BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase
[Candidatus Liberibacter asiaticus str. psy62]
         (395 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040305|gb|ACT57101.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 395

 Score =  318 bits (815), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 395/395 (100%), Positives = 395/395 (100%)

Query: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ
Sbjct: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN
Sbjct: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
           NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP
Sbjct: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
           KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ
Sbjct: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
           SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH
Sbjct: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER
Sbjct: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
Sbjct: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395


>gi|163757814|ref|ZP_02164903.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
 gi|162285316|gb|EDQ35598.1| coproporphyrinogen III oxidase [Hoeflea phototrophica DFL-43]
          Length = 414

 Score =  299 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 212/391 (54%), Positives = 281/391 (71%), Gaps = 1/391 (0%)

Query: 5   SAYENNMT-GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMR 63
           +A+++ +    G     VY+HWPFC  KCPYCDFNSHVR   + Q+ +I +F  E+  MR
Sbjct: 23  NAFKDGLAPDTGKPGFAVYLHWPFCAAKCPYCDFNSHVRHEGIDQQAYIDAFRAEIAAMR 82

Query: 64  QLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQ 123
           +L+GP+ ++SIFFGGGTPSL+ P+ +A ILD + + W V   +EIT+EANPSSVE   F+
Sbjct: 83  KLSGPQVVTSIFFGGGTPSLMHPETVAAILDAVHETWVVPEGIEITLEANPSSVEAGRFR 142

Query: 124 GYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQT 183
           GYR AGVNR+S+GVQ+L ++ L+ LGR H+ +EA+ AI LAR+IFPRMSFDLIYA P QT
Sbjct: 143 GYRAAGVNRVSMGVQALNDRDLKRLGRLHDRAEALRAIGLARDIFPRMSFDLIYARPDQT 202

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
              WE EL+ A+S A DHLSLYQLTIE+GT FY +HK G L++P  +++ +LY LTQS+ 
Sbjct: 203 PHAWEAELKEAISLAADHLSLYQLTIEEGTPFYGLHKAGKLIVPDGDLSAELYELTQSVC 262

Query: 244 SAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPES 303
            AHGL AYE+SNH+  GAES HNL YWRYGDY GIGPGAH R+   + ++A + E+ PE+
Sbjct: 263 EAHGLPAYEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTTSAGKIATATERTPET 322

Query: 304 WLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ 363
           WL  V   GH + E E L + +QADE L+MGLRLREG+ +  W+ L+G  LD E    L 
Sbjct: 323 WLTSVADRGHGMSESEVLGTSEQADELLLMGLRLREGVDLGRWQALSGHRLDAERVEFLI 382

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
             G IE +   R+RCT +GM +LD+V+A+LA
Sbjct: 383 DHGMIETMGKDRIRCTPQGMLVLDAVVADLA 413


>gi|222147319|ref|YP_002548276.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4]
 gi|221734309|gb|ACM35272.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           vitis S4]
          Length = 393

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 222/384 (57%), Positives = 285/384 (74%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    G+Y+HWPFC  KCPYCDFNSHVR  K+ Q  F Q+FL EM+ MR ++GP++
Sbjct: 9   LPDTGEPGFGIYIHWPFCAAKCPYCDFNSHVRHQKIDQPRFTQAFLKEMETMRAMSGPKT 68

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P  +  IL+GIA+ WTV   +EIT+EANP+SVE   F+GYR AGV
Sbjct: 69  VTSIFLGGGTPSLMDPATVGAILEGIARYWTVPRGIEITMEANPTSVEAERFRGYRSAGV 128

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L +  L+FLGR H+  +A+ A+ LAR IFPRMSFDLIYA P QT+  W+ E
Sbjct: 129 NRVSLGVQALNDADLKFLGRMHSVEDALKAVRLAREIFPRMSFDLIYARPNQTIADWDAE 188

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT F+ +HK G ++ P E  A  LY  TQ IT   GL A
Sbjct: 189 LKLAISYAVDHLSLYQLTIEEGTPFFGLHKAGKIITPDEEHAAQLYEATQEITEREGLPA 248

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + EKHPE+WL  V +
Sbjct: 249 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGHEKLATATEKHPETWLSAVEQ 308

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           NGH +V ++ L SE+QADE L+MGLRLREG+ +  W+ L+GR+ D   E+ L   GFIER
Sbjct: 309 NGHGMVIQDALGSEEQADELLLMGLRLREGVDLARWQQLSGRDPDPVREQFLLEHGFIER 368

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT +GM +LD+V+A+LA
Sbjct: 369 LGNSRLRCTPKGMLVLDAVVADLA 392


>gi|315121829|ref|YP_004062318.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495231|gb|ADR51830.1| coproporphyrinogen III oxidase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 395

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 302/393 (76%), Positives = 350/393 (89%)

Query: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           MKY  +Y +++    SN+LG+YVHWPFC KKCPYCDFNSHVRR  + Q +FI+S L EM+
Sbjct: 1   MKYSQSYGDDVVHPDSNTLGIYVHWPFCTKKCPYCDFNSHVRRRAIDQGHFIRSLLVEME 60

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           WMRQL+GPR ISS+FFGGGTPSLI+PQNI+++LD IAKNWT+ SNVEITIEANPSS E  
Sbjct: 61  WMRQLSGPRLISSVFFGGGTPSLIDPQNISILLDNIAKNWTLPSNVEITIEANPSSTEAG 120

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
           +F GYRKAGVNR+SLGVQSLEE++LRFLGRNHN SEA+ AIHLAR+IFPRMSFDLIYALP
Sbjct: 121 HFLGYRKAGVNRVSLGVQSLEERALRFLGRNHNVSEAVTAIHLARDIFPRMSFDLIYALP 180

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            Q++ QWEMELQ+ALSYAVDHLSLYQLTIEKGTLFYK+HKDGDLVLP E+++ DLYNLTQ
Sbjct: 181 GQSIKQWEMELQKALSYAVDHLSLYQLTIEKGTLFYKLHKDGDLVLPDESLSADLYNLTQ 240

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            IT  +GL++YEISNH+ LG+ESLHNL YWRYGDY+GIGPGAHSRVKV S R+A+SIEKH
Sbjct: 241 IITREYGLYSYEISNHARLGSESLHNLTYWRYGDYVGIGPGAHSRVKVDSQRIAMSIEKH 300

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PE+W+KMV KNGHA+VEKEFLSSEQQADEFLMMG+RLREGI VKDWE LAGR+LDIECER
Sbjct: 301 PENWVKMVEKNGHAIVEKEFLSSEQQADEFLMMGMRLREGIEVKDWERLAGRSLDIECER 360

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANL 393
            LQ QGFIER+  SRLRCTQ GM MLD+++A+L
Sbjct: 361 RLQEQGFIERINSSRLRCTQLGMVMLDAIVADL 393


>gi|217978308|ref|YP_002362455.1| oxygen-independent coproporphyrinogen III oxidase [Methylocella
           silvestris BL2]
 gi|217503684|gb|ACK51093.1| oxygen-independent coproporphyrinogen III oxidase [Methylocella
           silvestris BL2]
          Length = 389

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 188/386 (48%), Positives = 255/386 (66%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
           +++        GVYVHWPFC+ KCPYCDFNSHVR   V +  F  + + E+    + T  
Sbjct: 3   DDLQNGADPGFGVYVHWPFCLSKCPYCDFNSHVRHEPVDEARFGSALIREIAHRAETTRG 62

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R ++SIFFGGGTPSL+    +A +++ I ++WT++   EIT+EANP+SVE   F G+R A
Sbjct: 63  RRVASIFFGGGTPSLMSASTVARVIEAIDRHWTLAPGAEITLEANPTSVEATKFAGFRAA 122

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNR+S+GVQ+L +  L+ LGR H++ EA+AA+ +AR  F R SFDLIYA   Q++ QW 
Sbjct: 123 GVNRVSIGVQALNDADLKALGRTHSSVEALAALEIARKTFERFSFDLIYARAGQSVAQWR 182

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            EL  AL+ A DHLSLYQLTIE GT+F +M   G LV+P  ++  D ++ TQ I +  GL
Sbjct: 183 SELASALALARDHLSLYQLTIEPGTMFERMRDAGKLVVPGPDLGRDFWDATQEIMNGAGL 242

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
            AYEISNH+  GAES HNL YWR GDY G+GPGAH R+   + R A + E+ P+ WL  V
Sbjct: 243 PAYEISNHARPGAESRHNLIYWRTGDYAGVGPGAHGRITGQNKRRAQATERDPQKWLSAV 302

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
              GH ++E + LS E+Q DEFL+MGLRL EGI    +E ++GR LD    ++L   G +
Sbjct: 303 ESAGHGLIEDDVLSREEQGDEFLLMGLRLAEGIEPGRFEAMSGRGLDPRRVQSLIADGMV 362

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
           E     RLR +  G  +LD+V+A+LA
Sbjct: 363 EYTSGGRLRVSAEGFPLLDAVVADLA 388


>gi|15964126|ref|NP_384479.1| coproporphyrinogen III oxidase [Sinorhizobium meliloti 1021]
 gi|307301271|ref|ZP_07581033.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti BL225C]
 gi|307317942|ref|ZP_07597379.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti AK83]
 gi|15073302|emb|CAC41810.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sinorhizobium meliloti 1021]
 gi|306896344|gb|EFN27093.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti AK83]
 gi|306903727|gb|EFN34314.1| oxygen-independent coproporphyrinogen III oxidase [Sinorhizobium
           meliloti BL225C]
          Length = 393

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 224/379 (59%), Positives = 281/379 (74%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               GVYVHWPFC  KCPYCDFNSHVR   V Q  F+ +FL EM  +R L+GPR+++SIF
Sbjct: 14  DPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQPRFVAAFLKEMAAVRALSGPRTVTSIF 73

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++P+ +  ILDGIA+ W V   +EIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 74  MGGGTPSLMDPRTVEAILDGIARQWHVPDGIEITMEANPSSVEATRFRGYRAAGVNRVSL 133

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ L+FLGR H+   A+ AI LAR IFPRMSFDLIYA P QT+ +WE EL+ A+
Sbjct: 134 GVQALNDRDLKFLGRLHDVENALKAIRLAREIFPRMSFDLIYARPNQTVEEWERELKEAV 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYAVDHLSLYQLTIE+GT FY +HK G LV+P    +  LY  TQ IT+  G+ AYE+SN
Sbjct: 194 SYAVDHLSLYQLTIEEGTPFYGLHKAGKLVVPDGEQSAVLYEATQEITADIGMPAYEVSN 253

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYGDY GIGPGAH R+ +GS ++A + E++PE+WL+ V + G  +
Sbjct: 254 HARPGAESRHNLTYWRYGDYAGIGPGAHGRLAIGSGKIATATERNPEAWLQRVEECGEGL 313

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE+E L  E QADE L+MGLRLREG+ +  W+ L+GR+ D   E  L   GFIER+  SR
Sbjct: 314 VERELLDFEAQADELLLMGLRLREGVDLARWQTLSGRDPDPAREEFLIEHGFIERIGNSR 373

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LRCT  GM +LD+V+A+LA
Sbjct: 374 LRCTPAGMLILDAVVADLA 392


>gi|227820594|ref|YP_002824564.1| coproporphyrinogen III oxidase [Sinorhizobium fredii NGR234]
 gi|227339593|gb|ACP23811.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Sinorhizobium fredii NGR234]
          Length = 382

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 224/379 (59%), Positives = 284/379 (74%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               GVYVHWPFC  KCPYCDFNSHVR   V Q  F+ +FL EM  +  L+GPR+++SIF
Sbjct: 2   DPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQPRFVAAFLQEMASVGALSGPRTVTSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EP  +A ILDGIA++W V   +EIT+EANPSSVE   F GYR AGVNR+SL
Sbjct: 62  MGGGTPSLMEPATVAAILDGIARHWHVPDGIEITMEANPSSVEATRFHGYRAAGVNRVSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ L+FLGR HN  +A+ A+ LAR IFPRMSFDLIYA PKQT+ +WE EL+ A+
Sbjct: 122 GVQALNDRDLKFLGRLHNVEDALKAVRLAREIFPRMSFDLIYARPKQTVEEWERELKEAV 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYAVDHLSLYQLTIE+GT F+ +HK G L++P    +  LY  TQ IT+A G+ AYE+SN
Sbjct: 182 SYAVDHLSLYQLTIEEGTPFFGLHKAGKLIVPDGEQSAVLYEATQEITAAIGMPAYEVSN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYGDY GIGPGAH R+  GS ++A + E++PE+WL++V + G  +
Sbjct: 242 HARRGAESRHNLTYWRYGDYAGIGPGAHGRLTAGSGKIATATERNPEAWLRLVEERGDGI 301

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
            E+E L  E QADE L+MGLRLREG+ +  W+ L+GR+ D E E+ L   GF+ER+  SR
Sbjct: 302 TEQEPLDREAQADELLLMGLRLREGVDLARWQGLSGRDPDPEREQFLIEHGFVERLGNSR 361

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LRCT  GM +LD+V+A+LA
Sbjct: 362 LRCTPAGMLILDAVVADLA 380


>gi|150395235|ref|YP_001325702.1| coproporphyrinogen III oxidase [Sinorhizobium medicae WSM419]
 gi|150026750|gb|ABR58867.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Sinorhizobium medicae WSM419]
          Length = 381

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 228/379 (60%), Positives = 286/379 (75%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               GVYVHWPFC  KCPYCDFNSHVR   V Q  F+ +FL EM  +R L+GPR+++SIF
Sbjct: 2   DPGFGVYVHWPFCAAKCPYCDFNSHVRHTPVEQPRFVAAFLKEMAAVRDLSGPRTVTSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++PQ +  ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 62  MGGGTPSLMDPQTVEAILDGIARHWHVPDGIEITMEANPSSVEATRFRGYRAAGVNRVSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ L+FLGR HN  +A+ AI LAR IFPRMSFDLIYA P QT+ +WE EL+ A+
Sbjct: 122 GVQALNDRDLKFLGRLHNVEDALKAIRLAREIFPRMSFDLIYARPNQTVEEWERELKEAV 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ AYE+SN
Sbjct: 182 SYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITADIGMPAYEVSN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYGDY GIGPGAH R++VGS ++A + E++PE+WL+ V ++G  +
Sbjct: 242 HARPGAESRHNLTYWRYGDYAGIGPGAHGRLQVGSGKIATATERNPEAWLQNVEEHGDGM 301

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE+EFL  E QADE L+MGLRLREG+ +  W+ L+GRN D   E  L   GFIER+  SR
Sbjct: 302 VEREFLDFEAQADELLLMGLRLREGVDLARWQSLSGRNPDPAREEFLIEHGFIERIGNSR 361

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LRCT  GM +LD+V+A+LA
Sbjct: 362 LRCTPSGMLILDAVVADLA 380


>gi|90420652|ref|ZP_01228558.1| oxygen-independent coproporphyrinogen III oxidase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334943|gb|EAS48704.1| oxygen-independent coproporphyrinogen III oxidase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 398

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 212/379 (55%), Positives = 264/379 (69%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   GVYVHWPFC  KCPYCDFNSHVR   V QE +  +F  E+  M + +   +++SIF
Sbjct: 20  APGFGVYVHWPFCAAKCPYCDFNSHVRHKPVDQERYAAAFERELAEMARRSAGETVTSIF 79

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EP  +  ILD +A NWT++   EIT+EANPSSVE   F+GYR+AGVNR+SL
Sbjct: 80  LGGGTPSLMEPATVRRILDAVAANWTIADGAEITLEANPSSVEAERFRGYREAGVNRVSL 139

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LR LGR H+  +A+ AI LAR IFPR+SFDLIYA P QT+  WE EL +A+
Sbjct: 140 GVQALNDRDLRLLGRLHSVDQALHAIGLAREIFPRLSFDLIYARPDQTVAAWESELNQAI 199

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT FY +HK G L++P  +++ DLY  TQ IT+  GL AYEISN
Sbjct: 200 DLAADHLSLYQLTIEEGTPFYALHKAGKLIVPDGDLSADLYESTQRITAERGLPAYEISN 259

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG Y G+GPGAH R+     R AIS E  PE+WLKMV       
Sbjct: 260 HAVPGAESRHNLTYWRYGLYAGVGPGAHGRLMGPGGRHAISNEPLPETWLKMVESWDSGA 319

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           V  + LS  +QADE L+MGLRL EGI +K W  L GR+LD   E +L   G +ER+   R
Sbjct: 320 VVDDLLSPTEQADELLLMGLRLTEGIDLKRWRKLTGRDLDPVSEADLMAHGMVERLGPDR 379

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  GM +LD+V+A+LA
Sbjct: 380 LRATPAGMLVLDAVVADLA 398


>gi|209547615|ref|YP_002279532.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533371|gb|ACI53306.1| oxygen-independent coproporphyrinogen III oxidase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 401

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 225/384 (58%), Positives = 292/384 (76%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL EM  +R L+GP++
Sbjct: 17  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFASAFLKEMAAVRALSGPKT 76

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V + +EIT+EANPSSVE   F+GYR AGV
Sbjct: 77  VTSIFLGGGTPSLMKPETVSAILDGIARHWHVPAGIEITMEANPSSVEAERFRGYRAAGV 136

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L+++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P QT+ QWE E
Sbjct: 137 NRVSLGVQALDDRDLKFLGRLHDVADALKAIRLARDIFPRMSFDLIYARPDQTVEQWERE 196

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 197 LKQAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITAREGMPA 256

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PESWL MV +
Sbjct: 257 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGPEKIATATERKPESWLDMVER 316

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR+LD + E  L    FIER
Sbjct: 317 DGHGILDEERLGYEEQSDELLLMGLRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIER 376

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LDSV+A+LA
Sbjct: 377 IGNSRLRCTPSGMLILDSVVADLA 400


>gi|222084654|ref|YP_002543183.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
 gi|221722102|gb|ACM25258.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter
           K84]
          Length = 392

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 222/391 (56%), Positives = 288/391 (73%)

Query: 4   LSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMR 63
           ++     +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL EM  MR
Sbjct: 1   MTHEAQLLPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFTAAFLKEMASMR 60

Query: 64  QLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQ 123
            + GP++++SIF GGGTPSL++P+ +  +LDGIAK+W V   +EIT+EANPSSVE   F+
Sbjct: 61  AIGGPKTVTSIFLGGGTPSLMKPETVGAVLDGIAKHWHVPDGIEITMEANPSSVEAERFR 120

Query: 124 GYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQT 183
           GYR AGVNR+S+GVQ+L ++ L+FLGR HN ++A+ AI LAR+IFPRMSFDLIYA P QT
Sbjct: 121 GYRAAGVNRVSMGVQALNDRDLKFLGRLHNVADALKAIKLARDIFPRMSFDLIYARPNQT 180

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
           + +WE EL+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P  + +  LY  TQ IT
Sbjct: 181 VEEWERELKEAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGDQSALLYEATQEIT 240

Query: 244 SAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPES 303
              G+ AYE+SNH+  GAES HNL YWRYGDY GIGPGAH R+ +G  ++A + E+ PE+
Sbjct: 241 EREGMPAYEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTLGPKKLATATERKPEA 300

Query: 304 WLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ 363
           WL++V ++GH + ++E L  ++QADE L+MGLRL+EGI +  W+ L+GR  D   E  L 
Sbjct: 301 WLELVERDGHGIADQEMLGDDEQADELLLMGLRLKEGIDLVRWQQLSGREPDQAREEFLL 360

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
             GFIER+  SRLRCT  GM +LDSV+A+LA
Sbjct: 361 EHGFIERLGNSRLRCTPAGMLILDSVVADLA 391


>gi|190890029|ref|YP_001976571.1| oxygen-independent coprophorphyrinogen III oxidase [Rhizobium etli
           CIAT 652]
 gi|190695308|gb|ACE89393.1| oxygen-independent coprophorphyrinogen III oxidase protein
           [Rhizobium etli CIAT 652]
          Length = 400

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 222/384 (57%), Positives = 287/384 (74%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL E   +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFLKETAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +A ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPETVAAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPDQTVEEWESE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L++A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKQAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGREKIATATERKPEAWLDMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGHEEQSDELLLMGLRLREGVDLARWQQLSGRELDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LDSV+A+LA
Sbjct: 376 IGNSRLRCTPSGMLILDSVVADLA 399


>gi|299133259|ref|ZP_07026454.1| oxygen-independent coproporphyrinogen III oxidase [Afipia sp.
           1NLS2]
 gi|298593396|gb|EFI53596.1| oxygen-independent coproporphyrinogen III oxidase [Afipia sp.
           1NLS2]
          Length = 385

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 201/384 (52%), Positives = 265/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M     N+ GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E+      T  R+
Sbjct: 1   MPADAQNAFGVYVHWPFCLSKCPYCDFNSHVRHTAIDEERFARAFAREIATTAARTPGRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++PQ +  +LD I ++W V   VE+T+EANP+SVE   F GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMKPQTVGAVLDAIGQHWNVDKGVEVTLEANPTSVEATRFAGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EA+ A+ +AR  F R SFDLIYA P Q+   W  E
Sbjct: 121 NRVSLGVQALDDASLKALGRMHSAREALDAVAIARRSFDRYSFDLIYARPDQSADAWTRE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+S A +HLSLYQLTIE+GT F+ +H+ G L  P E++A  LY++TQ + +AHGL +
Sbjct: 181 LKVAISEAAEHLSLYQLTIEEGTPFFGLHRAGKLKTPDEDLARQLYDVTQEVCAAHGLPS 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R A + +K PE+WL  V +
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIGGIRHATATDKRPEAWLTRVEE 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH +  ++ L SEQ+ADEFL+MGLRL EGI  K +  LAGR LD      L+  G I  
Sbjct: 301 DGHGIATEDLLDSEQRADEFLLMGLRLAEGIDPKRYAALAGRPLDPHRIAALKEDGAIVM 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
            +  RLR TQ G  +LD+V+A+LA
Sbjct: 361 DESGRLRVTQDGFPLLDAVVADLA 384


>gi|159184259|ref|NP_353357.2| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58]
 gi|159139586|gb|AAK86142.2| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           tumefaciens str. C58]
          Length = 399

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 223/384 (58%), Positives = 288/384 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    G+Y+HWPFC  KCPYCDFNSHVR   V QE F  +FL EM+ MR L+GPR 
Sbjct: 15  LPDTGDPGFGIYLHWPFCAAKCPYCDFNSHVRHRPVDQERFTAAFLREMEHMRTLSGPRV 74

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++PQ +  +LDGI++ W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 75  VTSIFMGGGTPSLMDPQTVGALLDGISRFWHVPDGIEITMEANPSSVEAERFRGYRAAGV 134

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +W+ E
Sbjct: 135 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPNQTVAEWDAE 194

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT  +G+ A
Sbjct: 195 LKEAVSYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEHSAVLYEATQEITERYGMPA 254

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G+ ++A + E+HPE+WL+ V +
Sbjct: 255 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGASKLATATERHPETWLETVER 314

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH +V++E L  ++QADE L+MGLRLREGI +  W  L+GR+LD E E  L + GF+ER
Sbjct: 315 EGHGMVDQELLGVDEQADELLLMGLRLREGIDLARWSDLSGRDLDPEKEEFLLQHGFVER 374

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LD+V+A+LA
Sbjct: 375 LGNSRLRCTPSGMLILDAVVADLA 398


>gi|325291759|ref|YP_004277623.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           sp. H13-3]
 gi|325059612|gb|ADY63303.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium
           sp. H13-3]
          Length = 399

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 222/384 (57%), Positives = 286/384 (74%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    G+Y+HWPFC  KCPYCDFNSHVR   V QE F  +FL+EM  MR L+GPR 
Sbjct: 15  LPDTGDPGFGIYLHWPFCAAKCPYCDFNSHVRHRPVDQERFTAAFLSEMAKMRALSGPRV 74

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++PQ +  +LDG+++ W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 75  VTSIFMGGGTPSLMDPQTVGALLDGVSRFWHVPDGIEITMEANPSSVEAERFRGYRAAGV 134

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +W+ E
Sbjct: 135 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPNQTVAEWDAE 194

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT  +G+ A
Sbjct: 195 LKEAVSYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEHSAVLYEATQEITERYGMPA 254

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G+ ++A   E+HPE+WL+ V +
Sbjct: 255 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTNGASKLATVTERHPETWLETVER 314

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH +V++E L  ++QADE L+MGLRLREGI +  W  L+GR LD E E  L + GF+ER
Sbjct: 315 EGHGMVDQELLGVDEQADELLLMGLRLREGIDLARWSDLSGRELDPEKEEFLLQHGFVER 374

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LD+V+A+LA
Sbjct: 375 IGNSRLRCTPSGMLILDAVVADLA 398


>gi|239831022|ref|ZP_04679351.1| oxygen-independent coproporphyrinogen III oxidase [Ochrobactrum
           intermedium LMG 3301]
 gi|239823289|gb|EEQ94857.1| oxygen-independent coproporphyrinogen III oxidase [Ochrobactrum
           intermedium LMG 3301]
          Length = 409

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 214/401 (53%), Positives = 279/401 (69%), Gaps = 7/401 (1%)

Query: 1   MKYLSAYENNMTGQ-------GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQ 53
           ++ + A   N  G        G ++ GVY+HWPFC+ KCPYCDFNSHVR   V Q  F +
Sbjct: 8   LQAMDAARANTAGAIPIARANGEDAFGVYLHWPFCLAKCPYCDFNSHVRHKPVDQARFSE 67

Query: 54  SFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEAN 113
           +FL EM+ +R+ TGPR+I+SIF GGGTPSL++P+ +  +LDGIA +W+V+ ++E+T+EAN
Sbjct: 68  AFLREMECLRERTGPRTITSIFLGGGTPSLMQPETVGALLDGIASHWSVAPDIEVTLEAN 127

Query: 114 PSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSF 173
           P+SVE + F+GYR AGVNR+SLG+Q+L +  LR LGR H+  EA AAI LAR IFPR+SF
Sbjct: 128 PTSVEADRFRGYRAAGVNRVSLGIQALNDPDLRRLGRMHSVEEAKAAIRLAREIFPRLSF 187

Query: 174 DLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAV 233
           DLIYA P QT+  W  EL+ A+  A DHLSLYQLTIE+GT FY + K G L  P  + A 
Sbjct: 188 DLIYARPNQTIEAWREELKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPDPDHAA 247

Query: 234 DLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV 293
            LY  TQ +T+ HGL AYEISNH+  G ES HNL YWRYG Y+GIGPGAH R      R 
Sbjct: 248 ALYEETQRVTAEHGLPAYEISNHAVPGRESQHNLVYWRYGQYVGIGPGAHGRFVENDVRT 307

Query: 294 AISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN 353
               EKHPE+WL  V +NGH ++E+E+L  EQ+ DEFLMMGLRLREGI +  +E L+G  
Sbjct: 308 VTMTEKHPETWLDKVERNGHGIIEEEYLDGEQEGDEFLMMGLRLREGIDLARYERLSGHA 367

Query: 354 LDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           +D +    L  +G IE +  S +R T  G  +LD+++A+LA
Sbjct: 368 VDEKRLAKLIAEGMIEPMDGSFIRATPDGALVLDALVADLA 408


>gi|118593719|ref|ZP_01551094.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
 gi|118433729|gb|EAV40391.1| coproporphyrinogen III oxidase [Stappia aggregata IAM 12614]
          Length = 384

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 201/382 (52%), Positives = 261/382 (68%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
           G      G+Y+HWPFC  KCPYCDFNSHVR   V Q  F  +F  E+     LT  + + 
Sbjct: 2   GAAEGGFGIYIHWPFCAAKCPYCDFNSHVRHQPVDQARFAAAFERELSHFADLTKNKKVQ 61

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           S+F GGGTPSL+EP  +  IL  ++  W++  NVEI++EANPSSVE   F+GYR AGVNR
Sbjct: 62  SVFLGGGTPSLMEPATVDRILKAVSDRWSMDENVEISLEANPSSVEAERFRGYRSAGVNR 121

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLGVQSL +  LR LGR H+A  A  AI  AR  FPR+SFDLIYA P QT+  WE EL 
Sbjct: 122 VSLGVQSLIDTDLRLLGRLHDARTARTAIETARATFPRLSFDLIYARPGQTLAGWEQELN 181

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            A++ A DHLSLYQLTIE+GT F+ +   G L +P  ++  + Y LTQ++T+A GL AYE
Sbjct: 182 EAIALAADHLSLYQLTIEEGTPFHTLFHAGKLKVPDPDLGAEFYELTQNVTAAAGLPAYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           +SNH+  GAE  HNL YWRYGDY+G+GPGAH R+ VG+ R+A S E+HPE+WL+ V  +G
Sbjct: 242 VSNHARPGAECRHNLVYWRYGDYVGVGPGAHGRITVGASRLATSTERHPETWLENVESHG 301

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQ 372
            A+VE   LS E+Q DEFL+MGLRL EGI +K +E  A R++D      L   G +E + 
Sbjct: 302 QALVENAGLSEEEQGDEFLLMGLRLTEGIDLKRYERYASRSVDPARLAALIEHGMVEEIG 361

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
            +R+R T+ G  +LD+V+A+LA
Sbjct: 362 ENRIRATREGFFVLDAVVADLA 383


>gi|110636337|ref|YP_676545.1| coproporphyrinogen III oxidase [Mesorhizobium sp. BNC1]
 gi|110287321|gb|ABG65380.1| coproporphyrinogen III oxidase, anaerobic [Chelativorans sp. BNC1]
          Length = 387

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 213/381 (55%), Positives = 267/381 (70%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
                 GVYVHWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MR  TGPRS+SS
Sbjct: 6   DEGPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFKRELAAMRARTGPRSVSS 65

