     ++++ EIT+EANP +VE + F  Y++AGVNRIS+GV
Sbjct: 66  GGTPSLLSGPAMQTLLDGVRARLNLAADAEITMEANPGTVEADRFIDYQRAGVNRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS  E  L+ LGR H   EA+ A  LA  +  R  + DL++ LP QT+ +   +L++A++
Sbjct: 126 QSFSEPKLKRLGRIHGPQEAMRAARLANGLGLRSFNLDLMHGLPDQTLEEALNDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH +V     R+  + + +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPDGRILRTTKTRHPRGYMQ-----GRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLRE 339
             +  +S + +  EF M   RL E
Sbjct: 297 ESQRDVSDDDKPFEFFMNRFRLLE 320


>gi|318604343|emb|CBY25841.1| radical SAM family enzyme, similar to coproporphyrinogen III
           oxidase, oxygen-independent,clustered with
           nucleoside-triphosphatase RdgB [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 376

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 212/377 (56%), Gaps = 16/377 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLDVDVPLVSGREISTIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+GVQ
Sbjct: 67  GTPSLLSAEAMQQLLDGVRARLPLAIDAEITMEANPGAVEADRFSGYQRAGINRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALSY 197
           S   + L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A++ 
Sbjct: 127 SFSAEKLTRLGRIHGPYEAKRAAELATSLELRSFNLDLMHGLPDQSLEEALDDLRQAIAL 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLTIE  T F          LP ++   D++     + SA G   YE S ++
Sbjct: 187 NPPHLSWYQLTIEPNTGFSSRPP----TLPDDDALWDIFQQGHQLLSAAGYQQYETSAYA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAVV 316
             G +  HNLNYWR+GDY+GIG GAH ++     R+  +I+ KHP  +++     G  + 
Sbjct: 243 KPGYQCQHNLNYWRFGDYLGIGCGAHGKITFRDGRILRTIKTKHPRGFMQ-----GKYLD 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERVQF 373
           ++  + +  +  EF M   RL E     D+    G     +  + +  L ++  IE  ++
Sbjct: 298 KQYEVEAADRPFEFFMNRFRLLEAAPRADFTHFTGLAESTIRPQLDEALAKEYLIETEEY 357

Query: 374 SRLRCTQRGMTMLDSVI 390
            ++  T++G   L+S++
Sbjct: 358 WQI--TEKGKLFLNSLL 372


>gi|168264450|ref|ZP_02686423.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168819866|ref|ZP_02831866.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205343497|gb|EDZ30261.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205347072|gb|EDZ33703.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|322613501|gb|EFY10442.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621093|gb|EFY17951.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624157|gb|EFY20991.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628104|gb|EFY24893.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633223|gb|EFY29965.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636199|gb|EFY32907.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639537|gb|EFY36225.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647530|gb|EFY44019.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648714|gb|EFY45161.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653769|gb|EFY50095.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657875|gb|EFY54143.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663978|gb|EFY60177.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669011|gb|EFY65162.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672995|gb|EFY69102.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678014|gb|EFY74077.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681190|gb|EFY77223.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687880|gb|EFY83847.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323194924|gb|EFZ80111.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199628|gb|EFZ84718.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202625|gb|EFZ87665.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207888|gb|EFZ92834.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212560|gb|EFZ97377.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214957|gb|EFZ99705.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222687|gb|EGA07052.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225430|gb|EGA09662.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230555|gb|EGA14673.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235094|gb|EGA19180.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239133|gb|EGA23183.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244509|gb|EGA28515.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247124|gb|EGA31090.1| HemN family oxidoreductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253393|gb|EGA37222.1| HemN family oxidoreductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256300|gb|EGA40036.1| HemN family oxidoreductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262524|gb|EGA46080.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267380|gb|EGA50864.1| HemN family oxidoreductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269216|gb|EGA52671.1| HemN family oxidoreductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 378

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 190/324 (58%), Gaps = 11/324 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF G
Sbjct: 6   PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDADVAWAQGREVKTIFIG 65

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +LDG+     ++++ EIT+EANP +VE + F  Y++AGVNRIS+GV
Sbjct: 66  GGTPSLLSGPAMQTLLDGVRARLNLAADAEITMEANPGTVEADRFIDYQRAGVNRISIGV 125

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS  E  L+ LGR H   EA+ A  LA  +  R  + DL++ LP QT+ +   +L++A++
Sbjct: 126 QSFSEPKLKRLGRIHGPQEAMRAARLANGLGLRSFNLDLMHGLPDQTLEEALNDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH +V     R+  + + +HP  +++     G  +
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPGGRILRTTKTRHPRGYMQ-----GRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLRE 339
             +  +S + +  EF M   RL E
Sbjct: 297 ESQRDVSDDDKPFEFFMNRFRLLE 320


>gi|320087536|emb|CBY97301.1| putative oxidase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 382

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 190/324 (58%), Gaps = 11/324 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF G
Sbjct: 10  PLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDADVAWAQGREVKTIFIG 69

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+    +  +LDG+     ++++ EIT+EANP +VE + F  Y++AGVNRIS+GV
Sbjct: 70  GGTPSLLSGPAMQTLLDGVRARLNLAADAEITMEANPGTVEADRFIDYQRAGVNRISIGV 129

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRALS 196
           QS  E  L+ LGR H   EA+ A  LA  +  R  + DL++ LP QT+ +   +L++A++
Sbjct: 130 QSFSEPKLKRLGRIHGPQEAMRAARLANGLGLRSFNLDLMHGLPDQTLEEALNDLRQAIA 189

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 190 LNPPHLSWYQLTIEP