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL++P+ +  I+D +A +W V   VEIT+EANPSSVE + F+GYR AGVNR+
Sbjct: 66  IFLGGGTPSLMDPKTVGAIIDAVAASWHVPMGVEITLEANPSSVEADRFRGYRSAGVNRV 125

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+Q+L ++ LRFLGR HN  EA+ AI LAR++FPRMSFDLIYA P QT+  W  EL+ 
Sbjct: 126 SMGIQALNDRDLRFLGRLHNVEEALGAIRLARDLFPRMSFDLIYARPGQTVDAWRAELEE 185

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A+ YA DHLSLYQLTIE+GT FY +   G L +P  ++A DLY +TQ IT+A GL AYEI
Sbjct: 186 AVGYAADHLSLYQLTIEEGTPFYALRAAGKLTVPDMDLAADLYQVTQEITAARGLPAYEI 245

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SNH+  GAES HNL YWRYG+Y+G+GPGAH R      RV    E++PE+W  +V   G 
Sbjct: 246 SNHAKPGAESRHNLIYWRYGEYVGVGPGAHGRFIEDGRRVVTMTERNPETWAALVEARGS 305

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
            V   E L+  ++ADEFL+MGLRL EGI +  +E LAG  L  +    L+ +G IE V  
Sbjct: 306 GVTGGEMLTRSEEADEFLLMGLRLVEGIDLDRYEKLAGFPLSPQRVAILREEGLIEPVGN 365

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
           SRLR T  GM +LD+++A+LA
Sbjct: 366 SRLRATPAGMVVLDALVADLA 386


>gi|115522383|ref|YP_779294.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisA53]
 gi|115516330|gb|ABJ04314.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodopseudomonas palustris BisA53]
          Length = 386

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 199/384 (51%), Positives = 264/384 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +     N+ GVYVHWPFC+ KCPYCDFNSHVR   + +E ++ +F+ E++     TG R 
Sbjct: 2   IRTDADNAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERYLSAFVREIETTAARTGARE 61

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P  +  ILD I ++W V+ +VE+++EANP+SVE + F+GYR AGV
Sbjct: 62  VTSIFLGGGTPSLMQPSTVGGILDAIGRHWRVAGDVEVSMEANPTSVEASRFRGYRAAGV 121

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H A EA+ A+ +AR IF R SFDLIYA P+QT   W  E
Sbjct: 122 NRVSLGVQALDDVSLKSLGRMHTAQEAMEAVGIARQIFDRYSFDLIYARPEQTPAMWADE 181

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A++ A +HLSLYQLTIE  T F+ +H  G L  P E+    LY++TQ + +  GL A
Sbjct: 182 LRLAIAQAAEHLSLYQLTIEPETPFFGLHAAGKLRTPDEDTGRALYDVTQEVCAQAGLPA 241

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R AI+ EK PE+WL  V  
Sbjct: 242 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRIDLGGRRHAIATEKRPEAWLMRVEA 301

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH VV  + L+SE++ADEFL+MGLRL EGI  + ++ LAGR LD      L  +G I  
Sbjct: 302 CGHGVVTDDSLNSEERADEFLLMGLRLAEGIDPRRYQALAGRALDPARIATLLDEGAIVV 361

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 362 DADGRLRVTQSGFPVLDAVVADLA 385


>gi|296447431|ref|ZP_06889356.1| oxygen-independent coproporphyrinogen III oxidase [Methylosinus
           trichosporium OB3b]
 gi|296255051|gb|EFH02153.1| oxygen-independent coproporphyrinogen III oxidase [Methylosinus
           trichosporium OB3b]
          Length = 389

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 184/386 (47%), Positives = 253/386 (65%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
             +        GVYVHWPFC+ KCPYCDFNSHVR+ +V ++ F+ +F TE++    L   
Sbjct: 3   ATIRNAFDPGFGVYVHWPFCLSKCPYCDFNSHVRKGEVDEDRFVDAFRTELRHRAALAPG 62

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R   S+FFGGGTPSL+    +  IL  I   W ++ +VE+T+EANP+SVE + F+ ++ A
Sbjct: 63  RETRSVFFGGGTPSLMSASTVEAILREIGDCWPLAPDVEVTLEANPTSVEASRFRSFKAA 122

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNR+SLGVQ+L +  LR LGR H  +EA+AA+ +A  +F R SFDLIYA P+QT   W 
Sbjct: 123 GVNRVSLGVQALNDIELRALGRQHTVAEALAALDVANKVFERTSFDLIYARPQQTPAAWR 182

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            EL+ AL+   +H+SLYQLTIE  T+F +M++ G L +P  +    L+++TQ +T+  GL
Sbjct: 183 KELELALARVTEHVSLYQLTIEPETMFERMYEAGKLEVPDTDTQRALWDVTQEMTARAGL 242

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
            AYE+SNH+  G E  HNL YWRYG+Y G+GPGAH R+     R A + E+HPE WL +V
Sbjct: 243 PAYEVSNHARPGGECRHNLVYWRYGEYAGVGPGAHGRLITPRGRRAQATERHPEMWLTVV 302

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
              GH +VE E LS+EQ+ DEFL+MGLRLREGI    +  L G+ L       L   G +
Sbjct: 303 ESEGHGLVEDELLSAEQEGDEFLLMGLRLREGIDPGRFFALTGKKLSQSRVSELVGDGLV 362

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
           E  + +RLR +  G  +LD+V+A+LA
Sbjct: 363 ELTRDNRLRVSSEGFPVLDAVVADLA 388


>gi|316931693|ref|YP_004106675.1| oxygen-independent coproporphyrinogen III oxidase [Rhodopseudomonas
           palustris DX-1]
 gi|315599407|gb|ADU41942.1| oxygen-independent coproporphyrinogen III oxidase [Rhodopseudomonas
           palustris DX-1]
          Length = 385

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 204/384 (53%), Positives = 262/384 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +E F + F  E+    +  GPR 
Sbjct: 1   MRASPDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARGFAREIATTAERIGPRQ 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +A ILD IA++W V    E+++EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVAAILDAIARHWHVEPGAEVSLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EAI A+ +A++ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKALGRLHSAEEAINAVAIAKSAFDRYSFDLIYARPGQTAAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A +HLSLYQLTIE  T FY +HK G L  P E  A  LY++TQS+ +  GL A
Sbjct: 181 LRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEARALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G+ R A + EK PESWL  V  
Sbjct: 241 YEISNHARPGAECRHNLIYWRGQEYAGIGPGAHGRLDIGAVRYATATEKRPESWLMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  E L+SE++ADEFL+MGLRL EGI  + ++ L+GR LD      L+ +G I  
Sbjct: 301 TGHGLIADERLTSEERADEFLLMGLRLAEGIDPQRYQALSGRPLDPSRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 DADGRLRVTQEGFPVLDAVVADLA 384


>gi|241202758|ref|YP_002973854.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856648|gb|ACS54315.1| oxygen-independent coproporphyrinogen III oxidase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 400

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 223/384 (58%), Positives = 290/384 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FLTEM  +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFTSAFLTEMAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPEAVSAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLARDIFPRMSFDLIYARPDQTVEEWEKE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKEAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSAVLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGPEKLATATERKPETWLDMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR+LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGFEEQSDELLLMGLRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LDSV+A+LA
Sbjct: 376 IGNSRLRCTPSGMLILDSVVADLA 399


>gi|192288761|ref|YP_001989366.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris TIE-1]
 gi|192282510|gb|ACE98890.1| oxygen-independent coproporphyrinogen III oxidase [Rhodopseudomonas
           palustris TIE-1]
          Length = 385

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 204/384 (53%), Positives = 264/384 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E+    +  GPR 
Sbjct: 1   MQASSDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAFAREIATTAERIGPRQ 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +A ILD IA++W V    E+T+EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVAAILDAIARHWHVEPGAEVTLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EA+ A+ +A++ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKALGRMHSAEEALNAVAIAKSAFDRYSFDLIYARPGQTAAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A +HLSLYQLTIE  T FY +HK G L  P E  A  LY++TQS+ +  GL A
Sbjct: 181 LRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEARALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G+ R A + EK PESWL  V  
Sbjct: 241 YEISNHARPGAECRHNLIYWRGHEYAGIGPGAHGRLDIGNARYATATEKRPESWLMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  E L+SE++ADEFL+MGLRL EGI  + +++L+GR LD      L+ +G I  
Sbjct: 301 TGHGLIADEHLTSEERADEFLLMGLRLAEGIDPQRYQLLSGRPLDPSRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 DADGRLRVTQEGFPVLDAVVADLA 384


>gi|39933404|ref|NP_945680.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris CGA009]
 gi|39647250|emb|CAE25771.1| possible oxygen-independent coproporphyrinogen III oxidase (hemN)
           [Rhodopseudomonas palustris CGA009]
          Length = 385

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 204/384 (53%), Positives = 264/384 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E+    +  GPR 
Sbjct: 1   MQASSDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAFAREIATTAERIGPRQ 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +A ILD IA++W V    E+T+EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVAAILDAIARHWQVEPGAEVTLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H+A EA+ A+ +A++ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKALGRLHSAEEALNAVAIAKSAFDRYSFDLIYARPGQTAAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A +HLSLYQLTIE  T FY +HK G L  P E  A  LY++TQS+ +  GL A
Sbjct: 181 LRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEARALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G+ R A + EK PESWL  V  
Sbjct: 241 YEISNHARPGAECRHNLIYWRGHEYAGIGPGAHGRLDIGNARYATATEKRPESWLMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  E L+SE++ADEFL+MGLRL EGI  + +++L+GR LD      L+ +G I  
Sbjct: 301 TGHGLIADEHLTSEERADEFLLMGLRLAEGIDPQRYQLLSGRPLDPSRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 DADGRLRVTQEGFPVLDAVVADLA 384


>gi|323137232|ref|ZP_08072311.1| oxygen-independent coproporphyrinogen III oxidase [Methylocystis
           sp. ATCC 49242]
 gi|322397590|gb|EFY00113.1| oxygen-independent coproporphyrinogen III oxidase [Methylocystis
           sp. ATCC 49242]
          Length = 388

 Score =  288 bits (737), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 184/386 (47%), Positives = 256/386 (66%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
             +        GVYVHWPFC+ KCPYCDFNSHVRR  V ++ F+++F  E+     L   
Sbjct: 2   ATIRNAFDPGFGVYVHWPFCLSKCPYCDFNSHVRRGDVDEDRFVEAFAVELAHRASLAPG 61

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R + S+FFGGGTPSL+ P  +  IL  IA +WT++ +VEIT+EANP+SVE + F+G++ A
Sbjct: 62  REVRSVFFGGGTPSLMSPSTVEAILSQIASHWTMARDVEITLEANPTSVEASRFKGFKAA 121

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           G+NR+SLG+Q+L +  L+ LGR H+ +EA+ A+ +A ++F R SFDLIY    QT   W 
Sbjct: 122 GINRVSLGIQALNDIDLKGLGRQHSVAEALMALDIANSVFDRTSFDLIYGRTGQTPAAWR 181

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            EL  AL+ A +H+SLYQLTIE  TLF +M   G + +P  +    L+++TQ +T+ HGL
Sbjct: 182 KELDLALARAPEHVSLYQLTIEPDTLFERMVNTGKMTVPDVDTQRALWDVTQEVTARHGL 241

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
            +YE+SNH+  GAE  HNL YWRYG+Y G+GPGAH R+     R A + E+HPE WL  V
Sbjct: 242 PSYEVSNHARPGAECRHNLVYWRYGEYAGVGPGAHGRIVTTRGRRAQATERHPEMWLTCV 301

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
              GH +VE E L++EQ+ DEFL+MGLRLREGI  + + +L G+ L       L   G +
Sbjct: 302 ETEGHGLVEDELLNAEQEGDEFLLMGLRLREGIDPQRYFLLTGKKLSQSRISELIGDGLV 361

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
           E  + +RLR +  G  +LD+V+A+LA
Sbjct: 362 EVTRENRLRVSSEGFPVLDAVVADLA 387


>gi|86356017|ref|YP_467909.1| coproporphyrinogen III oxidase [Rhizobium etli CFN 42]
 gi|86280119|gb|ABC89182.1| coproporphyrinogen III oxidase protein [Rhizobium etli CFN 42]
          Length = 400

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 221/384 (57%), Positives = 289/384 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FL EM  +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFLKEMAAVRAMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V + +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPETVSAILDGIARHWHVPAGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR IFPRMSFDLIYA P QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLAREIFPRMSFDLIYARPDQTVDEWEKE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT F+ +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKEAISYAVDHLSLYQLTIEEGTPFFGLHKSGKLIVPDGEQSALLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL+MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGHEKLATATERKPEAWLEMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGFEEQSDELLLMGLRLREGVDLARWQQLSGRELDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LDSV+A+LA
Sbjct: 376 IGNSRLRCTSAGMLILDSVVADLA 399


>gi|116250146|ref|YP_765984.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254794|emb|CAK05868.1| putative oxygen-independent coprophorphyrinogen III oxidase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 400

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 223/384 (58%), Positives = 291/384 (75%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +   G    GVYVHWPFC  KCPYCDFNSHVR   V QE F  +FLTEM  +R ++GP++
Sbjct: 16  LPDTGEPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFTSAFLTEMAAVRSMSGPKT 75

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ ++ ILDGIA++W V   +EIT+EANPSSVE   F+GYR AGV
Sbjct: 76  VTSIFLGGGTPSLMKPETVSAILDGIARHWHVPDGIEITMEANPSSVEAERFRGYRAAGV 135

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L ++ L+FLGR H+ ++A+ AI LAR+IFPRMSFDLIYA P+QT+ +WE E
Sbjct: 136 NRVSLGVQALNDRDLKFLGRLHDVADALKAIRLARDIFPRMSFDLIYARPEQTVEEWEKE 195

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+SYAVDHLSLYQLTIE+GT FY +HK G L++P    +  LY  TQ IT+  G+ A
Sbjct: 196 LKEAISYAVDHLSLYQLTIEEGTPFYGLHKAGKLIVPDGEQSALLYEATQEITAREGMPA 255

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAES HNL YWRYGDY GIGPGAH R+  G  ++A + E+ PE+WL MV +
Sbjct: 256 YEVSNHARPGAESRHNLTYWRYGDYAGIGPGAHGRLTRGPEKLATATERKPETWLDMVER 315

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH ++++E L  E+Q+DE L+MGLRLREG+ +  W+ L+GR+LD + E  L    FIER
Sbjct: 316 DGHGILDEERLGFEEQSDELLLMGLRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIER 375

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  SRLRCT  GM +LDSV+A+LA
Sbjct: 376 IGNSRLRCTPSGMLILDSVVADLA 399


>gi|114705080|ref|ZP_01437988.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
 gi|114539865|gb|EAU42985.1| coproporphyrinogen III oxidase [Fulvimarina pelagi HTCC2506]
          Length = 400

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 211/379 (55%), Positives = 269/379 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               GVYVHWPFC  KCPYCDFNSHVR   V Q  +  +F  E+  M + +    ++SIF
Sbjct: 22  DPGFGVYVHWPFCAAKCPYCDFNSHVRMKPVDQARYAAAFERELAEMGRRSKGERVTSIF 81

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EP  + +IL+ I+  WTV+ + EIT+EANPSSVE N F+GYR AGVNR+SL
Sbjct: 82  LGGGTPSLMEPATVGIILNAISNIWTVAPDAEITLEANPSSVEANRFRGYRSAGVNRVSL 141

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LR LGR H+  EA+ AI LAR IFPR+SFDLIYA P QT+  WE EL RA+
Sbjct: 142 GVQALNDRDLRRLGRLHDVEEALRAIGLAREIFPRLSFDLIYARPDQTVAGWEAELARAI 201

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F+ +HK G L++P  +++ DLY  TQ++T+A GL AYEISN
Sbjct: 202 DLAADHLSLYQLTIEEGTAFHALHKAGKLIVPDGDLSADLYEATQALTAAKGLPAYEISN 261

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG Y G+GPGAH R+    +R A + E  PE+WL+MV    H +
Sbjct: 262 HAVPGAESRHNLTYWRYGHYAGVGPGAHGRLSWDGYRYATANEALPETWLQMVEDWDHGM 321

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           V +E LS  +QADE L+MGLRL EG+ +K W  L+GR +D   ER+L   G +ER+   R
Sbjct: 322 VVEEALSIAEQADELLLMGLRLAEGVDLKRWRELSGRVIDPRSERDLVENGMVERLGPER 381

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LRCT  GM +LD+V+A+LA
Sbjct: 382 LRCTPAGMMVLDAVVADLA 400


>gi|153007530|ref|YP_001368745.1| coproporphyrinogen III oxidase [Ochrobactrum anthropi ATCC 49188]
 gi|151559418|gb|ABS12916.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 409

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 210/383 (54%), Positives = 272/383 (71%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
              G N+ GVY+HWPFC+ KCPYCDFNSHVR   V Q  F ++FL EM+ +R+ TGPR+I
Sbjct: 26  RANGENAFGVYLHWPFCLAKCPYCDFNSHVRHKPVDQARFSEAFLREMETLRERTGPRTI 85

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           +SIF GGGTPSL++P+ +  +L+GIA +W+V+ ++E+T+EANP+SVE + F+GYR AGVN
Sbjct: 86  TSIFLGGGTPSLMQPETVGALLNGIASHWSVAPDIEVTLEANPTSVEADRFRGYRAAGVN 145

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLG+Q+L +  LR LGR H+  EA AAI LAR IFPR+SFDLIYA P QT+  W  EL
Sbjct: 146 RVSLGIQALNDPDLRRLGRMHSVEEAKAAIRLAREIFPRLSFDLIYARPNQTIEAWREEL 205

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           + A+  A DHLSLYQLTIE+GT FY + K G L  P  + A  LY  TQ +T+ HGL AY
Sbjct: 206 KEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDHAAALYEETQRVTAEHGLPAY 265

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISNH+  G ES HNL YWRYG Y+GIGPGAH R      R     EKHPE+WL  V +N
Sbjct: 266 EISNHAVPGRESQHNLVYWRYGQYVGIGPGAHGRFVENDIRTVTMTEKHPETWLDKVERN 325

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
           GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +E L+G  +D +    L  +G IE +
Sbjct: 326 GHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYERLSGHAVDEKRLAKLIAEGMIEPM 385

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
             S +R T  G  +LD+++A+LA
Sbjct: 386 SGSIIRATPDGALVLDALVADLA 408


>gi|254501285|ref|ZP_05113436.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Labrenzia alexandrii DFL-11]
 gi|222437356|gb|EEE44035.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Labrenzia alexandrii DFL-11]
          Length = 394

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 201/388 (51%), Positives = 273/388 (70%)

Query: 7   YENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT 66
            +  +T       G+YVHWPFC  KCPYCDFNSHVR  +V Q  F  +F  E+    ++T
Sbjct: 6   IDVALTQASDAGFGIYVHWPFCAAKCPYCDFNSHVRHQQVDQARFAAAFERELNHFAEMT 65

Query: 67  GPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYR 126
             + + S+F GGGTPSL+EP  +  +L  I+  W++ SNVEI++EANP+SVE   F+GYR
Sbjct: 66  QGKVVQSVFLGGGTPSLMEPATVERVLTAISDRWSMDSNVEISLEANPTSVEAERFKGYR 125

Query: 127 KAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQ 186
            AGVNR+SLGVQSL +  L+ LGR H+A+ A  AI  AR  FPR+SFDLIYA P QT+ Q
Sbjct: 126 AAGVNRVSLGVQSLHDADLKLLGRLHDAATARRAIETARATFPRLSFDLIYARPNQTLAQ 185

Query: 187 WEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAH 246
           WE EL+ A++ A DHLSLYQLTIE+GT FY ++  G L +P +++  + Y LTQ +T A 
Sbjct: 186 WEAELKDAIALAADHLSLYQLTIEEGTPFYTLYHGGKLTMPDQDLGAEFYELTQKVTEAE 245

Query: 247 GLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK 306
           GL AYE+SNH+  GAE  HNL YWRYGDY+G+GPGAH R+ VG +R+A S+E+HPE+WL+
Sbjct: 246 GLPAYEVSNHAKPGAECRHNLVYWRYGDYVGVGPGAHGRLSVGVNRMATSVERHPETWLE 305

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQG 366
            V +NGH ++E   L+ E+Q DEFL+MGLRL EGI +K +E  A R++D +   +L   G
Sbjct: 306 AVEQNGHGMIEFSGLNEEEQGDEFLLMGLRLTEGIDLKRYEAFAHRSVDPKRLNDLLEHG 365

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
            +E +  +R+R T+ G  +LD+V+A+LA
Sbjct: 366 MVEELGENRVRATREGFFVLDAVVADLA 393


>gi|75674390|ref|YP_316811.1| coproporphyrinogen III oxidase [Nitrobacter winogradskyi Nb-255]
 gi|74419260|gb|ABA03459.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Nitrobacter winogradskyi Nb-255]
          Length = 386

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 204/383 (53%), Positives = 268/383 (69%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
               + + GVY+HWPFC+ KCPYCDFNSHVR   + +E F ++F  E++     +  R++
Sbjct: 3   PADPAAAFGVYIHWPFCLSKCPYCDFNSHVRHAPIDEERFTRAFAREIETTAARSRGRTV 62

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           SSIF GGGTPSL+ PQ +  ILD I K+W+V+ +VE+T+EANP+SVE   F+GYR AGVN
Sbjct: 63  SSIFLGGGTPSLMRPQTVGAILDAIGKHWSVADDVEVTLEANPTSVEATRFRGYRAAGVN 122

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQ+L++ SL+ LGR H A EA  A+ +AR++F R SFDLIYA P QT   W  EL
Sbjct: 123 RVSLGVQALDDSSLKALGRLHTAREAQDAVAIARSVFDRYSFDLIYARPDQTPAMWAGEL 182

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           QRA+S A +HLSLYQLTIE GT F+ +H  G L  P E +A DLY++TQ + + HGL AY
Sbjct: 183 QRAISEAAEHLSLYQLTIEAGTPFFDLHAAGKLKTPDEAMARDLYDVTQDVCARHGLPAY 242

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V  N
Sbjct: 243 EISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGVRHAIATEKRPEAWLMRVEAN 302

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
           G+ +V  + L+SE++ADEFL+MGLRLREGI  + +  L+GR+LD      L+ +G I   
Sbjct: 303 GNGIVADDPLNSEERADEFLLMGLRLREGIDPRRYAALSGRSLDPRRIAILRDEGAIMIS 362

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
              RLR TQ G  +LD+V+A+LA
Sbjct: 363 TDGRLRVTQDGFPVLDAVVADLA 385


>gi|298293790|ref|YP_003695729.1| oxygen-independent coproporphyrinogen III oxidase [Starkeya novella
           DSM 506]
 gi|296930301|gb|ADH91110.1| oxygen-independent coproporphyrinogen III oxidase [Starkeya novella
           DSM 506]
          Length = 381

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 192/379 (50%), Positives = 249/379 (65%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               GVYVHWPFC  KCPYCDFNSHVR     Q  F+++F  E+   R+  G R   S+F
Sbjct: 2   DPGFGVYVHWPFCKAKCPYCDFNSHVRHSPPDQARFLKAFRAEIAHTRERIGQRRTQSVF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+EP  +  ILD I + W + +  E+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 62  FGGGTPSLMEPATVGAILDAINEAWPLDARAEVTLEANPTSVEAGRFRGYRAAGVNRVSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++ SL+ LGR H A EA+ A+ +AR  F R+SFDLIYA P Q    W  EL+RA+
Sbjct: 122 GVQALDDASLKALGRMHTAQEALGAVAVARAAFERVSFDLIYARPDQKPEAWAAELKRAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
               +HLSLYQLTIE GT F  +H+ G L++P + VA  L+++TQ  T   GL +YE+SN
Sbjct: 182 EEGCEHLSLYQLTIEDGTPFAALHRAGKLIVPEDEVARALWDVTQETTREAGLPSYEVSN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG+Y G+GPGAH R+     RVA S E+ PE W+  V   GH V
Sbjct: 242 HARPGAESRHNLLYWRYGEYAGLGPGAHGRLDTPEGRVATSTERGPEDWVARVEHAGHGV 301

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           +  E L+  +QADE+L+MGLRL EGI    +  LAG +LD      L     IE +   R
Sbjct: 302 IVDERLTRAEQADEYLLMGLRLAEGIDRARFARLAGHDLDAGRVATLIEDAMIEELPGER 361

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  G+ +LD+++A+LA
Sbjct: 362 LRATALGLPVLDAIVADLA 380


>gi|328541649|ref|YP_004301758.1| Coproporphyrinogen III oxidase, anaerobic [polymorphum gilvum
           SL003B-26A1]
 gi|326411401|gb|ADZ68464.1| Coproporphyrinogen III oxidase, anaerobic [Polymorphum gilvum
           SL003B-26A1]
          Length = 385

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 199/384 (51%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           MT        +YVHWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+    + T  R 
Sbjct: 1   MTLSTDAGFAIYVHWPFCTAKCPYCDFNSHVRHAGVDQARFVAAFERELAHFAEWTRGRR 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + SIFFGGGTPSL+ P  +  IL+ IA +W + ++VEI++EANPSSVE   F+GYR AGV
Sbjct: 61  VQSIFFGGGTPSLMAPCTVERILEAIAGHWALDADVEISLEANPSSVEAERFRGYRTAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L +  L+ LGR H+   A+AAI  AR  FPR+SFDLIYA P QT+  W+ E
Sbjct: 121 NRVSLGVQALNDPDLKMLGRLHDVQTALAAIDTARATFPRLSFDLIYARPGQTVAGWQAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+RA+  A DHLSLYQLTIE+GT F+ + + G L +P  ++  + Y LTQ++T AHGL A
Sbjct: 181 LERAIGLAADHLSLYQLTIEEGTPFFALRQAGKLTVPDPDLGAEFYELTQAVTEAHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  GAE  HNL YWRYGDY+G+GPGAH R+ +G+ + A +IE+HPE+WL  V  
Sbjct: 241 YEVSNHARPGAECRHNLVYWRYGDYVGVGPGAHGRLSLGASKRATAIERHPETWLANVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +GH +VE   L+ E+Q DE+L+MGLRL EG+ +  +E LAGR +D      L + G +E+
Sbjct: 301 HGHGMVENLPLTEEEQGDEYLLMGLRLVEGVDLSRYEALAGRQIDPRRLDALLQHGMVEK 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +   +LR T+ G  +LD+V+A+LA
Sbjct: 361 IGNHKLRATRDGFFVLDAVVADLA 384


>gi|254718390|ref|ZP_05180201.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|265983354|ref|ZP_06096089.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|306839623|ref|ZP_07472427.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. NF 2653]
 gi|264661946|gb|EEZ32207.1| coproporphyrinogen III oxidase [Brucella sp. 83/13]
 gi|306405321|gb|EFM61596.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. NF 2653]
          Length = 404

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+ YR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRSYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQCVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|209966228|ref|YP_002299143.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Rhodospirillum centenum SW]
 gi|209959694|gb|ACJ00331.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Rhodospirillum centenum SW]
          Length = 387

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 183/388 (47%), Positives = 246/388 (63%), Gaps = 6/388 (1%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M+        +YVHWPFC  KCPYCDFNSHV R  + QE +  + L E+     L   R 
Sbjct: 1   MSVPSDPGFALYVHWPFCASKCPYCDFNSHV-REGIDQERWRAALLRELDHFAALAPGRR 59

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++S+FFGGGTPSL+ P  +  +L     +W + +  E+T+EANP+SVE   F+ +R AGV
Sbjct: 60  LTSVFFGGGTPSLMAPATVEALLRRADGHWGLPAGTEVTLEANPTSVEAGRFRDFRAAGV 119

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L++  LR LGR H+A+EA+ AI LAR  F R SFDLIYA P QT+  W+ E
Sbjct: 120 NRVSLGIQALDDADLRRLGRRHSAAEALGAIRLARAAFDRFSFDLIYARPGQTVAAWKQE 179

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RAL  AV HLSLYQLTIE+GT F+ +H+ G+LVLP E+   +LY  TQ++  A GL A
Sbjct: 180 LARALDEAVGHLSLYQLTIEEGTQFHTLHERGELVLPDEDTQGELYEETQALLEAAGLPA 239

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  G ES HNL YWRYGDY+G+GPGAH R+ +   +V     + P+ WL+ V +
Sbjct: 240 YEVSNHARPGEESRHNLTYWRYGDYVGVGPGAHGRLTLTQGKVGTRTHRAPDIWLERVER 299

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQG 366
           +G A    E +  +++  E LMMGLRLREG+ +      +GR     LD +    L+R G
Sbjct: 300 DGTAAKPFEPIGPQERLVELLMMGLRLREGVPLDRIAAESGRPAAQALDPDRLDGLRRHG 359

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
            +E     RLR T  G T L+ V+  L 
Sbjct: 360 LLETAD-GRLRATAEGRTRLNGVLRALL 386


>gi|62289151|ref|YP_220944.1| coproporphyrinogen III oxidase [Brucella abortus bv. 1 str. 9-941]
 gi|189023427|ref|YP_001934195.1| coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|237814644|ref|ZP_04593642.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           str. 2308 A]
 gi|254690478|ref|ZP_05153732.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|254696598|ref|ZP_05158426.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731511|ref|ZP_05190089.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260546450|ref|ZP_05822190.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260756032|ref|ZP_05868380.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260759256|ref|ZP_05871604.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260760979|ref|ZP_05873322.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260885052|ref|ZP_05896666.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
 gi|297247567|ref|ZP_06931285.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           bv. 5 str. B3196]
 gi|62195283|gb|AAX73583.1| oxygen-independent coproporphyrinogen III oxidase, hypothetical
           [Brucella abortus bv. 1 str. 9-941]
 gi|189018999|gb|ACD71721.1| coproporphyrinogen III oxidase [Brucella abortus S19]
 gi|237789481|gb|EEP63691.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           str. 2308 A]
 gi|260096557|gb|EEW80433.1| coproporphyrinogen III oxidase [Brucella abortus NCTC 8038]
 gi|260669574|gb|EEX56514.1| coproporphyrinogen III oxidase [Brucella abortus bv. 4 str. 292]
 gi|260671411|gb|EEX58232.1| coproporphyrinogen III oxidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676140|gb|EEX62961.1| coproporphyrinogen III oxidase [Brucella abortus bv. 6 str. 870]
 gi|260874580|gb|EEX81649.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
 gi|297174736|gb|EFH34083.1| oxygen-independent coproporphyrinogen III oxidase [Brucella abortus
           bv. 5 str. B3196]
          Length = 404

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIY  P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYVRPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|148560210|ref|YP_001258208.1| coproporphyrinogen III oxidase [Brucella ovis ATCC 25840]
 gi|161618164|ref|YP_001592051.1| coproporphyrinogen III oxidase [Brucella canis ATCC 23365]
 gi|163842445|ref|YP_001626849.1| coproporphyrinogen III oxidase [Brucella suis ATCC 23445]
 gi|254700981|ref|ZP_05162809.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|254707135|ref|ZP_05168963.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|254709322|ref|ZP_05171133.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|260567187|ref|ZP_05837657.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|261314611|ref|ZP_05953808.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|261316833|ref|ZP_05956030.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|261751502|ref|ZP_05995211.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|261756066|ref|ZP_05999775.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|265987903|ref|ZP_06100460.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
 gi|294851575|ref|ZP_06792248.1| oxygen-independent coproporphyrinogen III oxidase [Brucella sp.
           NVSL 07-0026]
 gi|306844443|ref|ZP_07477033.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO1]
 gi|148371467|gb|ABQ61446.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella ovis ATCC 25840]
 gi|161334975|gb|ABX61280.1| oxygen-independent coproporphyrinogen III oxidase [Brucella canis
           ATCC 23365]
 gi|163673168|gb|ABY37279.1| Coproporphyrinogen III oxidase [Brucella suis ATCC 23445]
 gi|260156705|gb|EEW91785.1| coproporphyrinogen III oxidase [Brucella suis bv. 4 str. 40]
 gi|261296056|gb|EEX99552.1| coproporphyrinogen III oxidase [Brucella pinnipedialis B2/94]
 gi|261303637|gb|EEY07134.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M163/99/10]
 gi|261741255|gb|EEY29181.1| coproporphyrinogen III oxidase [Brucella suis bv. 5 str. 513]
 gi|261745819|gb|EEY33745.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|264660100|gb|EEZ30361.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
 gi|294820164|gb|EFG37163.1| oxygen-independent coproporphyrinogen III oxidase [Brucella sp.
           NVSL 07-0026]
 gi|306275256|gb|EFM57006.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO1]
          Length = 404

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 206/384 (53%), Positives = 268/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|90421847|ref|YP_530217.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB18]
 gi|90103861|gb|ABD85898.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodopseudomonas palustris BisB18]
          Length = 386

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 198/383 (51%), Positives = 264/383 (68%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
                 + GVY+HWPFC+ KCPYCDFNSHVR   + QE ++++F+ E++   + T  R +
Sbjct: 3   RADRDPAFGVYIHWPFCLSKCPYCDFNSHVRHVAIDQERYLRAFVREIETTAERTPGREV 62

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           +SIF GGGTPSL++P  +  IL+ I K+W V+++VEI++EANP+SVE   F+GYR AGVN
Sbjct: 63  TSIFLGGGTPSLMQPATVGGILEAIGKHWNVAADVEISMEANPTSVEATRFRGYRAAGVN 122

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQ+L++ SL+ LGR H A EA+ A+ +AR+IF R SFDLIYA P QT   W+ EL
Sbjct: 123 RVSLGVQALDDLSLKTLGRLHTAQEAMEAVAIARSIFERYSFDLIYARPGQTPAMWQAEL 182

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           Q+A+  A +HLSLYQLTIE  T F+ +H  G L  P E  A  LY++TQ + +AHGL +Y
Sbjct: 183 QKAIGEAAEHLSLYQLTIEADTPFFGLHAAGKLQTPDEATARALYDVTQEVCAAHGLPSY 242

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V   
Sbjct: 243 EISNHARAGAECRHNLLYWRGQEYAGIGPGAHGRLDINGIRHAIATEKRPEAWLMRVEAC 302

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
           GH VV  + L+SE++ADEFL+MGLRL EGI    ++ L+GR LD      L+ +G I   
Sbjct: 303 GHGVVVDDRLNSEERADEFLLMGLRLAEGIDPTRYQALSGRALDPARIAVLREEGAIVVD 362

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
              RLR T  G  +LD+V+A+LA
Sbjct: 363 PNGRLRVTLSGFPLLDAVVADLA 385


>gi|163849853|ref|YP_001637896.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           extorquens PA1]
 gi|163661458|gb|ABY28825.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           extorquens PA1]
          Length = 405

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 192/379 (50%), Positives = 248/379 (65%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+     L   R+++SIF
Sbjct: 26  DAGFGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIF 85

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 86  LGGGTPSLMAPDTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSL 145

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+
Sbjct: 146 GVQALDDGDLKRLGRLHSVAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAI 205

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            YA +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I    GL AYEISN
Sbjct: 206 DYAAEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICGLAGLPAYEISN 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE W   V ++GH +
Sbjct: 266 HARPGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEEWRARVERDGHGI 325

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R
Sbjct: 326 VETETLSAEDQGDEFLMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGR 385

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T RG  +L++V+A LA
Sbjct: 386 IAATARGAPVLNAVVAELA 404


>gi|307943383|ref|ZP_07658727.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseibium sp. TrichSKD4]
 gi|307773013|gb|EFO32230.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseibium sp. TrichSKD4]
          Length = 388

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 201/381 (52%), Positives = 267/381 (70%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
                 G+Y+HWPFC  KCPYCDFNSHVR   V Q+ F  +F  E+     LT  +++ S
Sbjct: 7   APDGGFGIYIHWPFCAAKCPYCDFNSHVRHQAVDQDRFAAAFERELTHFADLTKGKTVQS 66

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL++PQ +  IL  ++  W++   VEI++EANPSSVE   F+GYR AGVNR+
Sbjct: 67  IFFGGGTPSLMKPQTVERILSKVSGLWSIDDEVEISLEANPSSVESERFRGYRAAGVNRV 126

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLGVQSL ++ L+ LGR H+   A+ AI  AR+ FPR+SFDLIYA P Q++  W  ELQ+
Sbjct: 127 SLGVQSLHDRDLKLLGRLHDVKTALKAIETARSTFPRLSFDLIYARPDQSLEDWRAELQQ 186

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL  A DHLSLYQLTIE GT FY ++  G LV+P  +V  + Y LTQ IT+AHGL AYE+
Sbjct: 187 ALDLAADHLSLYQLTIEPGTPFYTLYHAGKLVVPEPDVGAEFYALTQDITTAHGLPAYEV 246

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SNH+  GAE  HN  YWRYGDY+G+GPGAH R+ VG+ ++A +IE+HPE+WL+ V  +GH
Sbjct: 247 SNHARPGAECRHNQVYWRYGDYVGVGPGAHGRITVGASKLATAIERHPETWLENVETHGH 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
             VE + LS E+Q DEFL+MGLRL EGI ++ +E +A R +D      L   G +E++  
Sbjct: 307 GKVEDQGLSEEEQGDEFLLMGLRLTEGIDLQRYEKIACRAIDPRRLSALIEHGMVEKIDE 366

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
           +R+R T+ G  +LD+V+A+LA
Sbjct: 367 TRVRATRDGFMVLDAVVADLA 387


>gi|304392748|ref|ZP_07374688.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ahrensia sp. R2A130]
 gi|303295378|gb|EFL89738.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ahrensia sp. R2A130]
          Length = 394

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 205/386 (53%), Positives = 260/386 (67%), Gaps = 4/386 (1%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
             G+   G+YVHWPFC  KCPYCDFNSHVR   V QE F   F  E+  M  L   R ++
Sbjct: 8   DDGTPGFGIYVHWPFCAAKCPYCDFNSHVRHRTVDQEAFAAGFEREIAHMAALQPNRPVT 67

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           S+FFGGGTPSL+EP  +  IL+ I  +W V   +EIT+EANP+SVE + F GYR AGVNR
Sbjct: 68  SVFFGGGTPSLMEPATVGTILEAIHSHWRVEDGIEITLEANPTSVEADRFSGYRAAGVNR 127

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLGVQSL ++ L+FLGR H+A EAIAAI +AR++FPR+SFD+IYA P Q +  W++EL+
Sbjct: 128 VSLGVQSLRDEQLKFLGRMHSADEAIAAIGIARDLFPRLSFDMIYARPDQKLDDWKVELE 187

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           +A+S A DHLSLYQLTIE  T FY +HK G   +P    A  LY LTQ IT A GL AYE
Sbjct: 188 QAISLAADHLSLYQLTIEPDTPFYDLHKKGRFAIPDHEQAAQLYELTQDITEAAGLPAYE 247

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           ISNH+  G ES HNL YWR G + GIGPGAH R+ +   R A++ ++HPESWL  V+ NG
Sbjct: 248 ISNHAIPGHESRHNLTYWRSGTWAGIGPGAHGRLDMNDGRHALATKRHPESWLDDVQDNG 307

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQ 372
           HA+VE E LS    ADE L+MG+RLREG+ +  +    G  +D    ++L+  G +E   
Sbjct: 308 HALVEDETLSDADLADEMLLMGMRLREGVDLNRYTQTTGIAIDPIRLQDLKGHGMVESWT 367

Query: 373 FS----RLRCTQRGMTMLDSVIANLA 394
                 RLR T  G  +LD+VIA+LA
Sbjct: 368 DEQGRPRLRATPAGWLVLDAVIADLA 393


>gi|17988054|ref|NP_540688.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|225851708|ref|YP_002731941.1| coproporphyrinogen III oxidase [Brucella melitensis ATCC 23457]
 gi|256045966|ref|ZP_05448838.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112679|ref|ZP_05453600.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264780|ref|ZP_05467312.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563249|ref|ZP_05833735.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|265992378|ref|ZP_06104935.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994121|ref|ZP_06106678.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983802|gb|AAL52952.1| oxygen-independent coproporphyrinogen iii oxidase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225640073|gb|ACN99986.1| oxygen-independent coproporphyrinogen III oxidase [Brucella
           melitensis ATCC 23457]
 gi|260153265|gb|EEW88357.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|262765102|gb|EEZ11023.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003444|gb|EEZ15737.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095189|gb|EEZ18858.1| coproporphyrinogen III oxidase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408199|gb|ADZ65264.1| coproporphyrinogen III oxidase [Brucella melitensis M28]
 gi|326537914|gb|ADZ86129.1| oxygen-independent coproporphyrinogen III oxidase [Brucella
           melitensis M5-90]
          Length = 404

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 206/384 (53%), Positives = 268/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEMTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|256258734|ref|ZP_05464270.1| coproporphyrinogen III oxidase [Brucella abortus bv. 9 str. C68]
          Length = 397

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 13  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 73  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 132

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIY  P QT+  W  E
Sbjct: 133 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYVRPDQTIEAWREE 192

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 193 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 253 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 312

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 313 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 372

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 373 MGGSLIRATPDGALVLDALVADLA 396


>gi|254705352|ref|ZP_05167180.1| coproporphyrinogen III oxidase [Brucella suis bv. 3 str. 686]
 gi|256030845|ref|ZP_05444459.1| coproporphyrinogen III oxidase [Brucella pinnipedialis M292/94/1]
          Length = 397

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 206/384 (53%), Positives = 268/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 13  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 73  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 132

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 133 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 192

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 193 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 253 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 312

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 313 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 372

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 373 MGGSLIRATPDGALVLDALVADLA 396


>gi|188579739|ref|YP_001923184.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           populi BJ001]
 gi|179343237|gb|ACB78649.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           populi BJ001]
          Length = 392

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 193/379 (50%), Positives = 246/379 (64%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               GVY+HWPFC  KCPYCDFNSHVR   V Q  F+++F  E+     L   R ++SIF
Sbjct: 13  DAGFGVYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLEAFRREIAHAAALAPGRMVTSIF 72

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ P+ +A +LD +A  W V+ + E+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 73  LGGGTPSLMAPETVAGLLDAVAGAWAVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSL 132

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++  L+ LGR H+  EA++A+  A   F R SFDLIYA P QT   W  EL+RA+
Sbjct: 133 GVQALDDGDLKRLGRLHSVEEALSAVRTAAAHFERFSFDLIYARPDQTAQAWAAELRRAI 192

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +YA +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I  A GL AYEISN
Sbjct: 193 AYAAEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICEAAGLPAYEISN 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V + GH +
Sbjct: 253 HARPGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEGWLARVEREGHGI 312

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
              E LS E Q DEFLMMGLRL EGI    +  L GR LD      L   G + R    R
Sbjct: 313 TGTESLSPEDQGDEFLMMGLRLSEGIDPDRYAALKGRPLDATRLEALVTDGLVARRPNGR 372

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T RG  +L++V+A LA
Sbjct: 373 IAATARGAPVLNAVVAELA 391


>gi|218528484|ref|YP_002419300.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           chloromethanicum CM4]
 gi|218520787|gb|ACK81372.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           chloromethanicum CM4]
          Length = 398

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 193/379 (50%), Positives = 248/379 (65%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+    +L   R+++SIF
Sbjct: 19  DAGFGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAELAPGRTVTSIF 78

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 79  LGGGTPSLMAPDTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSL 138

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+
Sbjct: 139 GVQALDDGDLKRLGRLHSVAEALDAVRTAAAHFERFSFDLIYARPEQTPEAWAAELRRAI 198

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            YA +HLSLYQLTIE GT F+ + + G LV P ++    LY++TQ I    GL AYEISN
Sbjct: 199 DYAAEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDATRALYDVTQEICGLAGLPAYEISN 258

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V ++G  V
Sbjct: 259 HARPGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEEWLARVERDGDGV 318

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R
Sbjct: 319 VETETLSAEDQGDEFLMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGR 378

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T RG  +L++V+A LA
Sbjct: 379 IAATARGAPVLNAVVAELA 397


>gi|256060315|ref|ZP_05450488.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
 gi|261324290|ref|ZP_05963487.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
 gi|261300270|gb|EEY03767.1| coproporphyrinogen III oxidase [Brucella neotomae 5K33]
          Length = 404

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 206/384 (53%), Positives = 268/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKLVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|240137079|ref|YP_002961548.1| putative oxidase [Methylobacterium extorquens AM1]
 gi|240007045|gb|ACS38271.1| putative oxidase [Methylobacterium extorquens AM1]
          Length = 392

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 193/379 (50%), Positives = 249/379 (65%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+     L   R+++SIF
Sbjct: 13  DAGFGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIF 72

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 73  LGGGTPSLMAPDTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSL 132

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+
Sbjct: 133 GVQALDDGDLKRLGRLHSVAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAI 192

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            YA +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I    GL AYEISN
Sbjct: 193 DYAAEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICGRAGLPAYEISN 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HNL YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V ++GH +
Sbjct: 253 HARPGAQSRHNLLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEDWLARVERDGHGI 312

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R
Sbjct: 313 VETETLSAEDQGDEFLMMGLRLTEGIDSARYASLKGRPLHAGRLDALARDGLVARRPDGR 372

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T RG  +L++V+A LA
Sbjct: 373 IAATARGAPVLNAVVAELA 391


>gi|92115781|ref|YP_575510.1| coproporphyrinogen III oxidase [Nitrobacter hamburgensis X14]
 gi|91798675|gb|ABE61050.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Nitrobacter hamburgensis X14]
          Length = 386

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 204/383 (53%), Positives = 267/383 (69%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
           +   + + GVYVHWPFC+ KCPYCDFNSHVR   + +E F+++F  E++     +  R +
Sbjct: 3   SADPTTAFGVYVHWPFCLSKCPYCDFNSHVRHAPIDEERFVRAFTREIETTAARSPGREV 62

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           SSIF GGGTPSL++PQ +  IL+ I KNW V+ N EIT+EANP+SVE   F+GYR AGVN
Sbjct: 63  SSIFLGGGTPSLMQPQTVGAILEAIGKNWRVADNAEITLEANPTSVEATRFRGYRAAGVN 122

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQ+L++ SL+ LGR H A EA+ A+ +AR++F R SFDLIYA P QT   W  EL
Sbjct: 123 RVSLGVQALDDASLKALGRLHTAREALDAVAIARSVFDRYSFDLIYARPDQTPAMWSEEL 182

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           QRA+S A +HLSLYQLTIE+GT F+ +H  G L  P E ++  LY++TQ I + HGL AY
Sbjct: 183 QRAISEAAEHLSLYQLTIEQGTPFFGLHAAGKLKTPDEAISRALYDVTQEICARHGLPAY 242

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V   
Sbjct: 243 EISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGDRHAIATEKRPEAWLMRVEAI 302

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
           G+ +V  + L+SE++ADEFL+MGLRLREGI  + +  L+GR LD      L+ +G I   
Sbjct: 303 GNGIVADDLLNSEERADEFLLMGLRLREGIDPQRYAALSGRLLDPRRIAILREEGAIAIS 362

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
              RLR TQ G  +LD+V+A+LA
Sbjct: 363 PDGRLRVTQDGFPVLDAVVADLA 385


>gi|91974877|ref|YP_567536.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris BisB5]
 gi|91681333|gb|ABE37635.1| coproporphyrinogen III oxidase, anaerobic [Rhodopseudomonas
           palustris BisB5]
          Length = 385

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 200/384 (52%), Positives = 261/384 (67%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M      + GVYVHWPFC+ KCPYCDFNSHVR   + +  F ++F  E+       GPR 
Sbjct: 1   MGADPDKAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEARFARAFAREIAATAARIGPRD 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++P  +  ILD I K+W V+ + E+++EANP+SVE   F+GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPSTVGAILDAIGKHWRVTPDAEVSLEANPTSVEATRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++ SL+ LGR H A EA+ A+ +AR+ F R SFDLIYA P QT   WE E
Sbjct: 121 NRVSLGVQALDDASLKTLGRLHTAQEAMDAVAIARSAFDRYSFDLIYARPGQTPAMWEAE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+RA+  A +HLSLYQLTIE  T F+ +H+ G L  P E+ +  LY++TQS+ +  GL A
Sbjct: 181 LRRAIGEAAEHLSLYQLTIEAETPFFALHRAGKLQTPDESASRALYDVTQSVCAELGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +G  R AI+ EK PESW+  V  
Sbjct: 241 YEISNHARPGAECKHNLVYWRGQEYAGIGPGAHGRLDIGGTRYAIATEKRPESWMMRVEA 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            G  V+  + L+SE++ADEFL+MGLRL EGI  + ++ LAGR+LD      L  +G I  
Sbjct: 301 TGTGVITDDRLNSEERADEFLLMGLRLAEGIDPRRYQALAGRSLDPSRIALLCAEGAIVV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 DADGRLRVTQAGFPVLDAVVADLA 384


>gi|85714063|ref|ZP_01045052.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
 gi|85699189|gb|EAQ37057.1| coproporphyrinogen III oxidase [Nitrobacter sp. Nb-311A]
          Length = 386

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 205/382 (53%), Positives = 268/382 (70%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
              + + GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F  E++     +  R++S
Sbjct: 4   ADPATAFGVYVHWPFCLSKCPYCDFNSHVRHAPIDEERFARAFAREIETTAARSRGRTVS 63

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSL++PQ +  ILD I K+W V  +VE+T+EANP+SVE   F+GYR AGVNR
Sbjct: 64  SIFLGGGTPSLMQPQTVGAILDAIGKHWGVGGDVEVTLEANPTSVEATRFRGYRAAGVNR 123

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLGVQ+L++ SL+ LGR H A EA+ A+ +AR++F R SFDLIYA P QT   W  ELQ
Sbjct: 124 VSLGVQALDDPSLKALGRLHTAREALDAVAIARSVFGRYSFDLIYARPDQTPVMWAEELQ 183

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           RA+S AV+HLSLYQLTIE+GT F+ +H  G L  P+E +A  LY++TQ I + HGL AYE
Sbjct: 184 RAISEAVEHLSLYQLTIEEGTPFFGLHTAGKLKTPNEAIARALYDVTQEICTRHGLPAYE 243

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           +SNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE+WL  V   G
Sbjct: 244 VSNHARPGAECRHNLVYWRGEEYAGIGPGAHGRLDIDGIRHAIATEKRPEAWLMRVEATG 303

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQ 372
             VV  + L+SE++ADEFL+MGLRLREGI  + +  L+GR+LD      L+ +G I    
Sbjct: 304 DGVVADDLLNSEERADEFLLMGLRLREGIDPQRYAALSGRSLDPRRIAILRDEGAITIST 363

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RLR TQ G  +LD+V+A+LA
Sbjct: 364 DGRLRVTQDGFPVLDAVVADLA 385


>gi|254559087|ref|YP_003066182.1| oxidase [Methylobacterium extorquens DM4]
 gi|254266365|emb|CAX22129.1| putative oxidase [Methylobacterium extorquens DM4]
          Length = 392

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 192/379 (50%), Positives = 248/379 (65%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+Y+HWPFC  KCPYCDFNSHVR   V Q  F+ +F  E+     L   R+++SIF
Sbjct: 13  DAGFGIYLHWPFCAAKCPYCDFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIF 72

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ P  +A +LD +A  W+V+ + E+T+EANP+SVE   F+GYR AGVNR+SL
Sbjct: 73  LGGGTPSLMAPNTVAGLLDAVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSL 132

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L++  L+ LGR H+ +EA+ A+  A   F R SFDLIYA P+QT   W  EL+RA+
Sbjct: 133 GVQALDDGDLKRLGRLHSVAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAI 192

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            YA +HLSLYQLTIE GT F+ + + G LV P ++ +  LY++TQ I    GL AYEISN
Sbjct: 193 DYAAEHLSLYQLTIEPGTPFFGLAQAGRLVPPDDDASRALYDVTQEICGLAGLPAYEISN 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GA+S HN  YWRYG+Y GIGPGAH R+ +   R     EK PE WL  V ++GH +
Sbjct: 253 HARPGAQSRHNQLYWRYGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEDWLARVERDGHGI 312

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE E LS+E Q DEFLMMGLRL EGI    +  L GR L       L R G + R    R
Sbjct: 313 VETETLSAEDQGDEFLMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGR 372

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T RG  +L++V+A LA
Sbjct: 373 IAATARGAPVLNAVVAELA 391


>gi|225626714|ref|ZP_03784753.1| oxygen-independent coproporphyrinogen III oxidase [Brucella ceti
           str. Cudo]
 gi|256158874|ref|ZP_05456728.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
 gi|256254251|ref|ZP_05459787.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|260169749|ref|ZP_05756560.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|261221402|ref|ZP_05935683.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|261759290|ref|ZP_06002999.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|265997364|ref|ZP_06109921.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
 gi|225618371|gb|EEH15414.1| oxygen-independent coproporphyrinogen III oxidase [Brucella ceti
           str. Cudo]
 gi|260919986|gb|EEX86639.1| coproporphyrinogen III oxidase [Brucella ceti B1/94]
 gi|261739274|gb|EEY27270.1| coproporphyrinogen III oxidase [Brucella sp. F5/99]
 gi|262551832|gb|EEZ07822.1| coproporphyrinogen III oxidase [Brucella ceti M490/95/1]
          Length = 404

 Score =  284 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL  
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPV 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|82699090|ref|YP_413664.1| coproporphyrinogen III oxidase [Brucella melitensis biovar Abortus
           2308]
 gi|82615191|emb|CAJ10132.1| Putative oxygen-independent coproporphyrinogen III
           oxidase:Elongator protein 3/MiaB/NifB:Radical SAM
           [Brucella melitensis biovar Abortus 2308]
          Length = 385

 Score =  284 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 1   MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIY  P QT+  W  E
Sbjct: 121 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYVRPDQTIEAWREE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 181 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 241 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 301 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 361 MGGSLIRATPDGALVLDALVADLA 384


>gi|23501087|ref|NP_697214.1| coproporphyrinogen III oxidase [Brucella suis 1330]
 gi|256368640|ref|YP_003106146.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
 gi|23346956|gb|AAN29129.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Brucella suis 1330]
 gi|255998798|gb|ACU47197.1| coproporphyrinogen III oxidase [Brucella microti CCM 4915]
          Length = 385

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 206/384 (53%), Positives = 268/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TGPR+
Sbjct: 1   MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGPRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 121 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 181 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 241 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 301 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 361 MGGSLIRATPDGALVLDALVADLA 384


>gi|261218176|ref|ZP_05932457.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
 gi|261320976|ref|ZP_05960173.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
 gi|260923265|gb|EEX89833.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
 gi|261293666|gb|EEX97162.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
          Length = 404

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TG R+
Sbjct: 20  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGLRT 79

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 80  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 139

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 140 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 199

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 200 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 259

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 260 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 319

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 320 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 379

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 380 MGGSLIRATPDGALVLDALVADLA 403


>gi|148251802|ref|YP_001236387.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. BTAi1]
 gi|146403975|gb|ABQ32481.1| putative oxygen-independent coproporphyrinogen III oxidase (yggW)
           [Bradyrhizobium sp. BTAi1]
          Length = 385

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 202/384 (52%), Positives = 264/384 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           MT   + + GVYVHWPFC+ KCPYCDFNSHVR   + Q+ F ++F  E++      G R+
Sbjct: 1   MTSAENEAFGVYVHWPFCLSKCPYCDFNSHVRHTAIDQDRFARAFAREIETTAARIGART 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++PQ +  ILD I K+W V+S+VE+++EANP+SVE   F GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPQTVGAILDAIGKHWHVASDVEVSLEANPTSVEATRFAGYRTAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ++++ SL+ LGR H A EA+ A+ +AR  F R SFDLIYA P QT   W  E
Sbjct: 121 NRVSLGVQAMDDASLKMLGRLHTAEEAMKAVAIARQAFTRYSFDLIYARPDQTPAMWTEE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA+  A +HLSLYQLTIE+GT F+ +H  G L  P E +A  LY++TQ + + HGL A
Sbjct: 181 LTRAIGEAAEHLSLYQLTIEEGTPFFGLHAAGKLKTPDEGLARTLYDVTQEVCARHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ +K PE+WL  V  
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGIRHAIATDKRPEAWLMRVES 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           NGH V+  + L+ E++ADEFL+MGLRL EGI  K +  ++GR LD      L+ +G I  
Sbjct: 301 NGHGVMTDDELNREERADEFLLMGLRLAEGIDPKRYAAISGRPLDPRRIALLREEGAIIV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 DGDGRLRVTQDGFPVLDAVVADLA 384


>gi|254713257|ref|ZP_05175068.1| coproporphyrinogen III oxidase [Brucella ceti M644/93/1]
 gi|254716390|ref|ZP_05178201.1| coproporphyrinogen III oxidase [Brucella ceti M13/05/1]
          Length = 397

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TG R+
Sbjct: 13  MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGLRT 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 73  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 132

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 133 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 192

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 193 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 252

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 253 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 312

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 313 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 372

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 373 MGGSLIRATPDGALVLDALVADLA 396


>gi|209883565|ref|YP_002287422.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Oligotropha carboxidovorans OM5]
 gi|209871761|gb|ACI91557.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Oligotropha carboxidovorans OM5]
          Length = 385

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M     N+ GVYVHWPFC+ KCPYCDFNSHVR   + +E F ++F+ E+         R+
Sbjct: 1   MRADAHNAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAFVREIATTAARAPDRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++PQ +A ILD IA++W+V  +VE+T+EANP+SVE   F GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMKPQTVATILDAIAQHWSVDKSVEVTLEANPTSVEATRFAGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L++QSL+ LGR H A EA+ A+ +AR  F R SFDLIYA P Q +  W  E
Sbjct: 121 NRVSLGVQALDDQSLKALGRLHTAREALDAVAIARRAFKRYSFDLIYARPDQGVQAWAGE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA++ A +HLSLYQLTIE+GT F+ +H+ G L  P+E++A  LY++TQ I +A+ L A
Sbjct: 181 LHRAIAEAAEHLSLYQLTIEEGTPFFGLHRAGKLKTPNEDLARALYDVTQEICAANNLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R AI+ EK PE WL  V +
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGIRHAIATEKRPEVWLSRVEE 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++  + L SEQ+ADEFL+MGLRL EGI  + +E LAGR LD      L+  G I  
Sbjct: 301 EGHGLITDDLLDSEQRADEFLLMGLRLAEGIDPQRYETLAGRPLDPHRIAALKNDGAIVM 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 DINGRLRVTQAGFPLLDAVVADLA 384


>gi|86747549|ref|YP_484045.1| coproporphyrinogen III oxidase [Rhodopseudomonas palustris HaA2]
 gi|86570577|gb|ABD05134.1| coproporphyrinogen III oxidase, anaerobic [Rhodopseudomonas
           palustris HaA2]
          Length = 390

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 203/378 (53%), Positives = 265/378 (70%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
            + GVYVHWPFC+ KCPYCDFNSHVR   + ++ F ++F  E++   Q  GPR ++SIF 
Sbjct: 12  QAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEDRFARAFAREIEATAQRIGPRDVTSIFL 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL++PQ +  ILD I K W V+ +VE+++EANP+SVE   F+GYR AGVNR+SLG
Sbjct: 72  GGGTPSLMQPQTVGAILDAIGKYWRVAPDVEVSLEANPTSVEATRFRGYRAAGVNRVSLG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQ+L++ SL+ LGR H A EA+ A+ +AR  F R SFDLIYA P QT   WE EL+RA+ 
Sbjct: 132 VQALDDASLKTLGRLHTAQEAMEAVAIARAAFDRYSFDLIYARPGQTPAMWEAELRRAIG 191

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A +HLSLYQLTIE  T F+ +H+ G L  P E+ +  LY++TQS+ +  GL AYEISNH
Sbjct: 192 EAAEHLSLYQLTIEAETPFFALHRAGKLQTPDESASRALYDVTQSVCAELGLPAYEISNH 251

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAE  HNL YWR  +Y GIGPGAH R+ +G  R AI+ EK PESWL  V  +G  VV
Sbjct: 252 ARPGAECKHNLVYWRGQEYAGIGPGAHGRLDIGGTRYAIATEKRPESWLMRVEASGTGVV 311

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             + L+SE++ADEFL+MGLRL EGI  + ++ LAGR+LD      L+ +G I      RL
Sbjct: 312 TDDRLNSEERADEFLLMGLRLAEGIDPRRYQALAGRSLDPSRIAILREEGAIAVDADGRL 371

Query: 377 RCTQRGMTMLDSVIANLA 394
           R TQ G  +LD+V+A+LA
Sbjct: 372 RVTQAGFPVLDAVVADLA 389


>gi|306842540|ref|ZP_07475191.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO2]
 gi|306287396|gb|EFM58876.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Brucella sp. BO2]
          Length = 385

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 267/384 (69%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M   G  + G+YVHWPFC+ KCPYCDFNSHVR   V Q  +  +F  EM+ +R+ TG R+
Sbjct: 1   MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAAFRREMETLRERTGLRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIF GGGTPSL++P+ +  +LDGIA  W+V+ ++E+T+EANP+SVE + F+GYR AGV
Sbjct: 61  VTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L +  LR LGR H+ +EA AAI LAR IFPR+SFDLIYA P QT+  W  E
Sbjct: 121 NRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L+ A+  A DHLSLYQLTIE+GT FY + K G L  P  ++A  LY  TQ +T+ HGL A
Sbjct: 181 LKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYG Y GIGPGAH R      R     EKHPE+WL  V +
Sbjct: 241 YEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVER 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
            GH ++E+E+L   Q+ DEFLMMGLRLREGI +  +  L+G  +D +    L  +G IE 
Sbjct: 301 RGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEP 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +  S +R T  G  +LD+++A+LA
Sbjct: 361 MGGSLIRATPDGALVLDALVADLA 384


>gi|84501189|ref|ZP_00999394.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
 gi|84390480|gb|EAQ02968.1| coproporphyrinogen III oxidase [Oceanicola batsensis HTCC2597]
          Length = 384

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 179/378 (47%), Positives = 245/378 (64%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV R  + Q+ ++ ++L+E+         R +SS+FFG
Sbjct: 9   GFGIYIHWPFCEAKCPYCDFNSHVSRS-IDQDRWLSAYLSELDRQAAEVPGRVVSSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +  +LD IA+ W  +++ EIT+EANP SVE + F+ Y  AGV+R+S+G 
Sbjct: 68  GGTPSLMDPHVVGAVLDRIARLWPQANDPEITLEANPGSVESSRFRAYHSAGVSRVSMGF 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q++ +  LR LGR H  +EA+ A  +AR+ F R+SFDLIYA   QT   W+ EL++AL  
Sbjct: 128 QAMNDGDLRRLGRLHTVAEALRAFDIARSCFERVSFDLIYARQDQTPEDWQKELEQALEL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE+GT F   ++ G L   P E+ A  +Y +TQ++T+A G   YE+SNH
Sbjct: 188 AVDHLSLYQLTIEEGTAFGDRYRIGKLRGLPDEDAAATMYEITQAVTAAAGFEPYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HN  YWRYGDY+GIGPGAH R+ +G  R A    + P+ WLK   + G+   
Sbjct: 248 ARPGAESRHNSLYWRYGDYVGIGPGAHGRLTLGGKRNATEAIRMPDGWLKA-AEQGNGDK 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  LS   QA EFL+MGLRL EG+ +  +  LAGR L      +L   G IE     RL
Sbjct: 307 RRTPLSPSDQATEFLLMGLRLTEGVDMMRYTRLAGRPLSQSSVLDLSEMGMIE-TDGQRL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           R + +G  +L++VIA L 
Sbjct: 366 RVSPQGRLVLNAVIARLL 383


>gi|182680298|ref|YP_001834444.1| oxygen-independent coproporphyrinogen III oxidase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182636181|gb|ACB96955.1| oxygen-independent coproporphyrinogen III oxidase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 402

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 186/383 (48%), Positives = 253/383 (66%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
              G  + G+Y+HWPFC+ KCPYCDFNSHVR   + +  F+     E+     LT  R +
Sbjct: 19  ASAGEPAFGIYLHWPFCLSKCPYCDFNSHVRAEPIDEPRFLSGLKRELAHRASLTPGRQV 78

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           SSIFFGGGTPSL++   +A ++D IA +W ++  VEIT+EANP+SVE   F  YR AGVN
Sbjct: 79  SSIFFGGGTPSLMQGSTVAALIDAIAGHWPLAPQVEITLEANPTSVEAERFAAYRAAGVN 138

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQ+L++ +L+ LGR H+A+EA+ A+  A ++F R SFDLIY  P QT+  W  EL
Sbjct: 139 RVSLGVQALDDAALQSLGRKHSAAEALRAVKTAASLFERYSFDLIYGRPGQTLADWRREL 198

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
             AL YA DHLSLYQLTIE  T F ++   G   LP  ++  DL++LTQ + +  GL AY
Sbjct: 199 GDALHYARDHLSLYQLTIEPETPFAQLAASGRFTLPEADLGRDLWDLTQEVMNKAGLPAY 258

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           E+SNH+  GAES HNL YWRYG+Y G+GPGAH R+     R A +  + P+ WLK V + 
Sbjct: 259 EVSNHARPGAESRHNLLYWRYGEYAGVGPGAHGRLLTPHGRRAQATLRQPDLWLKTVEER 318

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
           G  + E   L+ E+QADEFL+MGLRL EGI+ +++  +AGR+ D    + L  +G +E  
Sbjct: 319 GEGLTEDMPLTREEQADEFLLMGLRLTEGIAPENFRAVAGRDFDPRRLQTLLSEGMLEYT 378

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
              R+R +  G  +LD+VIA+LA
Sbjct: 379 PHGRVRVSAEGFPVLDAVIADLA 401


>gi|146337343|ref|YP_001202391.1| coproporphyrinogen III oxidase [Bradyrhizobium sp. ORS278]
 gi|146190149|emb|CAL74141.1| putative oxygen-independent coproporphyrinogen III oxidase (yggW)
           [Bradyrhizobium sp. ORS278]
          Length = 385

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 203/384 (52%), Positives = 263/384 (68%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M+   S + GVYVHWPFC+ KCPYCDFNSHVR   + Q+ F ++F  E+      TGPR+
Sbjct: 1   MSSAESEAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDQDRFARAFAQEIANTAARTGPRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +SSIF GGGTPSL++PQ +  ILD I K+W V+ +VE+++EANP+SVE   F GYR AGV
Sbjct: 61  VSSIFLGGGTPSLMQPQTVGAILDAIGKHWHVAPDVEVSLEANPTSVEATRFAGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ++++ SL+ LGR H A EA+ A+ +AR  F R SFDLIYA P QT   W  E
Sbjct: 121 NRVSLGVQAMDDASLKMLGRLHTAEEAMKAVAIARGAFERYSFDLIYARPDQTAAMWTEE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA+  A +HLSLYQLTIE+GT F+ +H  G L    E +A  LY++TQ I + HGL A
Sbjct: 181 LTRAIGEAAEHLSLYQLTIEEGTPFFGLHAAGKLKTLDEGLARTLYDVTQEICARHGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  GAE  HNL YWR  +Y GIGPGAH R+ +   R A + +K PE+WL  V  
Sbjct: 241 YEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIEGIRHATATDKRPEAWLMRVET 300

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           NGH V+  + L+SE++ADEFL+MGLRL EGI  + +  +AGR LD      L+ +G I  
Sbjct: 301 NGHGVMTDDLLNSEERADEFLLMGLRLSEGIDPRRYAAIAGRTLDPRRIALLREEGAIAV 360

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               RLR TQ G  +LD+V+A+LA
Sbjct: 361 EPDGRLRVTQDGFPVLDAVVADLA 384


>gi|254472504|ref|ZP_05085904.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudovibrio sp. JE062]
 gi|211958787|gb|EEA93987.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudovibrio sp. JE062]
          Length = 387

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 196/385 (50%), Positives = 270/385 (70%), Gaps = 1/385 (0%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           MT   +   G+YVHWPFC+ KCPYCDFNSHVR   V QE++ ++  TE+    Q+   R+
Sbjct: 1   MTVSPAGGFGIYVHWPFCLAKCPYCDFNSHVRHQPVSQEHYAKALATELARYAQMVPGRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + SIFFGGGTPSL+EP+ +  IL+ IA+ W +  + EI++EANP+SVE   F GYR AGV
Sbjct: 61  VDSIFFGGGTPSLMEPKTVETILNEIARLWHLPDSAEISMEANPTSVEATRFAGYRSAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+G+Q+L+++ L+ LGR H+ SEAI A+ +AR  FPR+SFDLIYA P QT+  WE E
Sbjct: 121 NRLSVGIQALDDKELKILGRQHSVSEAIQAVEIARKTFPRISFDLIYARPNQTLKAWEQE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RA+  A DHLS+YQLTIE GT+F +++  G L +   ++A D+++LTQ +T+A G  A
Sbjct: 181 LNRAIDLAADHLSMYQLTIESGTMFQRLYAAGKLEMLDPDLAADMFDLTQEVTAARGFPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSH-RVAISIEKHPESWLKMVR 309
           YE+SNH+   A+ LHNL YWRYGDY+G+GPGAH R+ +    ++A S EKHPE+WL +V 
Sbjct: 241 YEVSNHAAPDAQCLHNLIYWRYGDYVGVGPGAHGRLTLEDGAKLATSTEKHPETWLGLVE 300

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
             GH  + ++ L  ++Q DE L+MG+RL EGI V  +E L+GR    +   NLQ  G +E
Sbjct: 301 TKGHGAISEDRLVRDEQGDELLLMGMRLHEGIDVPRYEQLSGRQFSPQRLLNLQENGMVE 360

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
            V  +RLR TQ G  +L++VIA LA
Sbjct: 361 WVSNTRLRATQTGFPLLNAVIAELA 385


>gi|13473883|ref|NP_105451.1| coproporphyrinogen III oxidase [Mesorhizobium loti MAFF303099]
 gi|14024634|dbj|BAB51237.1| oxygen-independent coproporphyrinogen III oxidase; HemN
           [Mesorhizobium loti MAFF303099]
          Length = 392

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 212/385 (55%), Positives = 266/385 (69%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
            M    S   GVY+HWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MR+ TGPR
Sbjct: 7   TMPLDRSPGFGVYIHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFEAELATMRERTGPR 66

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            ++SIF GGGTPSL++P+ +A +LD +AKNWTV   +E+T+EANPSSVE   F+GYR AG
Sbjct: 67  EVTSIFLGGGTPSLMKPETVARVLDAVAKNWTVPDGIEVTLEANPSSVEAERFRGYRAAG 126

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR+SLGVQ+L ++ LRFLGR HN  EA+ AI LAR IFPR+SFDLIYA P QT   W  
Sbjct: 127 VNRVSLGVQALNDKDLRFLGRLHNVEEALHAIGLAREIFPRLSFDLIYARPGQTPEAWAA 186

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           EL++A+ +A DHLSLYQLTIE+GT F+ +H     ++P  + A DLY LTQ  TSAHGL 
Sbjct: 187 ELEQAIGHAADHLSLYQLTIEEGTPFHALHAAKKFIIPDNDHAADLYALTQETTSAHGLP 246

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
           AYEISNH+  GAES HNL YWRYG+Y+G+GPGAH R      R     E+ PE+W  +V 
Sbjct: 247 AYEISNHARPGAESRHNLTYWRYGEYVGVGPGAHGRFVEHGRRTVTIAERMPETWANLVE 306

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
             GH V   E L+  ++ADEFL+MGLRL EGI +  +E  +GR L       LQ +G + 
Sbjct: 307 AKGHGVTGGEILTRSEEADEFLLMGLRLAEGIDLARYEAFSGRGLSSARLSVLQGEGLVA 366

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
            +  +RLR T  GM +LD+V+A+LA
Sbjct: 367 PIGNARLRATPAGMIVLDAVVADLA 391


>gi|260463465|ref|ZP_05811665.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           opportunistum WSM2075]
 gi|259030790|gb|EEW32066.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           opportunistum WSM2075]
          Length = 385

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 210/379 (55%), Positives = 267/379 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   GVY+HWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MRQ TGPR ++SIF
Sbjct: 6   APGFGVYIHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFEAELATMRQRTGPREVTSIF 65

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL++P+ +A +LD +A+NWTV   +E+T+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 66  FGGGTPSLMKPETVARVLDAVARNWTVPDGIEVTLEANPSSVEAERFRGYRTAGVNRVSL 125

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LRFLGR HN  EA+ AI LAR IFPR+SFDLIYA P QT   W  EL++A+
Sbjct: 126 GVQALNDKDLRFLGRLHNVEEALHAIGLAREIFPRLSFDLIYARPGQTPEAWASELEQAI 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +A DHLSLYQLTIE+GT F+ +H     ++P  + A DLY LTQ IT+AHGL AYEISN
Sbjct: 186 GHAADHLSLYQLTIEEGTPFHALHAAKKFIIPDNDHAADLYALTQEITTAHGLPAYEISN 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG+Y+G+GPGAH R      R     E+ PE+W  +V   GH +
Sbjct: 246 HARPGAESRHNLTYWRYGEYVGVGPGAHGRFVEHGRRTVTIAERMPETWANLVEAKGHGI 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
              E L+  ++ADEFL+MGLRL EGI +  +E  +GR L       LQ +G +  +  +R
Sbjct: 306 TGGEILTRSEEADEFLLMGLRLAEGIDLSRYEAFSGRGLSSARLSVLQGEGLVAPIGNTR 365

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  GM +LD+V+A+LA
Sbjct: 366 LRATPAGMIVLDAVVADLA 384


>gi|158425915|ref|YP_001527207.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Azorhizobium caulinodans ORS 571]
 gi|158332804|dbj|BAF90289.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Azorhizobium caulinodans ORS 571]
          Length = 385

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 194/377 (51%), Positives = 255/377 (67%), Gaps = 1/377 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             GVYVHWPFC+ KCPYCDFNSHVR+    Q  ++ +F  E+  MR LTGPR+  S+FFG
Sbjct: 9   GFGVYVHWPFCLAKCPYCDFNSHVRQAPPDQARYVAAFRREIAHMRALTGPRTAGSVFFG 68

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +  ILD I + WT++ + EIT+EANP+SVE   F+GYR AGVNR+SLGV
Sbjct: 69  GGTPSLMAPETVGAILDAIREAWTLAPDAEITLEANPTSVEAGRFRGYRAAGVNRVSLGV 128

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++  L+ LGR H   EA+ A+ +AR+IF R+SFDLIYA P Q    W  EL RA+  
Sbjct: 129 QALDDGELKKLGRMHTVDEALGAVGIARSIFERVSFDLIYARPGQNPQDWARELSRAIDE 188

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +HLSLYQLTIE GT F K++  G L++P +  A  L+++TQ +T+A GL AYEISNH+
Sbjct: 189 GCEHLSLYQLTIEPGTAFEKLYSAGKLLIPDDEHARALWDVTQEVTAASGLPAYEISNHA 248

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAE+ HNL YWRYG Y G+GPGAH RV     R A   E+HPE WLK V  NGH +V 
Sbjct: 249 RPGAEARHNLVYWRYGLYAGVGPGAHGRVGQKGERRATYTERHPEGWLKAVEANGHGIVS 308

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
           +E L++ +QADE L+MGLRL EG+ +     L G  +D      L  +G + R+  +RL+
Sbjct: 309 EEVLTAAEQADEMLLMGLRLAEGVDLARHAALGGTPIDPARIAMLADEGLV-RLDGTRLK 367

Query: 378 CTQRGMTMLDSVIANLA 394
               G  +L++VI  LA
Sbjct: 368 VLPPGFPVLNAVIGTLA 384


>gi|149204372|ref|ZP_01881339.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
 gi|149142257|gb|EDM30304.1| coproporphyrinogen III oxidase [Roseovarius sp. TM1035]
          Length = 395

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 177/378 (46%), Positives = 244/378 (64%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q  +  ++LTE+     L   R ++++FFG
Sbjct: 19  GFGLYLHWPFCEAKCPYCDFNSHVA-RHIDQSRWCAAYLTEIDRYAALLPGRVLNTVFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A I++ I  +W ++++ EIT+EANP SVE   F+ + +AG++RIS+G+
Sbjct: 78  GGTPSLMAPETVAAIIERIKHHWPMANDPEITLEANPGSVEAGRFRAFAQAGISRISMGI 137

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  L+ LGR H+A+EA  A  +AR  F R+SFDLIYA   QT+  W+ EL+ ALS 
Sbjct: 138 QALNDTDLKRLGRIHSAAEARQAFDIARENFERVSFDLIYARQDQTLDSWKTELRSALSM 197

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVA-VDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE GT F   +  G L    E+    ++Y  TQ I ++ GL AYE+SNH
Sbjct: 198 AVDHLSLYQLTIESGTAFGDRYAAGKLRGLPEDDIAAEMYETTQEICASAGLPAYEVSNH 257

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDYIGIGPGAH R+     + A    + P  WL+ V  +G  + 
Sbjct: 258 ARAGAESRHNLIYWRYGDYIGIGPGAHGRITHNGQKYATEAHRAPGKWLESVENSG-VIE 316

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +E LS   QA E+L+MGLR+ +GI    +E LAG+ LD     +L   G IE    +RL
Sbjct: 317 TRERLSGPDQAVEYLLMGLRITDGIDPARFERLAGKPLDPAAVDHLVSIGMIE-THDTRL 375

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T+ G  +L++VI +L 
Sbjct: 376 RATRSGRAVLNAVIRDLL 393


>gi|220920080|ref|YP_002495381.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           nodulans ORS 2060]
 gi|219944686|gb|ACL55078.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           nodulans ORS 2060]
          Length = 387

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 189/377 (50%), Positives = 254/377 (67%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             GVY+HWPFC  KCPYCDFNSHVR     +  +  +F  E+  +  LT  R+++SIFFG
Sbjct: 10  GFGVYLHWPFCAAKCPYCDFNSHVRHAPPDEAVWRAAFAREIAHVSALTPGRTVTSIFFG 69

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +  +LD +A  W++S + EIT+EANP+SVE   F+GYR AGVNR+SLGV
Sbjct: 70  GGTPSLMQPATVGALLDAVAGAWSLSPDAEITLEANPTSVEAERFRGYRLAGVNRVSLGV 129

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ SL+ LGR H+A+EA+AA+  A   F R SFDLIYA P QT   W  EL+ A++ 
Sbjct: 130 QALDDASLKRLGRLHSAAEALAAVATAARHFERYSFDLIYARPDQTQAAWAAELREAIAR 189

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
           A +HLSLYQLTIE+GT F+ +   G LV P E+ A  L+++TQ + +A GL AYEISNH+
Sbjct: 190 AAEHLSLYQLTIEEGTPFHGLAAAGKLVTPDEDAARALFDVTQEVCAAAGLPAYEISNHA 249

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HNL YWRYG+Y GIGPGAH R+ +   R     E+ PE+WL  V ++GH +V 
Sbjct: 250 RPGAESRHNLLYWRYGEYAGIGPGAHGRLVLPEGRTGTVTERVPEAWLARVARDGHGIVT 309

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLR 377
            E L   ++ADEFL+MGLRL EGI    +  LAGR +D      L ++G I      R+ 
Sbjct: 310 MEPLKPAEEADEFLLMGLRLAEGIDPARFAALAGRPIDRGRLDALVQEGLIALTGSGRIA 369

Query: 378 CTQRGMTMLDSVIANLA 394
            T +G  +L++++A LA
Sbjct: 370 ATPKGAPVLNALVAELA 386


>gi|170749348|ref|YP_001755608.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655870|gb|ACB24925.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 391

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 193/379 (50%), Positives = 252/379 (66%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
               G+Y+HWPFC  KCPYCDFNSHVRR  V +  F+ +F  E+      T  R+++SIF
Sbjct: 12  DAGFGIYLHWPFCAAKCPYCDFNSHVRRAGVDEPRFLAAFRAEIAHNAARTPGRTVTSIF 71

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++P  +A +LD +A +W V+ + E+T+EANPSSVE   F GYR AGVNR+SL
Sbjct: 72  LGGGTPSLMQPATVAGLLDAVAAHWAVAPDAEVTLEANPSSVEAGRFHGYRAAGVNRVSL 131

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L++ SLR LGR H+ ++A+ AI LA++ F R SFDLIYA P QT   W  EL  AL
Sbjct: 132 GIQALDDASLRTLGRLHDTAQALDAIALAQSAFARTSFDLIYARPGQTPALWRAELAEAL 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A +HLSLYQLTIE GT F+ +   G LV P + V   LY++TQ + +  GL AYEISN
Sbjct: 192 ARAAEHLSLYQLTIEPGTPFHGLAAAGKLVTPDDEVGRALYDVTQDLCARAGLPAYEISN 251

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG+Y GIGPGAH R+     R+    E+ PE+WL  V   GH +
Sbjct: 252 HARPGAESRHNLLYWRYGEYAGIGPGAHGRLVTPGGRLGTVTERSPEAWLARVEAEGHGI 311

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
           VE E L++  QADEFL+MGLRLREGI    +  L GR L+      L   G +ER+   R
Sbjct: 312 VETEILTAADQADEFLVMGLRLREGIDPDTYAALKGRPLNGNRIGMLIGDGLLERLPGGR 371

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T RG  +L++++A LA
Sbjct: 372 IAATARGAPVLNALVAELA 390


>gi|319780508|ref|YP_004139984.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166396|gb|ADV09934.1| oxygen-independent coproporphyrinogen III oxidase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 387

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 210/379 (55%), Positives = 267/379 (70%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   GVYVHWPFC  KCPYCDFNSHVR   V QE F  +F  E+  MR+ TGPR ++S+F
Sbjct: 8   TPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQERFAAAFEAELATMRERTGPREVTSVF 67

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL++P+ +A +LD +AKNWTV + +E+T+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 68  LGGGTPSLMKPETVARVLDAVAKNWTVPAGIEVTLEANPSSVEAERFRGYRAAGVNRVSL 127

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L ++ LRFLGR HN  EA+ AI LAR IFPR+SFDLIYA P QT   W  EL++A+
Sbjct: 128 GVQALNDKDLRFLGRLHNVEEALHAIGLAREIFPRLSFDLIYARPGQTPEAWASELEQAI 187

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +A DHLSLYQLTIE+GT F+ +H     ++P  + A DLY LTQ IT+AHGL AYEISN
Sbjct: 188 GHAADHLSLYQLTIEEGTPFHALHAAKKFIIPDNDHAADLYALTQEITTAHGLPAYEISN 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  GAES HNL YWRYG+Y+G+GPGAH R      R     E+ PE+W  +V   GH V
Sbjct: 248 HARPGAESRHNLTYWRYGEYVGVGPGAHGRFVENGRRTVTIAERMPETWANLVEAKGHGV 307

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSR 375
              E L+  ++ADEFL+MGLRL EGI +  +E  +GR L       LQ +G +  +  +R
Sbjct: 308 TGGEILTRSEEADEFLLMGLRLAEGIDLARYEAFSGRGLSSARLSMLQGEGLVAPIGNAR 367

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T  GM +LD+V+A+LA
Sbjct: 368 LRATAAGMIVLDAVVADLA 386


>gi|260441106|ref|ZP_05794922.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI2]
 gi|291044438|ref|ZP_06570147.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI2]
 gi|291011332|gb|EFE03328.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI2]
          Length = 391

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|59800687|ref|YP_207399.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA 1090]
 gi|293399618|ref|ZP_06643771.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           gonorrhoeae F62]
 gi|59717582|gb|AAW88987.1| putative porphyrin oxidoreductase [Neisseria gonorrhoeae FA 1090]
 gi|291610187|gb|EFF39309.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           gonorrhoeae F62]
          Length = 391

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 129/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|240127626|ref|ZP_04740287.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-93-1035]
 gi|268686006|ref|ZP_06152868.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-93-1035]
 gi|268626290|gb|EEZ58690.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-93-1035]
          Length = 391

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|170738391|ref|YP_001767046.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           sp. 4-46]
 gi|168192665|gb|ACA14612.1| oxygen-independent coproporphyrinogen III oxidase [Methylobacterium
           sp. 4-46]
          Length = 398

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 188/387 (48%), Positives = 251/387 (64%), Gaps = 2/387 (0%)

Query: 10  NMTGQGSN--SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG 67
            M    +     GVY+HWPFC  KCPYCDFNSHVR     +  +  +F  E+     L  
Sbjct: 11  RMIDHPTRDVGFGVYLHWPFCAAKCPYCDFNSHVRHAPPDEAAWRAAFAREIAHAAALAP 70

Query: 68  PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRK 127
            R+++S+F GGGTPSL++P  +  +LD +A  WTV+   EIT+EANP+SVE + F+GYR 
Sbjct: 71  GRTVTSVFLGGGTPSLMQPATVGALLDAVAAAWTVAPGAEITLEANPTSVEADRFRGYRL 130

Query: 128 AGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQW 187
           AGVNR+SLGVQ+L++ +LR LGR H+A+EA+AA+  A   F R SFDLIYA P QT   W
Sbjct: 131 AGVNRVSLGVQALDDGALRRLGRLHSAAEALAAVETASRHFARFSFDLIYARPDQTPAAW 190

Query: 188 EMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHG 247
             EL++A++ A +HLSLYQLTIE+GT F+ +   G LV P E+ A  L+++TQ +  A G
Sbjct: 191 AAELRQAIARAAEHLSLYQLTIEEGTPFHGLAAAGRLVPPDEDTARALFDVTQEVCGAAG 250

Query: 248 LHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKM 307
           L AYEISNH+  GAES HNL YWRYG+Y GIGPGAH R+ +   R     E+ PE+WL  
Sbjct: 251 LPAYEISNHARPGAESRHNLLYWRYGEYAGIGPGAHGRLVLPGGRTGTVTERAPEAWLAR 310

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGF 367
           V + GH +V  E L+  ++ DEFL+MGLRL EGI    +  LAGR LD      L  +  
Sbjct: 311 VAREGHGIVRTEALTQAEEGDEFLVMGLRLAEGIDPARFARLAGRPLDRRRLDGLLAEDL 370

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +   Q  R+  T +G  +L++V+A LA
Sbjct: 371 VRVTQAGRIAATPKGAPVLNAVVAELA 397


>gi|194097947|ref|YP_002000993.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae NCCP11945]
 gi|239998420|ref|ZP_04718344.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 35/02]
 gi|240015984|ref|ZP_04722524.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA6140]
 gi|268594282|ref|ZP_06128449.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 35/02]
 gi|193933237|gb|ACF29061.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae NCCP11945]
 gi|268547671|gb|EEZ43089.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 35/02]
 gi|317163706|gb|ADV07247.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 391

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 127/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|240080124|ref|ZP_04724667.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA19]
 gi|268596276|ref|ZP_06130443.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA19]
 gi|268550064|gb|EEZ45083.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae FA19]
          Length = 391

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|240013545|ref|ZP_04720458.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae DGI18]
 gi|240115078|ref|ZP_04729140.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID18]
 gi|240120617|ref|ZP_04733579.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID24-1]
 gi|240125171|ref|ZP_04738057.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-92-679]
 gi|268600752|ref|ZP_06134919.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID18]
 gi|268683766|ref|ZP_06150628.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-92-679]
 gi|268584883|gb|EEZ49559.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID18]
 gi|268624050|gb|EEZ56450.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae SK-92-679]
          Length = 391

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 127/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|149912894|ref|ZP_01901428.1| coproporphyrinogen III oxidase [Roseobacter sp. AzwK-3b]
 gi|149813300|gb|EDM73126.1| coproporphyrinogen III oxidase [Roseobacter sp. AzwK-3b]
          Length = 385

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 175/379 (46%), Positives = 243/379 (64%), Gaps = 4/379 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNS V    + Q  +++++L E+     +   R ++S+F G
Sbjct: 9   GFGLYLHWPFCEAKCPYCDFNSQVS-RDIDQSRWLRAYLHEIDRYAGMLPGRVLNSVFLG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A IL+ + ++W  ++++E+T+EANP SVE   F+GY +AGV+R+S+G+
Sbjct: 68  GGTPSLMDPDVVAAILERVRQSWPQANDLEVTLEANPGSVEARRFRGYAEAGVSRVSMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L ++ LR LGR H+ +EA  A  +AR  F R+SFDLIYA   QT+  W  EL  AL  
Sbjct: 128 QALNDEDLRRLGRIHSLAEARQAHDIARKNFDRVSFDLIYARQDQTVEAWRAELGEALEM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE+GT F   +  G L   P+E+ A D+Y  TQ I +  G+ AYE+SNH
Sbjct: 188 AVDHLSLYQLTIEQGTAFADRYARGGLKGLPAEDAAADMYEATQEICAGAGMDAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDY+GIGPGAH RV +   R A     +P+ WL  V        
Sbjct: 248 AKPGAESRHNLIYWRYGDYVGIGPGAHGRVTLDGQRHATEAWSNPDRWLSAVDAGQSEKS 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             E +  + QA E+LMMGLR+REGI V  +E +AG  L  E    L+  G IE     R+
Sbjct: 308 -CEAIDPKDQAAEYLMMGLRIREGIDVVRYEAMAGEALSEEKLIELRELGMIE-SNGQRV 365

Query: 377 RCTQRGMTMLDSVIANLAV 395
             T++G  +L++V+ +L V
Sbjct: 366 WVTEQGRPVLNAVLRDLLV 384


>gi|85706898|ref|ZP_01037988.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
 gi|85668509|gb|EAQ23380.1| coproporphyrinogen III oxidase [Roseovarius sp. 217]
          Length = 396

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 179/395 (45%), Positives = 245/395 (62%), Gaps = 10/395 (2%)

Query: 3   YLSAY--ENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           +L A   E+   G      G+YVHWPFC  KCPYCDFNSHV   ++ Q  +  ++L E+ 
Sbjct: 6   WLQAVLPEDWQEG----GFGLYVHWPFCEAKCPYCDFNSHVA-REIDQTRWCTAYLAEID 60

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
               L   R ++++FFGGGTPSL+ P+ IA +++ I  +W +++  EIT+EANP SVE  
Sbjct: 61  RYAALVPGRVLNTVFFGGGTPSLMAPETIAALIERIKASWPMANAPEITLEANPGSVEAG 120

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
            F+ + +AGV RIS+GVQ+L +  L+ LGR H+ +EA  A  +AR  F R+SFDLIYA  
Sbjct: 121 RFRAFAEAGVTRISMGVQALNDIDLKRLGRIHSVAEARQAFDIARENFDRVSFDLIYARQ 180

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVA-VDLYNLT 239
            QT+  W+ EL+ AL+ AVDHLSLYQLTIE GT F   +  G L    E+    D+Y  T
Sbjct: 181 DQTLEAWKAELREALAMAVDHLSLYQLTIETGTAFGDRYAAGKLRGLPEDETAADMYEAT 240

Query: 240 QSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEK 299
           Q I  A GL AYE+SNH+  G+ES HNL YWRYGDYIGIGPGAH R+     + A    +
Sbjct: 241 QEICDAAGLPAYEVSNHARPGSESRHNLIYWRYGDYIGIGPGAHGRITRNGQKHATEAHR 300

Query: 300 HPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE 359
            P  WL    +   +  +   LS + QA E+L+MGLR+ +GI    +E LAG+ L     
Sbjct: 301 APGRWLDS-VETASSERKPVRLSGQDQAVEYLLMGLRISDGIDPGRFEKLAGQPLSPTVV 359

Query: 360 RNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
            +LQ+ G IE +  +RLR T+ G  +L++VI +L 
Sbjct: 360 DHLQQIGMIESL-GTRLRATRAGRAVLNAVIRDLL 393


>gi|325133820|gb|EGC56476.1| hypothetical protein NMBM13399_1544 [Neisseria meningitidis M13399]
          Length = 399

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEG 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|240112338|ref|ZP_04726828.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae MS11]
 gi|240117362|ref|ZP_04731424.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID1]
 gi|240122917|ref|ZP_04735873.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID332]
 gi|254493139|ref|ZP_05106310.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 1291]
 gi|268598397|ref|ZP_06132564.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae MS11]
 gi|268603058|ref|ZP_06137225.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID1]
 gi|268681537|ref|ZP_06148399.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID332]
 gi|226512179|gb|EEH61524.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae 1291]
 gi|268582528|gb|EEZ47204.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae MS11]
 gi|268587189|gb|EEZ51865.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID1]
 gi|268621821|gb|EEZ54221.1| coproporphyrinogen III oxidase [Neisseria gonorrhoeae PID332]
          Length = 391

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 129/391 (32%), Positives = 208/391 (53%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP +VE+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTVEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+Y+LP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYSLPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGTLEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            GL  YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGLIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMVQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEKGRLFLNDLLQCFL 391


>gi|261392962|emb|CAX50547.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria meningitidis 8013]
          Length = 391

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 129/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGIPAAQIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T+RG   L+ ++    
Sbjct: 362 QKGLLE-TDPAVFRPTERGRLFLNDLLQCFL 391


>gi|15676563|ref|NP_273707.1| coproporphyrinogen III oxidase [Neisseria meningitidis MC58]
 gi|7225891|gb|AAF41083.1| oxygen-independent coprophorphyrinogen III oxidase family protein
           [Neisseria meningitidis MC58]
 gi|316983631|gb|EFV62612.1| oxygen-independent coproporphyrinogen III oxidase-like protein yggW
           [Neisseria meningitidis H44/76]
          Length = 391

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 391


>gi|94496908|ref|ZP_01303482.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingomonas sp. SKA58]
 gi|94423584|gb|EAT08611.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingomonas sp. SKA58]
          Length = 393

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 175/388 (45%), Positives = 235/388 (60%), Gaps = 10/388 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +    +  L +Y+HWPFCV KCPYCDFNSHV R  +  + +  + L +M     LTG R 
Sbjct: 10  VASPTTEPLALYIHWPFCVSKCPYCDFNSHV-REGIDVDAWRGALLADMAHEAALTGGRP 68

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIFFGGGTPSL+ P  +A ++    + W ++ + EIT+EANP+SVE   F     AGV
Sbjct: 69  LTSIFFGGGTPSLMPPALVADLIAAADRQWGLAPDSEITLEANPNSVEAARFADLAAAGV 128

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+Q+L+  +L FLGR H+  E +AA+  A+ +F R+SFDLIYA P Q+   WE E
Sbjct: 129 NRVSLGLQALDNDALHFLGRAHDVDEGLAALATAQRVFDRVSFDLIYARPGQSEADWEAE 188

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RAL +   HLSLYQLTIE GT F  +   G L     +    LY LTQS+T A G+ A
Sbjct: 189 LARALGFGTGHLSLYQLTIEPGTRFATLVAQGKLTPADPDHGATLYELTQSMTVAAGIPA 248

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWRYGDY GIGPGAH          A    K PE+W+  V +
Sbjct: 249 YEISNHARPGQESRHNLTYWRYGDYAGIGPGAH----GRRTGQATVRHKKPENWMNAVAR 304

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL----DIECERNLQRQG 366
           NGH    +E L+ E +A E L+MGLRLREG+ ++     +G  +    D      L   G
Sbjct: 305 NGHGAQGEEPLADEDRAREALLMGLRLREGVDLRRIASESGITISQLVDDLAVARLMEIG 364

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
            ++R Q S ++ T  GM +LD+++  + 
Sbjct: 365 LMDR-QESHIQVTPAGMLLLDAILPEIV 391


>gi|254804543|ref|YP_003082764.1| putative porphyrin oxidoreductase [Neisseria meningitidis alpha14]
 gi|254668085|emb|CBA04593.1| putative porphyrin oxidoreductase [Neisseria meningitidis alpha14]
 gi|254670338|emb|CBA05750.1| putative porphyrin oxidoreductase [Neisseria meningitidis alpha153]
 gi|308388850|gb|ADO31170.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           meningitidis alpha710]
          Length = 391

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 391


>gi|121634461|ref|YP_974706.1| coproporphyrinogen III oxidase [Neisseria meningitidis FAM18]
 gi|120866167|emb|CAM09907.1| putative porphyrin oxidoreductase [Neisseria meningitidis FAM18]
 gi|325135743|gb|EGC58355.1| hypothetical protein NMBM0579_1451 [Neisseria meningitidis M0579]
          Length = 399

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 205/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS     L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNNDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEG 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQSQPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|319410037|emb|CBY90371.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria meningitidis WUE 2594]
          Length = 391

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPTAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 391


>gi|89052695|ref|YP_508146.1| coproporphyrinogen III oxidase [Jannaschia sp. CCS1]
 gi|88862244|gb|ABD53121.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Jannaschia sp. CCS1]
          Length = 385

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 178/378 (47%), Positives = 245/378 (64%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV    + Q  +++++L+E+  +      R++ S+FFG
Sbjct: 9   GFGLYVHWPFCEAKCPYCDFNSHVSAR-IDQGAWLKAYLSELDRVAAELPNRTLGSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P ++A I++ + + W VS+++E+T+EANPSSVE   F GY+ AGVNR+S+GV
Sbjct: 68  GGTPSLMAPDSVASIIEAVRRLWPVSNDLEVTLEANPSSVEAGRFAGYKDAGVNRVSVGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++  L+ LGR H+  EA AAI +AR  F RMSFDLIYA   Q++  W  EL +AL+ 
Sbjct: 128 QALDDVDLKRLGRLHSVKEAYAAIDVARAHFERMSFDLIYARQDQSLAAWRTELTQALNL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLSLYQLTIE GT F   H  G L   P E+++ D+Y+LTQ +  A GL AYE+SNH
Sbjct: 188 AADHLSLYQLTIEPGTAFGTRHAKGGLRGLPEEDLSADMYDLTQDLCGAAGLPAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +   A+S HNL YW  GDY GIGPGAH RV +   R        P++WL  V K+G    
Sbjct: 248 AADFAQSRHNLVYWHAGDYAGIGPGAHGRVTLAGRRYGTETYLQPQAWLDAVGKSGSGES 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           ++  LS+ +QA+E+LMM LRL EG     +E L G+ LD    R+L   G IE     R+
Sbjct: 308 DRTALSAREQAEEYLMMSLRLTEGSDPARYEALNGQPLDPVKIRDLVDLGLIEST-PERI 366

Query: 377 RCTQRGMTMLDSVIANLA 394
           + T  G  +L+ ++ +L 
Sbjct: 367 KATACGRPVLNGILRDLL 384


>gi|325127827|gb|EGC50735.1| hypothetical protein NMXN1568_1476 [Neisseria meningitidis N1568]
 gi|325131882|gb|EGC54582.1| hypothetical protein NMBM6190_1409 [Neisseria meningitidis M6190]
 gi|325137932|gb|EGC60507.1| hypothetical protein NMBES14902_1559 [Neisseria meningitidis
           ES14902]
 gi|325139886|gb|EGC62417.1| hypothetical protein NMBCU385_1468 [Neisseria meningitidis CU385]
 gi|325197885|gb|ADY93341.1| hypothetical protein NMBG2136_0612 [Neisseria meningitidis G2136]
 gi|325200649|gb|ADY96104.1| hypothetical protein NMBH4476_1524 [Neisseria meningitidis H44/76]
          Length = 399

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEG 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQSQPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|325129805|gb|EGC52613.1| hypothetical protein NMBOX9930304_1399 [Neisseria meningitidis
           OX99.30304]
 gi|325202539|gb|ADY97993.1| hypothetical protein NMBM01240149_1428 [Neisseria meningitidis
           M01-240149]
 gi|325207711|gb|ADZ03163.1| hypothetical protein NMBNZ0533_0711 [Neisseria meningitidis
           NZ-05/33]
          Length = 399

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|218767786|ref|YP_002342298.1| coproporphyrinogen III oxidase [Neisseria meningitidis Z2491]
 gi|121051794|emb|CAM08100.1| putative porphyrin oxidoreductase [Neisseria meningitidis Z2491]
          Length = 399

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPTAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|309378944|emb|CBX22397.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 391

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 127/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + ++FFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETVFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEN 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPAMQCCHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQSQPSVAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTKQGRLFLNDLLQCFL 391


>gi|161869602|ref|YP_001598769.1| coproporphyrinogen III oxidase [Neisseria meningitidis 053442]
 gi|161595155|gb|ABX72815.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           meningitidis 053442]
          Length = 399

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKINIDLMYALPNQTVR 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|261364291|ref|ZP_05977174.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria mucosa ATCC 25996]
 gi|288567538|gb|EFC89098.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria mucosa ATCC 25996]
          Length = 391

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 127/380 (33%), Positives = 203/380 (53%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI+ A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLMRLGRVHNGKEALTAINTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  
Sbjct: 196 TGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      V
Sbjct: 253 AKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPIEAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E++ +++     EF+M  LRL +G+     +   G             +++G +E    +
Sbjct: 313 ERKTVAAADLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLE-TDPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T+RG   L+ ++    
Sbjct: 372 VFRPTERGRLFLNDLLQCFL 391


>gi|255066001|ref|ZP_05317856.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria sicca ATCC 29256]
 gi|255049912|gb|EET45376.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria sicca ATCC 29256]
          Length = 391

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 128/380 (33%), Positives = 203/380 (53%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALDDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y LT+E  T F  M   G L    +  A+D+ +         G   YE S  
Sbjct: 196 TGATHISAYHLTMEPNTPFGHMPPKGLL---QDEAALDIEDAVHGALEGAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++    A V
Sbjct: 253 AKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSAAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E++ +++E    EF+M  LRL +G+     +   G             +++G +     +
Sbjct: 313 ERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLA-TDPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T+RG   L+ ++    
Sbjct: 372 VFRPTERGRLFLNDLLQCFL 391


>gi|148550176|ref|YP_001270278.1| coproporphyrinogen III oxidase [Pseudomonas putida F1]
 gi|148514234|gb|ABQ81094.1| coproporphyrinogen III oxidase, anaerobic [Pseudomonas putida F1]
          Length = 391

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 211/382 (55%), Gaps = 12/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFF
Sbjct: 17  PPLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFF 76

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L GI +    + ++EIT+EANP + E + F+ YR+ G+NR+S+G
Sbjct: 77  GGGTPSLFSANALGRLLRGIEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIG 136

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A+
Sbjct: 137 VQSFQPAKLEALGRIHNGDEAVRAADMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAI 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 197 DLGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSA 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++  G  + HNLNYWR+GD+IGIG GAH ++     R+      + P+ +L +       
Sbjct: 253 YAQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLA---KPF 309

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
              ++ L  ++   EFLM  LRL +G+  + +    G  L    E     +++G + +V+
Sbjct: 310 KAGEKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLSQLQEARPAAEQKGLL-QVE 368

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RL  T RG   L+ ++    
Sbjct: 369 PDRLVATPRGQLFLNDLLQYFL 390


>gi|254475038|ref|ZP_05088424.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ruegeria sp. R11]
 gi|214029281|gb|EEB70116.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ruegeria sp. R11]
          Length = 384

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 175/379 (46%), Positives = 239/379 (63%), Gaps = 4/379 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV    + Q  + +++  E+         R +++IFFG
Sbjct: 8   GFGLYVHWPFCQAKCPYCDFNSHVTAR-IDQSKWAEAYRRELLRAAPQLSGRVLNTIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A ++D   + W  S+++EI++EANP+SVE   F GYR AGVNRIS+GV
Sbjct: 67  GGTPSLMHPDTVATVIDTAREIWPFSNDIEISLEANPTSVEAGRFVGYRDAGVNRISMGV 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H+ SEA AA  +ARN F R+SFDLIYA   QT+  W+ EL  ALS 
Sbjct: 127 QALNDDDLRRLGRMHSVSEARAAFDVARNCFDRVSFDLIYARQGQTIETWKAELNDALSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVA-VDLYNLTQSITSAHGLHAYEISNH 256
           A+DHLSLYQLTIE GT F   ++ G L     +    D+Y  TQ I  AHGL AYE+SNH
Sbjct: 187 AIDHLSLYQLTIEAGTAFGDRYERGTLRDLPSDDNAADMYLATQEICEAHGLPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDY+G+GPGAH R+ +G  R A      P +W++ V        
Sbjct: 247 ARPGAESRHNLIYWRYGDYLGVGPGAHGRLTLGGDRYATETYLQPGAWMEAVTSG-SGEA 305

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           ++  LS +  + EFLMMG+RL EG+ +  +  ++G++L  +   +L   G +E  +  RL
Sbjct: 306 QRTLLSKDDASAEFLMMGMRLVEGLDMGRYRNISGKDLPADRITHLVDIGMVE-TRGDRL 364

Query: 377 RCTQRGMTMLDSVIANLAV 395
             T  G  +L++++  L V
Sbjct: 365 IATDDGRAVLNAILRELLV 383


>gi|241758876|ref|ZP_04756989.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           flavescens SK114]
 gi|241321084|gb|EER57297.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria
           flavescens SK114]
          Length = 391

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 130/380 (34%), Positives = 205/380 (53%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +E +I + LT++Q        R + +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEEAYIDALLTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAKSIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  
Sbjct: 196 TGVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGELEGAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  V
Sbjct: 253 AKANMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRSRHPNDYLAAMQSNPHEAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E++ +++E    EF+M  LRL +G+     +   G             +++G +E    +
Sbjct: 313 ERKTVAAEDLPFEFMMNALRLTDGVPASTLQERTGVPTAKIMAQIETARQKGLLE-SDPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
               T++G   L+ ++    
Sbjct: 372 VFCPTEQGRLFLNDLLQCFL 391


>gi|307294008|ref|ZP_07573852.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           chlorophenolicum L-1]
 gi|306880159|gb|EFN11376.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           chlorophenolicum L-1]
          Length = 396

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 177/383 (46%), Positives = 244/383 (63%), Gaps = 10/383 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           ++ L +YVHWPFCV KCPYCDFNSHV R  +  + +  + L ++     L G R +SSIF
Sbjct: 18  ADPLALYVHWPFCVSKCPYCDFNSHV-RADIDADAWRDALLKDLAHEAGLNGGRPLSSIF 76

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+ +  ++D  A++W  + ++EIT+EANPSSVE   F     AGVNR+SL
Sbjct: 77  FGGGTPSLMPPRIVEALIDAAARHWRPTPDIEITLEANPSSVEAARFADLAAAGVNRVSL 136

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+LE+++L FLGR H+  E +AA+ +A+++F R++FDLIYA P Q+   WE EL R L
Sbjct: 137 GLQALEDEALHFLGRAHDVREGLAALDVAQSVFGRVNFDLIYARPGQSEADWEAELARGL 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+  DHLSLYQLTIE GT F  +   G L+    + A  LY  TQ++T+A G+ AYEISN
Sbjct: 197 SFGTDHLSLYQLTIEPGTRFATLAAQGKLIPADPDHAATLYERTQAMTAAAGIPAYEISN 256

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           H+  G ES HNL YWRYGDY+G+GPGAH         +A    K PE+W+  V +NGH +
Sbjct: 257 HARPGQESRHNLTYWRYGDYLGVGPGAH----GRRGGLATMRHKKPENWMNAVARNGHGL 312

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI----ECERNLQRQGFIERV 371
             +E LS E +A E L+MGLRL EG+ +     L+G  +D     +    L   G + R 
Sbjct: 313 QSEEPLSPEDRAREALLMGLRLGEGVDLDRIARLSGLAVDALVDGKAVARLAGHGLV-RQ 371

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
           Q  RL     GM +LD+++  + 
Sbjct: 372 QDQRLYVESAGMLLLDAILPEIV 394


>gi|170719551|ref|YP_001747239.1| coproporphyrinogen III oxidase [Pseudomonas putida W619]
 gi|169757554|gb|ACA70870.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           putida W619]
          Length = 395

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 206/382 (53%), Gaps = 12/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + +E ++ + LT++         R ISSIFF
Sbjct: 21  PPLALYIHIPWCVRKCPYCDFNSHAAGPDLPEEAYVDALLTDLDQELPAVQGRPISSIFF 80

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +      ++EIT+EANP + E   F+ YR+ G+NR+S+G
Sbjct: 81  GGGTPSLFSANALGRLLRGVEQRIPFEPDIEITLEANPGTFEQEKFKAYRQTGINRLSIG 140

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 141 VQSFQPAKLQALGRIHNGDEAIRAAGMARAAGFDNFNMDLMHGLPDQSLNDALGDLRQAI 200

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLT+E  T+F+    +    LP +++  D+    Q++ +AHG   YE+S 
Sbjct: 201 DLGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAAHGYKQYEVSA 256

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++  G  + HNLNYW +GD+IGIG GAH +      R+      + P+ +L +       
Sbjct: 257 YAQPGRAAKHNLNYWCFGDFIGIGAGAHGKQTFADGRILRTWKTRLPKDYLNLA---KPF 313

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQ 372
              ++ L  ++   EFLM  LRL +G+  + +    G  L    E  R  +++G + +V+
Sbjct: 314 KAGEKLLPVDELPFEFLMNALRLTDGVEAELFSQRTGLPLVQLAEARRAAEQKGLL-QVE 372

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RL  T RG   L+ ++    
Sbjct: 373 PDRLVATPRGQLFLNDLLQYFL 394


>gi|261380182|ref|ZP_05984755.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria subflava NJ9703]
 gi|284797029|gb|EFC52376.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria subflava NJ9703]
          Length = 391

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 207/380 (54%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +E +I + LT++Q        R I +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEEAYIDALLTDLQLELPNIWGRPIETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  
Sbjct: 196 TGVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  V
Sbjct: 253 AKPGMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLAAMQGNPHEAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E + ++SE    EF+M  LRL +G+     +   G             +++G +E    +
Sbjct: 313 EHKTVASEDLPFEFMMNALRLTDGVPAAMLQERTGVPTAKIMAQIETARQKGLLE-SDPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T++G   L+ ++    
Sbjct: 372 VFRPTEQGRLFLNDLLQCFL 391


>gi|319407922|emb|CBI81576.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           schoenbuchensis R1]
          Length = 399

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 208/397 (52%), Positives = 266/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFCV KCPYCDFNSHVR+  V Q+ F+ +F  EM    +  GPR I+SIF
Sbjct: 2   AEPFGIYIHWPFCVAKCPYCDFNSHVRKNGVDQQRFVAAFKREMTTQYRTIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AKNWT+    EIT+EANPSSVE   F+GYR AG+NR+SL
Sbjct: 62  IGGGTPSLMTPQTVDALLQTVAKNWTIDDKTEITLEANPSSVEAERFRGYRAAGINRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++LR LGR H+  +A+ AI LAR IF R+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GVQALNDKALRQLGRLHDVKQALHAITLAREIFTRLSFDLIYARPEQTLKQWKYELSQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT+F K++  G L+LP   +A DLYNLTQ IT+ HGL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTVFKKLYAAGKLILPVSQLAADLYNLTQEITTMHGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISI 297
           H+  GAES HNL YWRY +Y G GPGAH R                        R     
Sbjct: 242 HAMPGAESRHNLLYWRYNEYAGFGPGAHGRFIQRPMKNFSTFSKIPLSKTEKLERYVTMN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE WL++V   GH  +E E L+ +QQA+E L+MGLRL EG+ +  +E L+ ++L   
Sbjct: 302 EKHPERWLELVETTGHGCIETEQLTRKQQANEMLLMGLRLSEGLDLTRYETLSLKSLSPV 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              NLQ+QG IE V   RL+ T +G  +LD +I  LA
Sbjct: 362 KLANLQQQGLIEMVDNQRLKATTKGFIVLDYIINQLA 398


>gi|104779591|ref|YP_606089.1| coproporphyrinogen III oxidase [Pseudomonas entomophila L48]
 gi|95108578|emb|CAK13272.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas entomophila L48]
          Length = 386

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 128/381 (33%), Positives = 204/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ +I + L ++         R IS+IFF
Sbjct: 12  PPLSLYIHIPWCVRKCPYCDFNSHQAGPSLPEDEYIDALLADLDQEMPAVQGRPISTIFF 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    + ++EIT+EANP + E   F+ YR+ G+NR+S+G
Sbjct: 72  GGGTPSLFSADALDRLLRGVEQRIPFAPDIEITLEANPGTFEQEKFKAYRQTGINRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 132 VQSFQPAKLERLGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAI 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 192 ELAPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++     + HNLNYWR+GD+IGIG GAH ++     R+              +  +    
Sbjct: 248 YAQADRAARHNLNYWRFGDFIGIGAGAHGKLSFPDGRILR--TWKTRLPKDYLNPSKPYK 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
             ++ L +++   EFLM  LRL +G+  + + +  G  L    E  R  +++G + RV+ 
Sbjct: 306 AGEKLLPADELPFEFLMNALRLTDGVEAELFSLRTGLPLAQLTEARREAEQKGLL-RVEP 364

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RL  T RG   L+ ++    
Sbjct: 365 DRLAATPRGQLFLNDLLQYFL 385


>gi|261401086|ref|ZP_05987211.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria lactamica ATCC 23970]
 gi|269208978|gb|EEZ75433.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria lactamica ATCC 23970]
          Length = 391

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 127/391 (32%), Positives = 205/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + ++FFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETVFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEN 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +       HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPAMRCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEQGRLFLNDLLQCFL 391


>gi|296315022|ref|ZP_06864963.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria polysaccharea ATCC 43768]
 gi|296838225|gb|EFH22163.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria polysaccharea ATCC 43768]
          Length = 391

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 129/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T+RG   L+ ++    
Sbjct: 362 QKGLLE-TNPAVFRPTERGRLFLNDLLQCFL 391


>gi|294671109|ref|ZP_06735964.1| hypothetical protein NEIELOOT_02817 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307217|gb|EFE48460.1| hypothetical protein NEIELOOT_02817 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 391

 Score =  268 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 127/380 (33%), Positives = 203/380 (53%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIT 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE S  
Sbjct: 196 TGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      V
Sbjct: 253 AKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSVAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E++ +++E    EF+M  LRL +G+     +   G             +++G +E    +
Sbjct: 313 ERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGIPAAKIMAQIETARQKGLLE-TNPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T++G   L+ ++    
Sbjct: 372 VFRPTEQGRLFLNDLLQCFL 391


>gi|330815845|ref|YP_004359550.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia gladioli BSR3]
 gi|327368238|gb|AEA59594.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia gladioli BSR3]
          Length = 409

 Score =  268 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 132/382 (34%), Positives = 211/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +E ++ +   +++        R + +IF
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPEEAYLDALRADLEQALPFVWGRQVHTIF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSI 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A + F   + DL++ALPKQT+ Q + +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDTAQARAAVEIAASTFDNFNLDLMFALPKQTLAQCQADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYA  HLSLY LT+E  TLF K        +P ++ + D+    Q  T+  G   YE+S 
Sbjct: 207 SYAPPHLSLYHLTLEPNTLFAKFPPA----VPDDDASADMQEWIQERTAQAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YARPNRQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATYMEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E +       EF++  LRL EG  V  +    G  L          +R+G I R  +
Sbjct: 323 EERE-VGPRDLPFEFMLNTLRLAEGFPVASYAERTGLPLSTIEPALAEAERRGLIAR-DY 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            R+  T  G   L+  +  L +
Sbjct: 381 ERIAPTPLGQRFLND-LQELFL 401


>gi|159046000|ref|YP_001534794.1| coproporphyrinogen III oxidase [Dinoroseobacter shibae DFL 12]
 gi|157913760|gb|ABV95193.1| oxygen-independent coproporphyrinogen III oxidase [Dinoroseobacter
           shibae DFL 12]
          Length = 387

 Score =  268 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 176/378 (46%), Positives = 241/378 (63%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHVR   V Q  +  +FL+E+      T  R + ++FFG
Sbjct: 8   GFGLYLHWPFCAAKCPYCDFNSHVRAR-VDQAAWENAFLSEIGRAGIETEGRRLDTVFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP  +A I+D I + W  S+++EIT+EANP+SVE   F+ YR AGVNR+S+G+
Sbjct: 67  GGTPSLMEPDLVASIIDRIRRTWPTSNSLEITLEANPTSVEAGRFRAYRDAGVNRVSMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  L+ LGR H+  EA +A  +A+  F R+SFDLIYA   QT+  W  EL+ ALS 
Sbjct: 127 QALNDADLKALGRLHSVKEAQSAFEVAQAHFERVSFDLIYARQGQTLEAWIAELRAALSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A+DHLSLYQLT+E GT F      G L   P  ++  D++  TQ + S  G+ AYE+SNH
Sbjct: 187 AIDHLSLYQLTVEPGTAFGDRAARGMLRGLPDGDLGADMFEATQDLCSDAGMPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRYGDY+GIGPGAH R+ +   + A S   HPE+WL  V+ +GH   
Sbjct: 247 AAEGCESRHNLIYWRYGDYVGIGPGAHGRLTLSGQKWATSTPLHPEAWLAQVQDSGHGET 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            ++ L+  + ++E L+MGLRL EG+S+     +AG  L       LQ    I RV   RL
Sbjct: 307 PRQLLTPNEISEELLLMGLRLSEGVSLNRITAIAGAPLPERKLSELQEAQLI-RVDGDRL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L++++  L 
Sbjct: 366 RTTLQGRMVLNAILRELL 383


>gi|288956858|ref|YP_003447199.1| oxygen-independent coproporphyrinogen III oxidase [Azospirillum sp.
           B510]
 gi|288909166|dbj|BAI70655.1| oxygen-independent coproporphyrinogen III oxidase [Azospirillum sp.
           B510]
          Length = 394

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 193/393 (49%), Positives = 255/393 (64%), Gaps = 6/393 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
               ++ GQ      VYVHWPFC  KCPYCDFNSHV R +V  + +    L E+     L
Sbjct: 3   PVSGSVPGQDGPGFAVYVHWPFCKSKCPYCDFNSHV-RERVDHDRWRAGLLRELDHYADL 61

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
           T  R+++SIFFGGGTPSL+EP  +  I+D +A+ W V+  +E+T+EANP+SVE + F+ +
Sbjct: 62  TAGRTVTSIFFGGGTPSLMEPATVGAIIDRVAQRWPVAERLEVTLEANPTSVEADKFRAF 121

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           R AG+NR+SLG+Q+L++ SL+FLGR H+A+EA  AI LA  IF R SFDLIYA P QT+ 
Sbjct: 122 RGAGINRVSLGIQALDDTSLKFLGRQHSAAEATGAITLAARIFDRFSFDLIYARPGQTVA 181

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
            W+ EL RAL +AV HLS+YQLTIE+GT F+ +H  GDLVLP E++A DLY  TQS  +A
Sbjct: 182 AWQAELARALDHAVGHLSVYQLTIEEGTAFHPLHARGDLVLPDEDLAGDLYEATQSQLAA 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            GL AYEISNH+ LG ES HNL YWRYGDY+GIGPGAH R+ +   + A    + PE WL
Sbjct: 242 AGLPAYEISNHARLGEESRHNLTYWRYGDYVGIGPGAHGRLTLDGEKFATRAHRAPEIWL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI----ECERN 361
           + V ++GHA    + +  + +  E LMMGLRL EG+ +       GR LD          
Sbjct: 302 ERVERDGHAAAPPDPIDRDARGTELLMMGLRLTEGVRLSRLVEETGRTLDEFVDPAALSR 361

Query: 362 LQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           L   GF+ R    RL  T  G+  L++V+  + 
Sbjct: 362 LIDGGFLSR-DAKRLVATSEGLQRLNAVLGAIL 393


>gi|83953081|ref|ZP_00961803.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
 gi|83842049|gb|EAP81217.1| coproporphyrinogen III oxidase [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 168/378 (44%), Positives = 241/378 (63%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV R  + Q  +  ++L E++     T  R ++++FFG
Sbjct: 9   GFGLYIHWPFCEAKCPYCDFNSHVSRT-IDQRAWRDAYLAELERGAAETQGRVLNAVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A ++  I + W  ++++EIT+EANP SVE + F  +R+AGVNRIS+G+
Sbjct: 68  GGTPSLMDPDVVADVIAAIRRLWPTANDLEITLEANPGSVEADRFAAFRQAGVNRISMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L    L+ LGR H   E +AA  +ARN F R+SFDLIY    Q++  W+ EL++ALS 
Sbjct: 128 QALNVADLKRLGRIHTVDEGLAAFDIARNTFERVSFDLIYGRQNQSLPDWKAELKQALSL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A+DH+SLYQLTIE+GT F   +  G L     +    D+Y  TQ I    G+ +YE+SNH
Sbjct: 188 AIDHMSLYQLTIEQGTAFGDRYAVGKLRGLPSDDLGADMYAATQDICGEMGMPSYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GA+S HNL YWRYGDY+GIGPGAH R+    +R A     +P+ WL     +G    
Sbjct: 248 ARDGAQSRHNLIYWRYGDYLGIGPGAHGRLTQNGNRFATECFSNPKRWLDA-AASGATEK 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +E L++E Q  EFLMMGLRL+EG+ ++ +E L+G  L  +    +Q  G I R    +L
Sbjct: 307 PRELLTTEDQGSEFLMMGLRLKEGVDLRRYEALSGAPLSTKKITQMQDIGMISR-DKDQL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T +G  +L++++A L 
Sbjct: 366 YVTDQGFMVLNAILAELL 383


>gi|325203752|gb|ADY99205.1| oxygen-independent coproporphyrinogen III oxidase-like protein yggW
           [Neisseria meningitidis M01-240355]
          Length = 391

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 129/391 (32%), Positives = 205/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEN 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +       HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPAMRCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T+RG   L+ ++    
Sbjct: 362 QKGLLE-TNPAVFRPTERGRLFLNDLLQCFL 391


>gi|325143947|gb|EGC66257.1| hypothetical protein NMBM01240013_1555 [Neisseria meningitidis
           M01-240013]
 gi|325206490|gb|ADZ01943.1| hypothetical protein NMBM04240196_1502 [Neisseria meningitidis
           M04-240196]
          Length = 399

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 207/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + ++FFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETVFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKINIDLMYALPNQTVR 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +   S    
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHSALEN 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 GGFIHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|148553493|ref|YP_001261075.1| coproporphyrinogen III oxidase [Sphingomonas wittichii RW1]
 gi|148498683|gb|ABQ66937.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingomonas wittichii RW1]
          Length = 397

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 173/381 (45%), Positives = 233/381 (61%), Gaps = 10/381 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+HWPFCV KCPYCDFNSHV R  V Q+ +  + L ++         R + SIFFG
Sbjct: 21  GLALYIHWPFCVSKCPYCDFNSHV-RESVDQQAWRDALLRDLAHEAAALPGRRLGSIFFG 79

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A ++D   ++W  + ++EIT+EANPSSVE   F    +AG+NR+SLG+
Sbjct: 80  GGTPSLMPPATVAALIDAATRHWPAADDIEITLEANPSSVEAARFADLARAGINRVSLGL 139

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++  L +LGR H  +E +AA+  A+  F R+SFDLIYA P QT   W  EL RALS+
Sbjct: 140 QALDDAVLGWLGRAHGVTEGLAALDTAQTSFGRVSFDLIYARPGQTPEAWAAELGRALSF 199

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +HLSLYQLTIE GT F      G+ V    +   +L+  T++ T+A GL AYEISNH+
Sbjct: 200 GTEHLSLYQLTIEPGTQFATRVAKGEFVPLDPDAGAELFEQTRAATAAAGLPAYEISNHA 259

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             GAES HNL YWRYG+Y GIGPGAH          A    K PE+WL  V  NGH +  
Sbjct: 260 RPGAESRHNLTYWRYGNYAGIGPGAH----GRRDGRATVRRKKPENWLARVEANGHGIER 315

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQF 373
           ++ L SE +A E L+MGLRL EG+ +     ++G      +D      L RQG + R   
Sbjct: 316 EDDLPSEARAQEALLMGLRLAEGVDLARIAAMSGLPVGRLVDAIAIDRLARQGLLAR-DG 374

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RL  +  GM +LD+++A + 
Sbjct: 375 DRLTVSDAGMLLLDAILAEIV 395


>gi|325275641|ref|ZP_08141540.1| HemN family oxidoreductase [Pseudomonas sp. TJI-51]
 gi|324099228|gb|EGB97175.1| HemN family oxidoreductase [Pseudomonas sp. TJI-51]
          Length = 391

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 212/382 (55%), Gaps = 12/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + LT++         R ISSIFF
Sbjct: 17  PPLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVAALLTDLDQELAAVQGRPISSIFF 76

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    ++++EIT+EANP + E + F+ YR+ G+NR+S+G
Sbjct: 77  GGGTPSLFSAGALGRLLRGVEQRIPFAADIEITLEANPGTFEQDKFKAYRQTGINRLSIG 136

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 137 VQSFQPAKLQALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLEDALGDLRQAM 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 197 DLGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGFRQYEVSA 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++  G  + HNLNYWR+GD+IGIG GAH ++     R+      + P+ +L +       
Sbjct: 253 YAQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLA---KPY 309

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
              ++ L  ++   EFLM  LRL +G+  + +    G  L+   E  R  +++G + +V+
Sbjct: 310 KAGEKLLPVDELPFEFLMNALRLTDGVEAQLFTQRTGLPLEQLREARRAAEQKGLL-QVE 368

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RL  T RG   L+ ++    
Sbjct: 369 SDRLVATPRGQLFLNDLLQYFL 390


>gi|70733131|ref|YP_262904.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens Pf-5]
 gi|68347430|gb|AAY95036.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas fluorescens Pf-5]
          Length = 400

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 134/382 (35%), Positives = 208/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++         R +SSIFF
Sbjct: 26  PPLALYIHIPWCVRKCPYCDFNSHAASPTLPEEEYVDALLADLDQDLHAVHGRELSSIFF 85

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   Q +  +L G+ +    + ++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 86  GGGTPSLFSAQALGRLLKGVEQRIRFAPDIEITLEANPGTFEQEKFTAYRALGINRLSIG 145

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +EQ L+ LGR HN  EAI A  +AR   F   + DL++ LP Q++     +L++A+
Sbjct: 146 IQSFQEQKLKALGRIHNGDEAIRAAGMARQAGFDNFNLDLMHGLPDQSLDDALGDLRQAI 205

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLT+E  T+F+        VLP ++   D+    Q++ + HG   YE+S 
Sbjct: 206 AMKPTHLSWYQLTLEPNTVFWNQPP----VLPEDDTLWDIQEAGQALLAEHGYAQYEVSA 261

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +       
Sbjct: 262 YAQPGRAARHNLNYWSFGDFIGIGAGAHGKLSHPDGRILR--TWKTRLPKDYLNPAKQFK 319

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             ++ L +E+   EFLM  LRL +G+    +    G +L    E  R  ++ G + +V+ 
Sbjct: 320 AGEKALGNEELPFEFLMNALRLTDGVDAALFAQRTGLDLVSLAEGRRQAEQSGLL-QVEP 378

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           SRL  T RG   L+ ++    +
Sbjct: 379 SRLAATARGQLFLNDLLQYFLI 400


>gi|313501077|gb|ADR62443.1| Coproporphyrinogen III oxidase [Pseudomonas putida BIRD-1]
          Length = 388

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 208/382 (54%), Gaps = 12/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFF
Sbjct: 14  PPLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFF 73

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    + ++EIT+EANP + E + F+ YR+ G+NR+S+G
Sbjct: 74  GGGTPSLFSASALGRLLRGVEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIG 133

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 134 VQSFQPAKLEALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAI 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 194 DLGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSA 249

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++  G  + HNLNYWR+GD+IGIG GAH ++     R+      + P+ +L +       
Sbjct: 250 YAQAGRAAQHNLNYWRFGDFIGIGAGAHGKLTFADGRILRTWKTRLPKDYLNLA---KPF 306

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
              ++ L  ++   EFLM  LRL +G+  + +    G  L    E  R  +++G + +V+
Sbjct: 307 RAGEKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLSQLQEARRAAEQKGLL-QVE 365

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RL  T RG   L+ ++    
Sbjct: 366 PDRLVATPRGQLFLNDLLQYFL 387


>gi|304388086|ref|ZP_07370215.1| possible coproporphyrinogen dehydrogenase [Neisseria meningitidis
           ATCC 13091]
 gi|304337943|gb|EFM04083.1| possible coproporphyrinogen dehydrogenase [Neisseria meningitidis
           ATCC 13091]
          Length = 391

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 128/391 (32%), Positives = 205/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + ++FFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETVFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEN 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +       HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPAMRCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T+RG   L+ ++    
Sbjct: 362 QKGLLE-TNPAVFRPTERGRLFLNDLLQCFL 391


>gi|83942032|ref|ZP_00954494.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
 gi|83847852|gb|EAP85727.1| coproporphyrinogen III oxidase [Sulfitobacter sp. EE-36]
          Length = 385

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 168/378 (44%), Positives = 239/378 (63%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV R  + Q  +  ++L E++     T  R ++++FFG
Sbjct: 9   GFGLYIHWPFCEAKCPYCDFNSHVSRT-IDQRAWRDAYLAELERGAAETQGRVLNAVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A ++  I + W  ++++EIT+EANP SVE   F  +R+AGVNRIS+G+
Sbjct: 68  GGTPSLMDPDVVADVIAAIRRLWPTANDLEITLEANPGSVEAVRFAAFRQAGVNRISMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  L+ LGR H   E +AA  +ARN F R+SFDLIY    Q +  W  EL++ALS 
Sbjct: 128 QALNDADLKRLGRIHTVDEGLAAFDIARNTFERVSFDLIYGRQNQGLADWRTELKQALSL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A+DH+SLYQLTIE+GT F   +  G L     +    D+Y  TQ I    G+ +YE+SNH
Sbjct: 188 AIDHMSLYQLTIEQGTAFGDRYAVGKLRGLPSDDLGADMYAATQDICGEMGMPSYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GA+S HNL YWRYGDY+GIGPGAH R+    +R A     +P+ WL     +G    
Sbjct: 248 ARDGAQSRHNLIYWRYGDYLGIGPGAHGRLTQNGNRFATECFSNPKRWLDA-VASGATEK 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +E L++E Q  EFLMMGLRL+EG+ ++ +E L+G  L  +    +Q  G I R    +L
Sbjct: 307 PRELLTTEDQGSEFLMMGLRLKEGVDLRRYEALSGAPLSTKKITQMQDIGMISR-DKDQL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T +G  +L++++A L 
Sbjct: 366 YVTDQGFMVLNAILAELL 383


>gi|325265917|ref|ZP_08132603.1| putative coproporphyrinogen dehydrogenase [Kingella denitrificans
           ATCC 33394]
 gi|324982555|gb|EGC18181.1| putative coproporphyrinogen dehydrogenase [Kingella denitrificans
           ATCC 33394]
          Length = 405

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 137/382 (35%), Positives = 212/382 (55%), Gaps = 8/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+C++KCPYCDFNSH  +  + ++ ++Q+ LT++Q        R I +IF 
Sbjct: 10  PPLSLYVHIPWCLQKCPYCDFNSHTIKTTLDEDAYVQALLTDLQHELPHFWGRGIETIFI 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPS+     I  +L GI     ++   EIT+EANP + + + FQG+R AG+NR+S+G
Sbjct: 70  GGGTPSVFSVSAIDRLLSGIRALVKLNPEAEITLEANPGTFDHDKFQGFRSAGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS +++ L  LGR H+A EA  AI  A  IF R++ DL+YALP+Q       ++Q ALS
Sbjct: 130 VQSFDDRKLAALGRIHSADEARTAIEKACRIFERVNIDLMYALPQQNAADALADVQAALS 189

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           + V H+S YQLT+E  T F      G   LP ++ A D+ +   S     G   YE S  
Sbjct: 190 FGVQHISAYQLTLEPNTPFGHTPPKG---LPEDDTAQDIEDTVHSALQHAGFERYETSAF 246

Query: 257 SFLGA-ESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           +      + HNLNYW++GDYIGIG GAH ++           ++HPE++L  ++ N  A 
Sbjct: 247 ARTPESRARHNLNYWQFGDYIGIGAGAHGKISHHDRIERTVRKRHPEAYLAAMQGNVQAA 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
           ++ + ++      EF+M  LRL  G+    +    G +L          +++G ++    
Sbjct: 307 IDHKTVAPNDLPFEFMMNALRLTGGVPAALFAERTGISLAQIEPVLAKARQKGLLDH-AP 365

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           + LR T+ G   L+ ++  L +
Sbjct: 366 NVLRPTELGRRFLNDLL-ELFL 386


>gi|167036140|ref|YP_001671371.1| coproporphyrinogen III oxidase [Pseudomonas putida GB-1]
 gi|166862628|gb|ABZ01036.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           putida GB-1]
          Length = 391

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 127/381 (33%), Positives = 204/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFF
Sbjct: 17  PPLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFF 76

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    + ++EIT+EANP + E + F+ YR+ G+NR+S+G
Sbjct: 77  GGGTPSLFSANALGRLLRGVEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIG 136

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 137 VQSFQPAKLEALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAI 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 197 DLGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMTEHGYRQYEVSA 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYWR+GD+IGIG GAH ++     R+              +       
Sbjct: 253 YAQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILR--TWKTRLPKDYLNLAKPFK 310

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
             ++ L  ++   EFLM  LRL +G+  + +    G  L+   E  R  +++G + +V+ 
Sbjct: 311 AGEKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLEQLREARRAAEQKGLL-QVEP 369

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RL  T RG   L+ ++    
Sbjct: 370 DRLVATPRGQLFLNDLLQYFL 390


>gi|269838405|ref|YP_003320633.1| oxygen-independent coproporphyrinogen III oxidase [Sphaerobacter
           thermophilus DSM 20745]
 gi|269787668|gb|ACZ39811.1| oxygen-independent coproporphyrinogen III oxidase [Sphaerobacter
           thermophilus DSM 20745]
          Length = 393

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 136/386 (35%), Positives = 204/386 (52%), Gaps = 12/386 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
               LGVY+H PFC + CPYCDFN++ R+  +    ++++ + EM       GPR   SI
Sbjct: 7   ADAPLGVYIHIPFCTRICPYCDFNTYARQEHL-IPEYVEALIGEMDLTLAAIGPRPAQSI 65

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL+ P+ +A ++D + + + +  + E+++EANP +++     G+ +AGVNRIS
Sbjct: 66  FFGGGTPSLLPPELVARLIDAVRERFPLPDDAEVSLEANPETIDAATLDGFLQAGVNRIS 125

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQR 193
           LGVQ+ + + L+ LGR H       A+  AR       S D I+  P QTM +WE +L  
Sbjct: 126 LGVQTQQARGLKVLGRAHKPDVPERALAAARAAGVDNFSVDFIFGWPNQTMAEWEDDLDS 185

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            L +  DHLSLY L +E GT + +  + G L +P E+   D+Y       +A G H YEI
Sbjct: 186 ILRWQPDHLSLYSLIVEPGTPYERAVQRGILTVPDEDTTADMYERALDRLAAAGWHHYEI 245

Query: 254 SNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           SN +      S HNL YWR G Y+G+G GAH+ +              P  ++  VR+  
Sbjct: 246 SNWARTPEHRSRHNLLYWRNGHYLGLGAGAHAHLDNVRSSNIR----LPAKYIAAVREGR 301

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRL-REGISVKDWEMLAGRNLDIECERN---LQRQGFI 368
             + E+E L       E +M+GLRL  EG+S   +    GR L+    R    L   G +
Sbjct: 302 LPIDEREELDETTAMAETMMLGLRLPEEGVSAAAFAARHGRELEEIYGRELTDLTDAGLL 361

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
                + +R T+RG+ + + V A   
Sbjct: 362 -YWDGAHVRLTRRGLLLANEVAARFL 386


>gi|225075212|ref|ZP_03718411.1| hypothetical protein NEIFLAOT_00212 [Neisseria flavescens
           NRL30031/H210]
 gi|224953387|gb|EEG34596.1| hypothetical protein NEIFLAOT_00212 [Neisseria flavescens
           NRL30031/H210]
          Length = 391

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 129/380 (33%), Positives = 205/380 (53%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +E +I +  T++Q        R + +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEEAYIDALFTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLARLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQTALNDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V H+S Y LT+E  T F      G   LP +  A+D+ +             YE S  
Sbjct: 196 TGVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGADFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  V
Sbjct: 253 AKPGMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLAAMQSNPHEAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E++ ++++    EF+M  LRL +G+     +   G             +++G +E    +
Sbjct: 313 ERKTVAAKDLPFEFMMNALRLTDGVPAAMLQERTGVPTAKIMAQIETARQKGLLE-SDPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T++G   L+ ++    
Sbjct: 372 VFRPTEQGRLFLNDLLQCFL 391


>gi|229593141|ref|YP_002875260.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens SBW25]
 gi|229365007|emb|CAY53156.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 379

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 134/381 (35%), Positives = 206/381 (54%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++         R +SSIFF
Sbjct: 5   PPLALYIHIPWCVRKCPYCDFNSHTASKVLPEEEYVDALLADLDQDLHAVYGRELSSIFF 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+      +S++EIT+EANP + E   F  YRK G+NR+S+G
Sbjct: 65  GGGTPSLFSAAALGRLLKGVEARIPFASDIEITLEANPGTFEQEKFVAYRKLGINRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS ++Q L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A+
Sbjct: 125 IQSFQQQKLEALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPDQSLEDALSDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLT+E  T+F+         LP ++   D+    Q++ + HG   YE+S 
Sbjct: 185 ALKPTHLSWYQLTLEPNTVFWNQPPA----LPEDDTLWDIQEAGQALLAEHGYAQYEVSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+         +    +       
Sbjct: 241 YAQPGRPARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVR--TWKTRAPKDYLNPAKSFQ 298

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L++E+   EFLM  LRL EG+  K +    G  L    E  R  ++ G + +V+ 
Sbjct: 299 AGAKELTNEELPFEFLMNALRLTEGVEAKLYAERTGLALSSLDEGRREAEQSGLM-QVEP 357

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
           SRL  T RG   L+ ++    
Sbjct: 358 SRLAATDRGQLFLNDLLQKFL 378


>gi|319898242|ref|YP_004158335.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           clarridgeiae 73]
 gi|319402206|emb|CBI75737.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           clarridgeiae 73]
          Length = 399

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 208/397 (52%), Positives = 266/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFCV KCPYCDFNS+VR   V Q  F  +F  EM       GPR I+SIF
Sbjct: 2   TKPFGIYIHWPFCVSKCPYCDFNSYVRINGVDQPRFAAAFEREMTTQAHEIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  IAKNWT+    EIT+EANPSSVE + F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMTPQTVDRLLQAIAKNWTIDDKTEITLEANPSSVEADRFRGYRLAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++L+ LGR HN  +A+ AI+LAR IFPR+SFDLIYA PKQT+ QWE EL +A+
Sbjct: 122 GVQALNDKALQQLGRLHNVKQALYAINLAREIFPRLSFDLIYARPKQTLKQWESELLQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A DHLSLYQLTIE GT F K+H  G L+LP+   A +LY LTQ IT+ +GL AYEISN
Sbjct: 182 NLAADHLSLYQLTIEDGTNFKKLHAAGKLILPTSERAANLYTLTQEITTMYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISI 297
           H+  GAES HNL YWRY +Y G GPGAH R                       +R     
Sbjct: 242 HAIPGAESCHNLLYWRYHEYAGFGPGAHGRFIKQQLKNSSFLSETLLSKTENHNRYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EK+PE+WLK+V   GH  ++ E L+ EQQA+E L+MGLRL EG+++K +E L+G++L  +
Sbjct: 302 EKYPENWLKLVETIGHGCIDTEQLTQEQQANEMLLMGLRLSEGLNLKRYETLSGQSLSPK 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ++G IE      L+ T  G  +LD +I  LA
Sbjct: 362 KLISLQQKGLIEMTSNQHLKATATGRILLDHIICQLA 398


>gi|313668861|ref|YP_004049145.1| porphyrin oxidoreductase [Neisseria lactamica ST-640]
 gi|313006323|emb|CBN87786.1| putative porphyrin oxidoreductase [Neisseria lactamica 020-06]
          Length = 391

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 129/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVR 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEN 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAQNNKQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 302 ALMQNRPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T+RG   L+ ++    
Sbjct: 362 QKGLLE-TNPAVFRPTERGRLFLNDLLQCFL 391


>gi|261377934|ref|ZP_05982507.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria cinerea ATCC 14685]
 gi|269145794|gb|EEZ72212.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Neisseria cinerea ATCC 14685]
          Length = 391

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 127/391 (32%), Positives = 204/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N         L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 5   SFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 64

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 65  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 124

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           ++AG+ R+S+G QS     L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 125 KEAGITRLSIGAQSFNNDMLARLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQ 184

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +        
Sbjct: 185 TALDDVQTAIATGATHVSAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEG 241

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 242 AGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 301

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+         G             +
Sbjct: 302 ALMQSQPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLHERTGVPAAKIMAQIETAR 361

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 362 QKGLLE-TDPTVFRPTEQGQLFLNDLLQCFL 391


>gi|94309795|ref|YP_583005.1| coproporphyrinogen III oxidase [Cupriavidus metallidurans CH34]
 gi|93353647|gb|ABF07736.1| Oxygen-independent coproporphyrinogen III oxidase-like protein
           [Cupriavidus metallidurans CH34]
          Length = 419

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 129/400 (32%), Positives = 218/400 (54%), Gaps = 16/400 (4%)

Query: 3   YLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSH-----VRRYKVGQENFIQSFLT 57
           +L   +  + G  S  L +YVH P+CV+KCPYCDFNSH        +++ ++ ++ +   
Sbjct: 27  WLKPGQIALPG--SPPLSLYVHIPWCVRKCPYCDFNSHAAPGKPDSHEIPEDAYLDALRA 84

Query: 58  EMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSV 117
           +++    L   R + ++F GGGTPSL+    +  +L  I     + ++ EIT+EANP + 
Sbjct: 85  DLEQSLPLVWGRPVHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEANPGTF 144

Query: 118 EVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIY 177
           E   F  YR +G+NR+S+G+QS  +  L+ LGR H   EA AAI +A   F  ++ DL+Y
Sbjct: 145 EAERFASYRASGINRLSIGIQSFNDAHLKALGRIHGEREARAAIDIALKHFDNVNLDLMY 204

Query: 178 ALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYN 237
           ALP QT+ +   +L  ALSY   HLSLY LT+E  TLF K        LP E+ A ++ +
Sbjct: 205 ALPGQTLDECARDLDAALSYGTTHLSLYHLTLEPNTLFAKFPPA----LPDEDTAYEMQD 260

Query: 238 LTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISI 297
           + ++ T+  G   YE S ++    E+ HNLNYWR+GDY+GIG GAH ++   +  +    
Sbjct: 261 IVEARTAQAGYRHYETSAYAKPHREARHNLNYWRFGDYLGIGAGAHGKLSFPNRILRQMR 320

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI- 356
            KHP ++++           +E + +++   EF++  LRL +G+    +    G  L + 
Sbjct: 321 HKHPATYMEQALAGNAVQEARE-VGADELPFEFMLNALRLTDGVPASSFHDYTGLPLHMI 379

Query: 357 -ECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            +     +++G ++    + ++ T+ G   L+  +  + +
Sbjct: 380 GKQLAAAEKKGLLD-ADPTVIKPTELGRRFLND-LQEMFL 417


>gi|298368352|ref|ZP_06979670.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria sp.
           oral taxon 014 str. F0314]
 gi|298282355|gb|EFI23842.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria sp.
           oral taxon 014 str. F0314]
          Length = 391

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 126/380 (33%), Positives = 202/380 (53%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +IFF
Sbjct: 16  PPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDGMLARLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y LT+E  T F          LP +  A+D+ +         G   YE S  
Sbjct: 196 TGATHISAYHLTMEPNTPFGHTPPK---CLPQDEAALDIEDAVHGALEGAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++      V
Sbjct: 253 AKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPSEAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E++ +++E    EF+M  LRL +G+     +   G             +++G + +   +
Sbjct: 313 ERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLL-KTNPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T+RG   L+ ++    
Sbjct: 372 VFRPTERGRLFLNDLLQCFL 391


>gi|26991777|ref|NP_747202.1| coproporphyrinogen III oxidase [Pseudomonas putida KT2440]
 gi|24986887|gb|AAN70666.1|AE016710_11 oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas putida KT2440]
          Length = 391

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 127/381 (33%), Positives = 203/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH    ++ ++ ++ + L ++         R ISSIFF
Sbjct: 17  PPLALYIHIPWCVRKCPYCDFNSHAAGPELPEDAYVTALLDDLDQELAAVQGRPISSIFF 76

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    + ++EIT+EANP + E + F+ YR+ G+NR+S+G
Sbjct: 77  GGGTPSLFSASALGRLLRGVEQRIPFAPDIEITLEANPGTFEQDKFKAYRQTGINRLSIG 136

Query: 137 VQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L  LGR HN  E   AA       F   + DL++ LP Q++     +L++A+
Sbjct: 137 VQSFQPAKLEALGRIHNGDEAVRAAGMARAAGFDNFNMDLMHGLPDQSLDDALGDLRQAI 196

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLT+E  T+F+    +    LP +++  D+    Q++ + HG   YE+S 
Sbjct: 197 DLGPTHLSWYQLTVEPNTVFWNQPPE----LPEDDILWDIQEAGQALMAEHGYRQYEVSA 252

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYWR+GD+IGIG GAH ++     R+              +       
Sbjct: 253 YAQAGRAARHNLNYWRFGDFIGIGAGAHGKLTFADGRILR--TWKTRLPKDYLNLAKPFR 310

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
             ++ L  ++   EFLM  LRL +G+  + +    G  L    E  R  +++G + +V+ 
Sbjct: 311 AGEKLLPVDELPFEFLMNALRLTDGVEAELFTQRTGLPLAQLQEARRAAEQKGLL-QVEP 369

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RL  T RG   L+ ++    
Sbjct: 370 DRLVATPRGQLFLNDLLQYFL 390


>gi|254852100|ref|ZP_05241448.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL R2-503]
 gi|300765619|ref|ZP_07075598.1| oxygen-independent coproporphyrinogen III oxidase [Listeria
           monocytogenes FSL N1-017]
 gi|258605402|gb|EEW18010.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL R2-503]
 gi|300513720|gb|EFK40788.1| oxygen-independent coproporphyrinogen III oxidase [Listeria
           monocytogenes FSL N1-017]
          Length = 385

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 109/379 (28%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +   VNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNILPLKKDIEFSFEANPGDLSLSKLQAMQDHSVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ ++KN     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQKNILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|46907704|ref|YP_014093.1| coproporphyrinogen III oxidase [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47093483|ref|ZP_00231246.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Listeria monocytogenes str. 4b H7858]
 gi|254824465|ref|ZP_05229466.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL J1-194]
 gi|254932661|ref|ZP_05266020.1| coproporphyrinogen III oxidase [Listeria monocytogenes HPB2262]
 gi|254991904|ref|ZP_05274094.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL J2-064]
 gi|46880973|gb|AAT04270.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria monocytogenes serotype 4b str. F2365]
 gi|47018159|gb|EAL08929.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Listeria monocytogenes str. 4b H7858]
 gi|293584220|gb|EFF96252.1| coproporphyrinogen III oxidase [Listeria monocytogenes HPB2262]
 gi|293593702|gb|EFG01463.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL J1-194]
 gi|332311918|gb|EGJ25013.1| Oxygen-independent coproporphyrinogen III oxidase [Listeria
           monocytogenes str. Scott A]
          Length = 385

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 110/379 (29%), Positives = 192/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNILPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ ++KN     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQKNILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|58040027|ref|YP_191991.1| coproporphyrinogen III oxidase [Gluconobacter oxydans 621H]
 gi|58002441|gb|AAW61335.1| HemN [Gluconobacter oxydans 621H]
          Length = 392

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 178/385 (46%), Positives = 235/385 (61%), Gaps = 10/385 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG----PRSISS 73
            L +Y+HWPFC+ KCPYCDFNSHV R  + Q+ F +    E+             R + S
Sbjct: 9   PLSLYIHWPFCLAKCPYCDFNSHV-REVIPQQRFAEVLRRELAHDAARLTRDGVKRPLRS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL+ P+ +A +++   + +    ++EIT+EANP+SVE   F  +R+AGVNR+
Sbjct: 68  IFFGGGTPSLMAPETVAALIEDAHRLFDAEDDLEITLEANPTSVEAGKFAAFRQAGVNRV 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLGVQSL + +LR LGR H+A++AI A+  AR +FPR+SFDLIYA P Q+   W  EL  
Sbjct: 128 SLGVQSLRDDALRKLGREHSATQAIRALETARTLFPRISFDLIYARPGQSDADWTDELTT 187

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL    DHLSLYQLTIE GT F  MH+ G+L LP E+ A  LY+LT  I + HGL  YE+
Sbjct: 188 ALDLVADHLSLYQLTIEPGTKFEAMHRRGELTLPDEDTAARLYDLTGEIAARHGLLPYEV 247

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SN++  GAES HNL YWRY DYIGIGPGAH R+ +     A    + PE W + + K G 
Sbjct: 248 SNYARPGAESRHNLTYWRYADYIGIGPGAHGRLTLDGELYATRRHRAPEPWAERIEKTGS 307

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL----DIECERNLQRQGFIE 369
              E+  LS E++  E L+MGLRL EGI    +    GR L    D         + ++E
Sbjct: 308 GSTEETLLSPEEKGREALLMGLRLSEGIDAARFAARTGRALMDCVDPALLEACIEENYLE 367

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
           R     LR T  G   L++++A L 
Sbjct: 368 R-DNGILRATGEGRLRLEAILARLV 391


>gi|226224077|ref|YP_002758184.1| coproporphyrinogen III oxidase [Listeria monocytogenes Clip81459]
 gi|225876539|emb|CAS05248.1| Putative coproporphyrinogen III oxidase [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
          Length = 385

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 109/379 (28%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +   VNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNILPLKKDIEFSFEANPGDLSLSKLQAMQDHRVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ ++KN     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQKNILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|329120740|ref|ZP_08249402.1| coproporphyrinogen dehydrogenase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327460537|gb|EGF06873.1| coproporphyrinogen dehydrogenase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 391

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 125/383 (32%), Positives = 202/383 (52%), Gaps = 6/383 (1%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
                L +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q        R + +
Sbjct: 13  AALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPNIWGRPVET 72

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+
Sbjct: 73  IFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRL 132

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q 
Sbjct: 133 SIGVQSFNDDMLARLGRVHNGKEALTAIATALKLFDKVNIDLMYALPNQTVQTALNDVQT 192

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A++    H+S Y LT+E  T F      G   LP +  A+D+ +         G   YE 
Sbjct: 193 AITTGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALEGAGFIHYET 249

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L +++    
Sbjct: 250 SAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLALMQSQPS 309

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERV 371
             VE++ ++++    EF+M  LRL +G+     +   G             +++G +E  
Sbjct: 310 EAVERKTVAADDLPFEFMMNALRLTDGVPAAMLQERTGVPAAKIMAQIETARQKGLLE-T 368

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
             +    T++G   L+ ++    
Sbjct: 369 NPTVFCPTEQGRLFLNDLLQCFL 391


>gi|302877639|ref|YP_003846203.1| oxygen-independent coproporphyrinogen III oxidase [Gallionella
           capsiferriformans ES-2]
 gi|302580428|gb|ADL54439.1| oxygen-independent coproporphyrinogen III oxidase [Gallionella
           capsiferriformans ES-2]
          Length = 394

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 136/391 (34%), Positives = 215/391 (54%), Gaps = 9/391 (2%)

Query: 7   YENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT 66
              ++       L +Y+H P+CVKKCPYCDFNSH  R    ++ ++ + + +++      
Sbjct: 7   ISKSVAFTALPPLSLYIHVPWCVKKCPYCDFNSHEARGGFSEKEYVDALIRDLEMALPQI 66

Query: 67  GPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYR 126
             R + ++FFGGGTPSL+  + I  IL  +     +S + EIT+EANP +VE   F  +R
Sbjct: 67  WGRKVYTVFFGGGTPSLLSGEAITEILRQVRMLLPLSGDAEITLEANPGTVEAAKFAAFR 126

Query: 127 KAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQ 186
            AGVNR+S+G+QS  +  L+ LGR H A EA AAI +A+  F  ++ DL+YALPKQT+ Q
Sbjct: 127 DAGVNRLSMGIQSFNDTHLQALGRIHTADEAKAAIDIAQLHFDNINLDLMYALPKQTLDQ 186

Query: 187 WEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAH 246
              ++Q AL++   HLS Y LT+E  TLFY         LP ++ + D+    +++ + +
Sbjct: 187 ALQDVQTALTFKPQHLSAYHLTLEPNTLFY----RNPPSLPDDDASADMQQAIEALLAEN 242

Query: 247 GLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK 306
           G   YE S  +     S HNLNYW++GDY+GIG GAHS++      V  +  K P+++++
Sbjct: 243 GYQHYETSAFAQPNRRSRHNLNYWKFGDYLGIGAGAHSKLSFPDKIVREARYKQPQAYMQ 302

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL--QR 364
            V        E E +S ++   EF+M  LRL EG     +      +L       L  ++
Sbjct: 303 QVALGAPVQTEHE-VSRDEIPFEFMMNALRLNEGFDAALFCERTSLSLISIQRELLDAEK 361

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           +G + R    R+  T +G   L+ ++  + +
Sbjct: 362 RGLLSR-DIQRIAPTLQGQRFLNDLL-EIFL 390


>gi|325141883|gb|EGC64325.1| hypothetical protein NMB9615945_1490 [Neisseria meningitidis
           961-5945]
          Length = 399

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 127/391 (32%), Positives = 206/391 (52%), Gaps = 6/391 (1%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           ++ N           +Y+H P+C+KKCPYCDFNSH  +  + +  +I + LT++Q     
Sbjct: 13  SFPNRTRLTALPPPSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQLELPN 72

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + +IFFGGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG+
Sbjct: 73  IWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGF 132

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           + AG+ R+S+GVQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+ 
Sbjct: 133 KDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPNQTVQ 192

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
               ++Q A++    H+S Y LT+E  T F      G   LP +  A+D+ +       +
Sbjct: 193 TALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALES 249

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L
Sbjct: 250 AGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYL 309

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQ 363
            +++      VE++ +++E    EF+M  LRL +G+     +   G             +
Sbjct: 310 ALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPTAMLQERTGVPSAKIMAQIETAR 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++G +E    +  R T++G   L+ ++    
Sbjct: 370 QKGLLE-TDPAVFRPTEKGRLFLNDLLQCFL 399


>gi|27375783|ref|NP_767312.1| coproporphyrinogen III oxidase [Bradyrhizobium japonicum USDA 110]
 gi|27348921|dbj|BAC45937.1| oxygen-independent coproporphyrinogen III oxidase [Bradyrhizobium
           japonicum USDA 110]
          Length = 373

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 193/371 (52%), Positives = 251/371 (67%)

Query: 24  HWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSL 83
           HWPFC+ KCPYCDFNSHVR   + +  F  +F  E++   Q    R ++SIF GGGTPSL
Sbjct: 2   HWPFCLSKCPYCDFNSHVRHAAIDEARFASAFAREIETTAQRAPGREVTSIFLGGGTPSL 61

Query: 84  IEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQ 143
           ++P  +  +LD I K+W V+ +VE+T+EANP+SVE   F GYR AGVNR+SLGVQ+L++ 
Sbjct: 62  MQPATVGAVLDSIGKHWQVARDVEVTLEANPTSVEATRFAGYRAAGVNRVSLGVQALDDA 121

Query: 144 SLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
           SL+ LGR H+A EA+ A+ +AR  F R SFDLIYA P QT   W  EL+ A++ A +HLS
Sbjct: 122 SLKALGRMHSAREALDAVAIARRSFERYSFDLIYARPDQTPAMWADELRLAIAEAAEHLS 181

Query: 204 LYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAES 263
           LYQLTIE+GT F+ +H+ G L  P E VA  LY++TQ      GL AYEISNH+  GAE 
Sbjct: 182 LYQLTIEEGTPFFGLHQAGKLKTPDEAVARALYDVTQETCDKLGLPAYEISNHARRGAEC 241

Query: 264 LHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSS 323
            HNL YWR  +Y GIGPGAH R+ +   R A + EK PE+WL  V  NGH VV  + L+S
Sbjct: 242 RHNLVYWRGDEYAGIGPGAHGRLDIDGIRHATATEKRPEAWLLRVETNGHGVVTDDLLNS 301

Query: 324 EQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGM 383
           E++ADEFL+MGLRL EGI  + +  L+GR LD +    L+ +G I      RLR T  G 
Sbjct: 302 EERADEFLLMGLRLAEGIDPERYTALSGRALDPKRIALLREEGAITVDATGRLRVTSSGF 361

Query: 384 TMLDSVIANLA 394
            +LD+V+A+LA
Sbjct: 362 PVLDAVVADLA 372


>gi|254487813|ref|ZP_05101018.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. GAI101]
 gi|214044682|gb|EEB85320.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. GAI101]
          Length = 385

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 172/378 (45%), Positives = 245/378 (64%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV R  + Q+ +  ++L E++     T  R ++++FFG
Sbjct: 9   GFGLYIHWPFCEAKCPYCDFNSHVSRT-IDQQAWRDAYLLELERGAAETKGRVLNAVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P+ +A ++  I + W V++++EIT+EANP SVE   F+G+R AGVNR+S+G+
Sbjct: 68  GGTPSLMDPEIVADVIAAIYRLWPVANDLEITLEANPGSVEAGRFKGFRDAGVNRVSMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR HN +EA+AA  +AR+ F R+SFDLIY    QT+++W+ EL++ALS 
Sbjct: 128 QALNDTDLRKLGRIHNTTEALAAFDIARSTFDRVSFDLIYGRQNQTLSEWKTELKQALSL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A+DH+SLYQLTIE+GT F   +  G L    ++    D+Y  TQ I    G+ +YE+SNH
Sbjct: 188 AIDHISLYQLTIEQGTAFGDRYAVGKLRGLPDDDLGADMYAATQEICDQMGMPSYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +   A+S HNL YWRYGDY+GIGPGAH R+  G  R A     +P+ WL           
Sbjct: 248 ARDSAQSRHNLIYWRYGDYLGIGPGAHGRLTKGGDRFATECFSNPKRWLDAAVSGSTEKP 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             E L+   QA EFLMMGLRL+EG+ +K +E LAG  L  +    +Q  G I  +   RL
Sbjct: 308 R-EQLAKSDQASEFLMMGLRLKEGVDLKRYEALAGSPLSAKKIIRMQDIGMIS-ISGDRL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T +G  +L++++  L 
Sbjct: 366 TVTNQGFMVLNAILEELL 383


>gi|319638392|ref|ZP_07993154.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria mucosa
           C102]
 gi|317400141|gb|EFV80800.1| oxygen-independent coproporphyrinogen III oxidase [Neisseria mucosa
           C102]
          Length = 391

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 131/380 (34%), Positives = 207/380 (54%), Gaps = 6/380 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C+KKCPYCDFNSH  +  + +E +I + LT++Q        R + +IFF
Sbjct: 16  PPLSLYIHTPWCIKKCPYCDFNSHSLKNGLPEEAYIDALLTDLQLELPNIWGRPVETIFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + ++I  +L G+     +    EIT+EANP + E+  FQG++ AG+ R+S+G
Sbjct: 76  GGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEKFQGFKDAGITRLSIG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS  +  L  LGR HN  EA+ AI  A  +F +++ DL+YALP QT+     ++Q A++
Sbjct: 136 VQSFNDDMLARLGRVHNGKEALTAIDTALKLFEKVNIDLMYALPNQTVQTALNDVQTAIA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V H+S Y LT+E  T F      G   LP +  A+D+ +       + G   YE S  
Sbjct: 196 TGVSHISAYHLTMEPNTPFGHTPPKG---LPQDEAALDIEDAVHGALESAGFIHYETSAF 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    +  HNLNYW++GDY+GIG GAH ++            +HP  +L  ++ N H  V
Sbjct: 253 AKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDYLAAMQSNPHEAV 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERNLQRQGFIERVQFS 374
           E++ +++E    EF+M  LRL +G+     +   G             +++G +E    +
Sbjct: 313 ERKTVAAEDLPFEFMMNVLRLTDGVPAATLQERTGVPTAKIMTQIETARQKGLLE-SDPT 371

Query: 375 RLRCTQRGMTMLDSVIANLA 394
             R T++G   L+ ++    
Sbjct: 372 VFRPTEQGRLFLNDLLQCFL 391


>gi|319404961|emb|CBI78563.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella sp.
           AR 15-3]
          Length = 398

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 206/396 (52%), Positives = 261/396 (65%), Gaps = 18/396 (4%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+Y+HWPFC+ KCPYCDFNS+VR   V Q  F  +F  E+       GPR I+SIF 
Sbjct: 2   KPFGIYIHWPFCMSKCPYCDFNSYVRINGVDQSRFANAFEREITTQAHEIGPRRITSIFI 61

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +  +L  +AKNWT+   VEIT+EANPSSVE N F+GY  AGVNR+SLG
Sbjct: 62  GGGTPSLMTPQTVDRLLQAVAKNWTIDDKVEITLEANPSSVEANRFRGYHLAGVNRLSLG 121

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQ+L +++L+ LGR HNA +A+ AI+LAR IFPR+SFDLIYA PKQT+ QW+ EL +A++
Sbjct: 122 VQALNDKALQQLGRLHNAKQALHAINLARKIFPRLSFDLIYARPKQTLKQWKSELLQAIN 181

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A DHLSLYQLTIE GT F K+H  G L+LP+   A +LY LTQ IT+ HGL AYEISNH
Sbjct: 182 LATDHLSLYQLTIEDGTTFKKLHAAGKLILPASEQAANLYTLTQEITTMHGLPAYEISNH 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISIE 298
           +  GAES HNL YWRY +Y G GPGAH R                       +R     E
Sbjct: 242 AIPGAESCHNLLYWRYHEYAGFGPGAHGRFIKQSLKNSSLFSEKLPSKTENHNRYVTINE 301

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC 358
           KHPE+WL++V   GH  +  E LS EQQA+E L+MGLRL EG+ +  +E L  ++L  + 
Sbjct: 302 KHPENWLELVETTGHGCINTEHLSREQQANEMLLMGLRLTEGLDLIRYETLNRQSLSSKK 361

Query: 359 ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
             +LQ+QG +E      L+ T +G   LD +I  LA
Sbjct: 362 LIHLQQQGLVEITDNKHLKATIKGRIFLDHIIYQLA 397


>gi|224501584|ref|ZP_03669891.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL R2-561]
          Length = 385

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 192/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTVAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNTLPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LPS++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPSQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +     I+K+ E   +    N     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFGPIKKYMEPLQE----NILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|319406449|emb|CBI80089.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella sp.
           1-1C]
          Length = 399

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 202/397 (50%), Positives = 261/397 (65%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC+ KCPYCDFNS+VR   V Q  F  +F  E+    +  GPR I+SIF
Sbjct: 2   TKPFGIYIHWPFCMSKCPYCDFNSYVRTNGVDQPRFANAFEREITTQAKKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AKNWT+    EIT+EANPSSVE + F+GY+ AGVNR+SL
Sbjct: 62  IGGGTPSLMAPQTVDRLLQAVAKNWTIDDKAEITLEANPSSVEADRFRGYQLAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++L+ LGR H+  +A  AI+LAR IFPR+SFDLIYA PKQT+ QWE EL +A+
Sbjct: 122 GVQALNDKALQQLGRLHSVKQAFHAINLAREIFPRLSFDLIYARPKQTLKQWETELLQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A DHLSLYQLTIE GT F K+H  G L+LP    A +LY LTQ IT+ +GL AYEISN
Sbjct: 182 NLAADHLSLYQLTIEDGTTFKKLHAAGKLILPPSEQAANLYTLTQEITTMYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISI 297
           H+  GAES HNL YWRY +Y G GPGAH R                       +R     
Sbjct: 242 HAIPGAESRHNLLYWRYHEYAGFGPGAHGRFIKQSLKNSSFFPETFPSKIENHNRYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE+WL++V   GH  +E E LS EQQA+E L+MG+RL EG+ +  ++ L+ ++L  +
Sbjct: 302 EKHPENWLELVENTGHGCIETELLSQEQQANEMLLMGMRLAEGLDLARYKTLSCQSLPRK 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
               LQ+QG IE      L+ T+ G   LD +I  LA
Sbjct: 362 KLIRLQKQGLIEITDNQHLKATKTGRIFLDHIIYQLA 398


>gi|241762328|ref|ZP_04760408.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|241373122|gb|EER62761.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 393

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 174/380 (45%), Positives = 241/380 (63%), Gaps = 10/380 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+HWPFC+ KCPYCDFNSHVR   +    +  + L++M     LT  R +SSIFFG
Sbjct: 18  PLALYIHWPFCLAKCPYCDFNSHVRP-DIDAALWQDALLSDMAHEAALTQGRRLSSIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D   + W  + ++EIT+EANPSSVE + FQ    AGVNR+SLG+
Sbjct: 77  GGTPSLMPPETVAALIDAATRYWQPTPDIEITLEANPSSVEADRFQSLALAGVNRLSLGI 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ SL FLGR HN  EA++A+ +A+  F R+SFDLIY  P Q++  WE EL++AL++
Sbjct: 137 QALDDTSLHFLGRIHNVQEALSALDIAQKNFSRVSFDLIYGRPNQSLKDWEEELKQALAF 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             DHLSLYQLTIE+GT F+ + + G       + A DL++LT+ +T A G+ AYEISNH+
Sbjct: 197 GSDHLSLYQLTIEEGTRFHSLVRQGQFTPMDGDKAADLFDLTRDMTKAAGIPAYEISNHA 256

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
              +ES HNL YWRYGDYIGIG GAH               K PE+WL  V+K    + E
Sbjct: 257 RKNSESRHNLTYWRYGDYIGIGAGAH----GRRLNNVTIRHKKPENWLSAVQKQQQGIQE 312

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQF 373
           +  LS + QA E ++MGLRL EGI  K+ +   G +    LDI   +    QG +     
Sbjct: 313 ETPLSPKDQAIEAVLMGLRLTEGIDPKNIQKRTGLDISEFLDIAAIQYYSDQGLLT-FNN 371

Query: 374 SRLRCTQRGMTMLDSVIANL 393
             LR T++G  + D++I  +
Sbjct: 372 GLLRITEQGALLTDALIREI 391


>gi|315303221|ref|ZP_07873871.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria ivanovii FSL F6-596]
 gi|313628403|gb|EFR96886.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria ivanovii FSL F6-596]
          Length = 388

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 109/379 (28%), Positives = 192/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 16  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTVAKGPIAPVDTVFVGGG 74

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 75  TPTTLNEAQIARLCTAIHNTLPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 134

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 135 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 194

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 195 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 254

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ +++N     ++
Sbjct: 255 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQENILPTFQQ 310

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 311 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 369

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 370 VALTRNGRFLGNNVFQEFL 388


>gi|16803516|ref|NP_465001.1| coproporphyrinogen III oxidase [Listeria monocytogenes EGD-e]
 gi|224500505|ref|ZP_03668854.1| coproporphyrinogen III oxidase [Listeria monocytogenes Finland
           1988]
 gi|254827764|ref|ZP_05232451.1| hemN [Listeria monocytogenes FSL N3-165]
 gi|284801863|ref|YP_003413728.1| coproporphyrinogen III oxidase [Listeria monocytogenes 08-5578]
 gi|284995005|ref|YP_003416773.1| coproporphyrinogen III oxidase [Listeria monocytogenes 08-5923]
 gi|16410905|emb|CAC99554.1| hemN [Listeria monocytogenes EGD-e]
 gi|258600144|gb|EEW13469.1| hemN [Listeria monocytogenes FSL N3-165]
 gi|284057425|gb|ADB68366.1| coproporphyrinogen III oxidase [Listeria monocytogenes 08-5578]
 gi|284060472|gb|ADB71411.1| coproporphyrinogen III oxidase [Listeria monocytogenes 08-5923]
          Length = 385

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 112/379 (29%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTVAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNTLPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +     I+K+ E   +    N     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFGPIKKYMEPLQE----NILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|73542165|ref|YP_296685.1| coproporphyrinogen III oxidase [Ralstonia eutropha JMP134]
 gi|72119578|gb|AAZ61841.1| coproporphyrinogen III oxidase, anaerobic [Ralstonia eutropha
           JMP134]
          Length = 413

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 132/400 (33%), Positives = 218/400 (54%), Gaps = 16/400 (4%)

Query: 3   YLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHV-----RRYKVGQENFIQSFLT 57
           +L   +  + G  S  L +YVH P+CV+KCPYCDFNSH        + + ++ ++ +   
Sbjct: 21  WLKPGQIALPG--SPPLSLYVHVPWCVRKCPYCDFNSHAVPGKDGSHDIPEDAYLDALRA 78

Query: 58  EMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSV 117
           +++    L   R + ++F GGGTPSL+    +  +L  I     + ++ EIT+EANP + 
Sbjct: 79  DLEQSLPLVWGRPVHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEANPGTF 138

Query: 118 EVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIY 177
           E   F  YR +GVNR+S+G+QS  +  L+ LGR H   EA AAI +A+  F  ++ DL+Y
Sbjct: 139 EAERFASYRASGVNRLSIGIQSFNDSHLQALGRIHGEREARAAIDIAQRSFDNVNLDLMY 198

Query: 178 ALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYN 237
           ALP QT+ Q   +L+ ALSY   HLSLY LT+E  TLF K        LP +++A ++ +
Sbjct: 199 ALPGQTLEQCRSDLESALSYGTTHLSLYHLTLEPNTLFAKFPPA----LPDDDLAYEMQD 254

Query: 238 LTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISI 297
           L ++ T+  G   YE S ++    E+ HNLNYWR+GDY+GIG GAH ++   +  +    
Sbjct: 255 LIEARTTEAGYRHYETSAYARAHREARHNLNYWRFGDYLGIGAGAHGKLSFPNRILRQMR 314

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI- 356
            KHP +++            +E + +++   EF++  LRL +G+    +  + G  L   
Sbjct: 315 HKHPATYMAQAMAGNAVQEARE-VGADELPFEFMLNALRLTDGVPASSFHDMTGLPLHAI 373

Query: 357 -ECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
                  +++G ++    + +R T+ G   L+  +  + +
Sbjct: 374 SRQLAAAEKKGLLD-ADPTVIRPTELGRRFLND-LQEMFL 411


>gi|296284091|ref|ZP_06862089.1| coproporphyrinogen III oxidase [Citromicrobium bathyomarinum JL354]
          Length = 387

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 176/384 (45%), Positives = 237/384 (61%), Gaps = 10/384 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
            ++ L +Y+HWPFC+KKCPYCDFNSHV R  V  + +    L ++     LT  R + SI
Sbjct: 3   AADDLALYIHWPFCLKKCPYCDFNSHV-RDDVDADAWQAGLLADLAHEHALTQGRRVGSI 61

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL+ P     +++   + W ++ + EIT+EANP+S E   F  +R AGVNR+S
Sbjct: 62  FFGGGTPSLMPPALAGSLIEQAQRLWGLAPDAEITLEANPTSYEAGKFADFRAAGVNRVS 121

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           LGVQSL E++L FLGR H+A+EA+AA+  A+ +F R++FDLIYA P Q+   WE EL RA
Sbjct: 122 LGVQSLHEEALAFLGREHSAAEAMAAVESAQGLFGRVTFDLIYARPGQSAEAWEAELARA 181

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++  +HLSLYQLTIE GT F      G L     + A DL+  TQ    A GL AYEIS
Sbjct: 182 LAFGTEHLSLYQLTIEPGTGFAGAVARGRLTPMDPDEAADLFVQTQEQMRAAGLPAYEIS 241

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           NH+  GA+S HNL YWRY DY+GIGPGAH         +A    K PE++L+ V +NGH 
Sbjct: 242 NHARPGAQSHHNLTYWRYRDYVGIGPGAH----GRRGGMATIRHKKPEAFLRRVGENGHG 297

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIER 370
           + E+  L  E+Q  E L+MGLRL EG+ +       G      +D +        GF+E 
Sbjct: 298 ISEERALGREEQLSEALLMGLRLAEGLDLAALATRFGTTPDALVDADRAAFYADLGFVE- 356

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
           +   RL  T +GM +LD+++A L 
Sbjct: 357 LDGDRLTITPQGMPLLDALLAELV 380


>gi|121602251|ref|YP_989584.1| coproporphyrinogen III oxidase [Bartonella bacilliformis KC583]
 gi|120614428|gb|ABM45029.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Bartonella bacilliformis KC583]
          Length = 392

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 209/389 (53%), Positives = 266/389 (68%), Gaps = 11/389 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
              G+Y+HWPFC  KCPYCDFNSHVR   V Q++F+++F  EM       GPR I+SIF 
Sbjct: 3   EPFGIYIHWPFCTAKCPYCDFNSHVRVKGVNQQHFVKAFEREMTTQYHEIGPRHITSIFI 62

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P  +  +L  +AKNWT+   +EIT+EANPSSVE   F GYR AGVNR+SLG
Sbjct: 63  GGGTPSLMTPHTVDALLQSVAKNWTIDDKIEITLEANPSSVEAERFHGYRTAGVNRLSLG 122

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQ+L +++L+ LGR H+  +A+ AI+LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+ 
Sbjct: 123 VQALNDKALQQLGRLHDVKQALHAINLARKIFPRLSFDLIYARPEQTLKQWKDELLQAID 182

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
            A DHLSLYQLTIEKGT F ++H +G L+LP   +A DLYNLTQ IT+ HGL AYEISNH
Sbjct: 183 LAADHLSLYQLTIEKGTAFKRLHAEGKLILPEPELAADLYNLTQEITALHGLPAYEISNH 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-----------SHRVAISIEKHPESWL 305
           +  GAES HNL YWRY +Y G GPGAH R                 R     EKHPE WL
Sbjct: 243 AISGAESRHNLLYWRYHEYAGFGPGAHGRFTKHSLALSERPSSQQTRHVTINEKHPERWL 302

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQ 365
           K+V   GH  +E E L+ EQQADE L+MGLRL EG  +  +E L+ +++  E   NLQ+Q
Sbjct: 303 KLVDTKGHGCIETEELTGEQQADEMLLMGLRLSEGFDLTRYETLSTKSVSSEKLTNLQQQ 362

Query: 366 GFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           G +E +   RL+ T+ G  +LD +I+ LA
Sbjct: 363 GLVEMIDNQRLKVTKTGRILLDHIISQLA 391


>gi|221201199|ref|ZP_03574239.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2M]
 gi|221206347|ref|ZP_03579360.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2]
 gi|221213627|ref|ZP_03586601.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD1]
 gi|221166416|gb|EED98888.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD1]
 gi|221173656|gb|EEE06090.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2]
 gi|221179049|gb|EEE11456.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia multivorans CGD2M]
          Length = 404

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 209/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEHALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT  +   +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTFDECRADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        +P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPPA----VPDDDASADMQEWIHARTAEAGYERYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++       HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHRCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFMEQALAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALQEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +R+  T  G   L+  +  L +
Sbjct: 381 TRIAPTPLGQRFLND-LQELFL 401


>gi|254829765|ref|ZP_05234420.1| coproporphyrinogen III oxidase [Listeria monocytogenes 10403S]
          Length = 385

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 112/379 (29%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICFYCDFNKVFL-EGQPVDEYVDLLIKEMELTVAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNTLPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +     I+K+ E   +    N     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFGPIKKYMEPLQE----NILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G+  K ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVDKKHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|113866971|ref|YP_725460.1| coproporphyrinogen III oxidase [Ralstonia eutropha H16]
 gi|113525747|emb|CAJ92092.1| Coproporphyrinogen III oxidase, Fe-S oxidoreductase [Ralstonia
           eutropha H16]
          Length = 410

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 128/387 (33%), Positives = 216/387 (55%), Gaps = 13/387 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVR----RYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           GS  L +YVH P+CV+KCPYCDFNSH       +++ ++ ++ +   +++    L   R 
Sbjct: 29  GSPPLSLYVHIPWCVRKCPYCDFNSHAAPGADNHEIPEDIYLDALRADLEQSLPLVWGRP 88

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + ++F GGGTPSL+    +  +L  I     + ++ EIT+EA P + E + F  YR +G+
Sbjct: 89  VHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEAKPGTFEADKFASYRASGI 148

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+G+QS  ++ L+ LGR H  +EA  AI +A+  F  ++ DL+YALP QT+ +   +
Sbjct: 149 NRLSIGIQSFNDRHLQALGRIHGGAEARKAIDIAQASFDNINLDLMYALPGQTLDECRQD 208

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           ++ ALSY   HLSLY LT+E  TLF K        LP ++ A ++ +  ++ T+  G   
Sbjct: 209 VEAALSYGTTHLSLYHLTLEPNTLFAKFPPA----LPDDDSAYEMQDWIEARTAQAGYRH 264

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE S ++    E+ HNLNYWR+GDY+GIG GAH ++      +     KHP ++++    
Sbjct: 265 YETSAYAKPHREARHNLNYWRFGDYLGIGAGAHGKLSFPHRILRQMRHKHPATYMERALA 324

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFI 368
             +AV E   + +++   EF++  LRL +G+    +    G  L    +     +++G +
Sbjct: 325 G-NAVQEARDVGADELPFEFMLNALRLTDGVPASSFHDYTGLPLHTISKQLAEAEKKGLL 383

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E    + +R T+ G   L+  +  + +
Sbjct: 384 E-ADLTTIRATELGRRFLND-LQEMFL 408


>gi|146278694|ref|YP_001168853.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556935|gb|ABP71548.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 385

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 186/378 (49%), Positives = 247/378 (65%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+FFG
Sbjct: 8   GFGLYLHWPFCQSKCPYCDFNSHVAAT-IDQSRWQRAYLSEIRRLGTETEGRVLNSVFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP+ +A IL+ +   W +++++E+T+EANP SVE   F+G+R AGVNRIS+G+
Sbjct: 67  GGTPSLMEPELVAAILETVRATWPLANDLEVTLEANPGSVEAGRFRGFRDAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q++  W  EL  AL+ 
Sbjct: 127 QALNDADLRQLGRLHTVAEARAAFDVARTTFDRVSFDLIYARQDQSLADWRQELSEALAM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLS+YQLTIE GT F +  K G L    E   + D+Y LTQ +  A GL AYEISNH
Sbjct: 187 AADHLSMYQLTIEDGTAFGERFKRGKLRGLPEEELSADMYALTQDLCDAAGLPAYEISNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWR GDY G GPGAH RV + + R A    K P  WL+ V ++G+  +
Sbjct: 247 AQPGAESRHNLIYWRGGDYAGAGPGAHGRVSLATGRWATEAPKAPGGWLERVERDGNGEL 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L  +  A E+LMM LRLREG+  +    LAGR LD     +LQ  G IE    +RL
Sbjct: 307 PRVRLDRDDHALEYLMMALRLREGLDSERHAALAGRPLDERRVTDLQEMGMIE-TDGARL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T RG  +L+SVIA+LA
Sbjct: 366 RATTRGRMVLNSVIASLA 383


>gi|259417573|ref|ZP_05741492.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter sp. TrichCH4B]
 gi|259346479|gb|EEW58293.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter sp. TrichCH4B]
          Length = 384

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 174/378 (46%), Positives = 234/378 (61%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   ++ Q  ++ ++ +E++ M +L   R ++SIFFG
Sbjct: 8   GFGLYVHWPFCQAKCPYCDFNSHVV-SQIDQSAWVTAYQSELRRMGELLPDRLLNSIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A +++   +NWT ++++EI++EANP SVE   F GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMHPDTVAAVIEAARENWTFANDIEISLEANPGSVEAGRFAGYRDAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H   EA  A  +ARN F R+SFDLIYA   QT+  W+ EL  ALS 
Sbjct: 127 QALNDDDLRRLGRIHTVDEARTAFDVARNCFDRVSFDLIYARQGQTLEAWKAELSEALSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAH-GLHAYEISNH 256
           A+DHLSLYQLTIE GT F   +  G L     +       L         GL  YEISNH
Sbjct: 187 AIDHLSLYQLTIEDGTAFGDRYARGKLRDLPTDDNAADMYLATQDICDAYGLPGYEISNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HN  YWRYGDY+G+GPGAH R+ +   R A    + P +WL  V+K    + 
Sbjct: 247 ARPGAESRHNQIYWRYGDYVGVGPGAHGRITLNGQRYATEAPRAPGAWLDAVKKGQGLLP 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             E L  E Q  E +MMG+RL EG+ ++  E LAG+ L ++  + L   G I  V  +RL
Sbjct: 307 F-EILKPEDQVVEHMMMGMRLFEGLDLERHEALAGKPLSVKRIQELTDWGMIV-VDGARL 364

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L++V+  L 
Sbjct: 365 RATSQGRAVLNAVLRELL 382


>gi|170698510|ref|ZP_02889581.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria IOP40-10]
 gi|170136594|gb|EDT04851.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria IOP40-10]
          Length = 404

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 209/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSASGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTMFAKFPPA----VPDDDASADMQEWIHERTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E +       EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGPRDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|327482669|gb|AEA85979.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri DSM 4166]
          Length = 392

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 129/381 (33%), Positives = 210/381 (55%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L  YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R +SSIFF
Sbjct: 18  PPLAAYVHIPWCVRKCPYCDFNSHTAGPELPEEAYVAALLADLRADLEHVQGRRLSSIFF 77

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +A I++G+      + ++EIT+EANP + E   F+ YR+ G++R+S+G
Sbjct: 78  GGGTPSLFSARALAAIVEGLEHLVGFADDIEITLEANPGTFEQAKFRDYRQLGIDRLSIG 137

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+  EAI A  +AR   F   + DL++ LP Q++     +L+ A+
Sbjct: 138 VQSFQAAKLKALGRIHDGDEAIRAADMARAAGFENFNLDLMHGLPDQSLEDALSDLRTAI 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLT+E  TLF+         LP +++  D+    Q++   HG   YE S 
Sbjct: 198 AQQPTHLSWYQLTLEPNTLFWSQPPQ----LPEDDILWDIQEAGQALLGEHGYRQYETSA 253

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G ++ HNLNYW +GD++GIG GAH+++     R+  S +         +       
Sbjct: 254 YAQPGRQARHNLNYWTFGDFLGIGAGAHAKLSHADGRILRSWKTRL--PKDYLDPGKAFR 311

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
             ++ L++++   EFLM  LRL +G+    +    G  LD      RN + +G +     
Sbjct: 312 AGEKQLTADELPFEFLMNVLRLTDGVPAVLFTQRTGLALDAIAKPRRNAEARGLLS-NDP 370

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
           +RL  T +G   L+ ++ +  
Sbjct: 371 ARLVATPKGQLFLNDLLQSFL 391


>gi|47095429|ref|ZP_00233039.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Listeria monocytogenes str. 1/2a F6854]
 gi|254898358|ref|ZP_05258282.1| coproporphyrinogen III oxidase [Listeria monocytogenes J0161]
 gi|254912150|ref|ZP_05262162.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936478|ref|ZP_05268175.1| hemN [Listeria monocytogenes F6900]
 gi|47016250|gb|EAL07173.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Listeria monocytogenes str. 1/2a F6854]
 gi|258609071|gb|EEW21679.1| hemN [Listeria monocytogenes F6900]
 gi|293590122|gb|EFF98456.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 385

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 109/379 (28%), Positives = 192/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTVAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNTLPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ ++KN     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQKNILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G++   ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVNKNHFKQKFGQDLDATFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRNGRFLGNNVFQEFL 385


>gi|221633414|ref|YP_002522639.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thermomicrobium roseum DSM 5159]
 gi|221156673|gb|ACM05800.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thermomicrobium roseum DSM 5159]
          Length = 404

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 195/383 (50%), Gaps = 12/383 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVH PFC + CPYCDFN + R+  +    ++ +   E+  +    G   + +I+ G
Sbjct: 21  PWGLYVHIPFCRRVCPYCDFNVYARQEPL-IPRYLAAVRRELALLADRWGRGPVRTIYLG 79

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A +LD IA  + +    E+T+EANP +V+     GYR AGVNR+SLGV
Sbjct: 80  GGTPSLLTPHQVAELLDAIAAIFVLVDQPEVTLEANPETVDTEKLAGYRAAGVNRLSLGV 139

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+L  Q L+ LGR H     +AA   AR      ++ DLIY  P QT  QWE +L   LS
Sbjct: 140 QTLVPQGLKVLGRAHRPETPVAAYRAARATGFRNVNLDLIYGWPGQTRDQWEQDLATVLS 199

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLY LTIE GT + +  + G L    ++V  +L  L       HG   YE+SN 
Sbjct: 200 WQPEHLSLYALTIEPGTPYERAVRRGILRPLDDDVVAELAELAMEQLEKHGYLHYELSNW 259

Query: 257 SFLGA-ESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           +  G   S+HN  YWR G Y+G+G GAH  +           E+ P  ++  V      +
Sbjct: 260 ARAGCSRSIHNTIYWRNGFYLGVGAGAHGYLGGIR----TVNERLPARYIARVEAGDLPI 315

Query: 316 VEKEFLSSEQQADEFLMMGLRL-REGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERV 371
            + E +    +  E +M+GLRL  +GIS        G  L          L + G IE  
Sbjct: 316 ADMESIDPRTELVETMMLGLRLVADGISAAAVRARHGVELSEAYGPELDELVQYGLIEW- 374

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
              RLR ++RG+ + + V     
Sbjct: 375 DGERLRLSRRGILLANEVAVRFL 397


>gi|290894236|ref|ZP_06557205.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL J2-071]
 gi|290556233|gb|EFD89778.1| coproporphyrinogen III oxidase [Listeria monocytogenes FSL J2-071]
          Length = 385

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/379 (29%), Positives = 193/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNILPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LPS++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPSQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ ++KN     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQKNILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G++   ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVNKNHFKQKFGQDLDTTFANAIQKTTSKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRNGRFLGNNVFQEFL 385


>gi|194289071|ref|YP_002004978.1| coproporphyrinogen iii oxidase [Cupriavidus taiwanensis LMG 19424]
 gi|193222906|emb|CAQ68911.1| Oxygen-independent coproporphyrinogen III
           oxidase(Coproporphyrinogenase)(Coprogen oxidase)
           [Cupriavidus taiwanensis LMG 19424]
          Length = 410

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 129/387 (33%), Positives = 217/387 (56%), Gaps = 13/387 (3%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVR----RYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           GS  L +YVH P+CV+KCPYCDFNSH       +++ ++ ++ +   +++    L   R 
Sbjct: 29  GSPPLSLYVHVPWCVRKCPYCDFNSHAAPGADNHEIPEDLYLDALRADLEQSLPLVWGRP 88

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + ++F GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  YR +G+
Sbjct: 89  VHTVFIGGGTPSLLSAAGMDRLLSDIRALLPLDADAEITMEANPGTFEAEKFASYRASGI 148

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+S+G+QS  ++ L+ LGR H  +EA  AI +A+  F  ++ DL+YALP QT+ + + +
Sbjct: 149 NRLSIGIQSFNDRHLQALGRIHGGTEARRAIDIAQASFDNINLDLMYALPGQTLQECQAD 208

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           ++ AL Y   HLSLY LT+E  TLF K        LP ++ A ++ +  ++ T+A G   
Sbjct: 209 VETALGYGTTHLSLYHLTLEPNTLFAKFPPA----LPDDDTAYEMQDWIEARTAAAGYRH 264

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE S ++    E+ HNLNYWR+GDY+GIG GAH ++      +     KHP +++     
Sbjct: 265 YETSAYARPHREARHNLNYWRFGDYLGIGAGAHGKLSFPQRVLRQMRHKHPATYMAQAMA 324

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFI 368
             +AV E   + +++   EF++  LRL +G+    ++   G  L    +     +++G +
Sbjct: 325 G-NAVQEARDVGADELPFEFMLNALRLTDGVPASSFQDYTGLPLHTISKQLAEAEKKGLL 383

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E    + +R T+ G   L+  +  + +
Sbjct: 384 E-ADLTTIRPTELGRRFLND-LQEMFL 408


>gi|49473731|ref|YP_031773.1| coproporphyrinogen III oxidase [Bartonella quintana str. Toulouse]
 gi|49239234|emb|CAF25554.1| Oxygen-independent coproporphyrinogen III oxidase [Bartonella
           quintana str. Toulouse]
          Length = 399

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 206/397 (51%), Positives = 264/397 (66%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+++F  E++      GPR I+SIF
Sbjct: 2   NEPFGIYIHWPFCAAKCPYCDFNSHVRVHGVDQPRFVKAFKREIETQYHKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AK WTV    EIT+EANPSSVE N F GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMTPQTVDALLQALAKTWTVDDKAEITLEANPSSVEANRFYGYRAAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++LR LGR H+  +A+ AI LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GVQALNDKALRQLGRLHDVKQALHAIVLAREIFPRLSFDLIYARPEQTLEQWKCELFQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F ++H  G L+LP   +A +LY+LTQ +T+ HGL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTAFKRLHAAGRLILPESELAANLYHLTQEMTALHGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV------------------GSHRVAISI 297
           H+  GAES HNL YWRY +Y G GPGAH R                        R     
Sbjct: 242 HAIPGAESAHNLLYWRYHEYAGFGPGAHGRFIERSTNHFSPFLKSSSSQIKNRERSVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE WL++V   GH  VE E L+  QQA+E L+MGLRL EG+ +  +E L  ++L IE
Sbjct: 302 EKHPEYWLELVETKGHGCVETEQLTPLQQANEMLLMGLRLCEGLDLTRYETLTSKSLPIE 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              NL+ QG +E +   RL+ T +G  +LD +I+ LA
Sbjct: 362 KLINLKHQGLVETIGHQRLKATAKGRILLDHIISQLA 398


>gi|254252977|ref|ZP_04946295.1| Coproporphyrinogen III oxidase [Burkholderia dolosa AUO158]
 gi|124895586|gb|EAY69466.1| Coproporphyrinogen III oxidase [Burkholderia dolosa AUO158]
          Length = 404

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 126/382 (32%), Positives = 211/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   + +++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPESDYLDALRADLEHALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT  +   +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTFDECRADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        +P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPPA----VPDDDASADMQEWIHARTAEAGYERYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNRQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPAAFIEHAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL +G  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVDGFPVHSFIERTGLPMSTIEPALQEAERRGLIVR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +R+  T  G   L+  +  L +
Sbjct: 381 TRIAPTPLGQRFLND-LQELFL 401


>gi|221640721|ref|YP_002526983.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides KD131]
 gi|221161502|gb|ACM02482.1| oxygen-independent coproporphyrinogen III oxidase [Rhodobacter
           sphaeroides KD131]
          Length = 385

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 180/378 (47%), Positives = 240/378 (63%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+FFG
Sbjct: 8   GFGLYLHWPFCQSKCPYCDFNSHVAAT-IDQGRWQRAYLSEIRRLGTETEGRVLNSVFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVEV  F+GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMEPDLVAAILETVRTTWPLANDLEVTLEANPGSVEVGRFRGYRAAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q +  W  EL  AL+ 
Sbjct: 127 QALNDADLRKLGRLHTVAEARAAFDVARATFDRVSFDLIYARQDQPLDHWRSELTEALAM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLS+YQLT+E GT F +  K G L    E   + D+Y LTQ +    GL AYE+SNH
Sbjct: 187 AADHLSMYQLTVEDGTAFGERFKRGKLRGLPEEELSADMYALTQHLCERAGLPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWR GDY G+GPGAH R+   + R A    K P +WL+ V ++G+   
Sbjct: 247 ARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPKAPGAWLERVERDGNGES 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L  E  A E+LMM LRLREG+       LAGR LD     +L+  G IE +   R+
Sbjct: 307 PRVRLDPEDHALEYLMMSLRLREGLDRARHAALAGRPLDERRVADLREMGMIE-IDDERI 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T  G  +L+SVI  LA
Sbjct: 366 CATTEGRMVLNSVITALA 383


>gi|217964378|ref|YP_002350056.1| oxygen-independent coproporphyrinogen III oxidase [Listeria
           monocytogenes HCC23]
 gi|217333648|gb|ACK39442.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria monocytogenes HCC23]
 gi|307571057|emb|CAR84236.1| oxygen-independent coproporphyrinogen III oxidase [Listeria
           monocytogenes L99]
          Length = 385

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 109/379 (28%), Positives = 192/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIHNILPLKKDIEFSFEANPGDLSLSKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R I F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQTEADFQDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ ++KN     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQKNILPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G++   ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVNKNHFKQKFGQDLDTTFANAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRNGRFLGNNVFQEFL 385


>gi|167563699|ref|ZP_02356615.1| coproporphyrinogen III oxidase [Burkholderia oklahomensis EO147]
 gi|167570849|ref|ZP_02363723.1| coproporphyrinogen III oxidase [Burkholderia oklahomensis C6786]
          Length = 405

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 126/383 (32%), Positives = 210/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPEHDYLDALRADLEQALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS +E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFDESHLKALGRIHDAAQARAAVEIAARTFDNFNLDLMFALPNQTLDECRTDLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           LS+A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LSFAPPHLSLYHLTLEPNTYFAKFPPA----VPDDDASADMQDWLHERTAQAGYERYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGAAV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL EG+    +    G +L          +R+G I    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVEGVPTHSFAERTGMSLAAIGPALAEAERRGLIVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|115350909|ref|YP_772748.1| coproporphyrinogen III oxidase [Burkholderia ambifaria AMMD]
 gi|115280897|gb|ABI86414.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia ambifaria AMMD]
          Length = 404

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 209/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTMFAKFPPA----VPDDDASADMQEWIHERTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E +       EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGPRDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|325524720|gb|EGD02707.1| coproporphyrinogen III oxidase [Burkholderia sp. TJI49]
          Length = 404

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 211/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  T+F K        +P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTMFAKFPPA----VPDDDASADMQEWIHARTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPISTIEPALKEAERRGLIAR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|172059922|ref|YP_001807574.1| coproporphyrinogen III oxidase [Burkholderia ambifaria MC40-6]
 gi|171992439|gb|ACB63358.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria MC40-6]
          Length = 404

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 209/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTMFAKFPPA----VPDDDASADMQEWIHERTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPDHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQATAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E +       EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGPRDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|238026482|ref|YP_002910713.1| coproporphyrinogen III oxidase [Burkholderia glumae BGR1]
 gi|237875676|gb|ACR28009.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia glumae BGR1]
          Length = 406

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 123/389 (31%), Positives = 211/389 (54%), Gaps = 10/389 (2%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGP 68
            +       L +Y+H+P+CV+KCPYCDFNSH  + +   ++ ++ +   +++        
Sbjct: 20  RVRLSALPPLALYIHFPWCVRKCPYCDFNSHEWKGERFPEQEYLDALRADLEQALPFVWG 79

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R + ++F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +
Sbjct: 80  RQVHTVFIGGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRAS 139

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNR+S+G+QS  E  L+ LGR H++++A AA+ +A + F   + DL++ALP Q++ +  
Sbjct: 140 GVNRLSIGIQSFNEAHLKALGRIHDSAQARAAVEIAASRFDNFNLDLMFALPNQSLDECR 199

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            +++ AL+YA  HLSLY LT+E  T+F K        +P ++ + D+ +     T+  G 
Sbjct: 200 ADIETALAYAPPHLSLYHLTLEPNTMFAKFPPA----VPDDDASADMQDWIHERTAEAGY 255

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
             YE+S ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  
Sbjct: 256 GHYEVSAYAQPHRQCRHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQA 315

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQG 366
                   E+E +       EF++  LRL EG  V  +    G             +R+G
Sbjct: 316 MAGTPVQEERE-VGPRDLPFEFMLNTLRLVEGFPVASYAERTGLPFSTIEPALAEAERRG 374

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            I+R  F R+  T  G   L+  +  L +
Sbjct: 375 LIQR-DFERIAPTPLGQRFLND-LQELFL 401


>gi|319403535|emb|CBI77116.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 399

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 204/397 (51%), Positives = 261/397 (65%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNS+VR   V Q  F  +F  E+    +  GPR I+SIF
Sbjct: 2   TKPFGIYIHWPFCTSKCPYCDFNSYVRINGVDQPRFANAFEREITTQAKEIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +AKNWT+    EIT+EANPSSVE N F+GY+ AGVNR+SL
Sbjct: 62  IGGGTPSLMAPQTVDRLLQAVAKNWTIDDKAEITLEANPSSVEANRFRGYQLAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++L+ LGR HN  +A+ AI+LAR IFPR+SFDLIYA PKQT+ QWE EL +A+
Sbjct: 122 GVQALNDKALQQLGRLHNVKQALHAINLAREIFPRLSFDLIYARPKQTLKQWETELLQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A DHLSLYQLTIE GT F K+H  G L+LP+   A +LY LTQ IT+ +GL AYEISN
Sbjct: 182 NLAADHLSLYQLTIEDGTTFKKLHAAGKLILPASEQAANLYTLTQEITTMYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISI 297
           H+  GAES HNL YWRY +Y G GPGAH R                        R     
Sbjct: 242 HAIPGAESCHNLLYWRYHEYAGFGPGAHGRFIKQSLKNSSFFSETFPSKIENHSRYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE+WL++V   GH  ++ E LS EQQA+E L+MG+RL EG+ +  +E L+ ++L  +
Sbjct: 302 EKHPENWLELVETKGHGCIDTEHLSQEQQANEMLLMGMRLSEGLDLARYETLSCQSLSRK 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
               LQ+QG IE      L+ T  G  +LD +I  LA
Sbjct: 362 KLIRLQQQGLIEITDKQHLKATTTGRILLDHIIGQLA 398


>gi|291612876|ref|YP_003523033.1| oxygen-independent coproporphyrinogen III oxidase [Sideroxydans
           lithotrophicus ES-1]
 gi|291582988|gb|ADE10646.1| oxygen-independent coproporphyrinogen III oxidase [Sideroxydans
           lithotrophicus ES-1]
          Length = 399

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 133/389 (34%), Positives = 220/389 (56%), Gaps = 9/389 (2%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP 68
             +  Q    L +Y+H P+CV+KCPYCDFNSH  R  + ++ ++ + + +++    L   
Sbjct: 14  QAVNFQALPPLSLYIHIPWCVRKCPYCDFNSHAARGAIPEKQYVAALVRDLEMALPLIWG 73

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R + ++FFGGGTPSL+  + +A IL  +     +  N EIT+EANP +VE + F  +R+A
Sbjct: 74  RKVYTVFFGGGTPSLLSGEVLAEILRQVRMLLPLDINAEITLEANPGTVEADKFARFREA 133

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GVNR+SLG+QS  +  L+ LGR H+++EA +AI +A+  F  ++ DL+YALP+QT+ +  
Sbjct: 134 GVNRLSLGIQSFNDTHLQALGRIHSSAEARSAIGIAQQHFDNINLDLMYALPQQTLEEAL 193

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            ++Q AL Y   HLS Y LT+E  TLF          LP ++ + D+    +++ + HG 
Sbjct: 194 QDVQTALQYRPQHLSCYHLTLEPNTLFAHQPP----PLPDDDASSDMQLAIEALLATHGY 249

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
             YE S  +  G  S HNLNYW++GDY+GIG GAHS++      +  +  K P+++++ V
Sbjct: 250 QHYETSAFAQPGRRSRHNLNYWQFGDYLGIGAGAHSKLSFHDKVLRQARYKQPQAYMEAV 309

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQG 366
            +      E E ++  + A EF+M  LRL EG     ++      L          +++G
Sbjct: 310 ARGEPVQDEHE-VAHAELAFEFMMNALRLNEGFDSTLFQERTSLPLLSIRRELDAAEKRG 368

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            + +    ++  T+ G   L+ ++  L +
Sbjct: 369 LLFQ-DHKKIAPTEAGRRFLNDLL-QLFL 395


>gi|161525575|ref|YP_001580587.1| coproporphyrinogen III oxidase [Burkholderia multivorans ATCC
           17616]
 gi|189349697|ref|YP_001945325.1| coproporphyrinogen III oxidase [Burkholderia multivorans ATCC
           17616]
 gi|160343004|gb|ABX16090.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           multivorans ATCC 17616]
 gi|189333719|dbj|BAG42789.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           multivorans ATCC 17616]
          Length = 404

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 210/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEHALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS +E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT  +   +++ AL
Sbjct: 147 GIQSFDEAHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQTFDECRADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        +P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPPA----VPDDDASADMQEWIHARTAEAGYERYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++       HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHRCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEHALAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFVERTGLPISTIEPALQEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +R+  T  G   L+  +  L +
Sbjct: 381 TRIAPTPLGQRFLND-LQELFL 401


>gi|56694934|ref|YP_165279.1| coproporphyrinogen III oxidase [Ruegeria pomeroyi DSS-3]
 gi|56676671|gb|AAV93337.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Ruegeria pomeroyi DSS-3]
          Length = 385

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 174/378 (46%), Positives = 245/378 (64%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   ++ Q+ +++++++E++        R +++IFFG
Sbjct: 9   GFGLYVHWPFCQAKCPYCDFNSHVA-REIDQKAWVRAYVSELERCAAELPGRVLNTIFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A +++ + + W  S+++EIT+EANP SVE   F  YR  GVNRIS+GV
Sbjct: 68  GGTPSLMMPETVAAVIETVRRLWPTSNDMEITLEANPGSVEAGRFAAYRDGGVNRISMGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L ++ L  LGR H+ +EA AA  +AR  F R+SFDLIYA   QT   W  EL  AL+ 
Sbjct: 128 QALNDRDLHRLGRIHSVAEARAAFDIARRCFERVSFDLIYARQDQTPEAWRAELNEALAM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVA-VDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE GT F   +  G L     +    D+Y +TQ + + HGL AYE+SNH
Sbjct: 188 AVDHLSLYQLTIEDGTAFGDRYARGKLRGLPADDDAADMYLITQEVCATHGLPAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G+ES HNL YWRYGDY+GIGPGAH R+ V   R A     +P +WL      G   +
Sbjct: 248 ARPGSESRHNLIYWRYGDYVGIGPGAHGRITVDGQRFATESPLNPGAWLGA-VAKGSGEL 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  LS + QADE+LMMGLR+ EG+ +  +E L+ + L+     +L   G IE ++ +RL
Sbjct: 307 SRVALSLQDQADEYLMMGLRIAEGLDIHRYEALSPQPLNRNRLAHLTELGMIE-IEGTRL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           + T +G  +L++VI +L 
Sbjct: 366 KATAQGRAVLNAVILDLM 383


>gi|154246478|ref|YP_001417436.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Xanthobacter autotrophicus Py2]
 gi|154160563|gb|ABS67779.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Xanthobacter autotrophicus Py2]
          Length = 399

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 189/392 (48%), Positives = 255/392 (65%), Gaps = 8/392 (2%)

Query: 9   NNMTGQGSNS------LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWM 62
               G+G++        GVYVHWPFC  KCPYCDFNSHVR     +  FI +F  E+  M
Sbjct: 9   RVWAGEGASPVPDPAGFGVYVHWPFCKAKCPYCDFNSHVRHAPPDEARFIAAFRREIAHM 68

Query: 63  RQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNF 122
           R L+GP+   ++FFGGGTPSL+ P  +A IL+ I   W ++++ E+T+EANP+SVE   F
Sbjct: 69  RALSGPKQAQTVFFGGGTPSLMAPATVAAILEAINAAWPLTADAEVTLEANPTSVEAERF 128

Query: 123 QGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQ 182
            GY  AGVNR+SLGVQ+L +  L+ LGR H+ +EA+AA+ +AR  F R+SFDLIYA P+Q
Sbjct: 129 AGYGAAGVNRVSLGVQALHDADLQGLGRMHSVAEALAAVAIARRAFRRVSFDLIYARPRQ 188

Query: 183 TMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI 242
           T   W  EL+RAL+   +HLSLYQLTIE GT F +++  G L+LP ++++  L+++TQ +
Sbjct: 189 TPEGWAAELRRALAEGCEHLSLYQLTIEPGTPFERLYGAGKLILPDDDISRALWDVTQEV 248

Query: 243 TSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPE 302
           T+  GL AYE+SNH+  GAE+ HN  YWRYG Y GIG GAH R+ V   R A+  E+ PE
Sbjct: 249 TAQAGLPAYEVSNHARPGAEARHNQIYWRYGTYAGIGAGAHGRLVVDGTRRALFTERAPE 308

Query: 303 SWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL 362
            WL  V  +GH +V  E LS+ +QADE L+MGLRL+EG+ +       G  +D      L
Sbjct: 309 DWLARVEAHGHGIVSDEALSAAEQADEMLLMGLRLKEGVDLAR-HARLGGRVDEARIAAL 367

Query: 363 QRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              GF+ R    RL  T  G  +L++VIA LA
Sbjct: 368 AAAGFVTRT-GDRLAVTPAGFPVLNAVIAQLA 398


>gi|226940859|ref|YP_002795933.1| coproporphyrinogen III oxidase [Laribacter hongkongensis HLHK9]
 gi|226715786|gb|ACO74924.1| Probable porphyrin oxidoreductase [Laribacter hongkongensis HLHK9]
          Length = 406

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 134/381 (35%), Positives = 204/381 (53%), Gaps = 8/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+C+KKCPYCDFNSH  R  V +  +I + L ++     L   RS+ ++F 
Sbjct: 19  PPLSLYVHVPWCLKKCPYCDFNSHGVRGPVDEAGYIDALLADLDQSLPLVWGRSLKTVFI 78

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  +    +L G+     +    EIT+EANP + E   F+ YR AG+NR+S+G
Sbjct: 79  GGGTPSLLSAEAFDRLLSGVRARLKLDPQAEITLEANPGTAEAGRFREYRAAGINRLSIG 138

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS +++ L  LGR H+  EA  A  LA + F   + DL+YALP QT+ + + ++  A++
Sbjct: 139 IQSFDDRFLHALGRVHDGKEAHLAADLAADTFDTFNLDLMYALPGQTLAEAQADVTAAVA 198

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLS Y LT+E  TLF      G   LP ++ + D+    ++  +  G   YE S  
Sbjct: 199 HRPTHLSCYHLTLEPNTLFAAAPPAG---LPDDDTSADMQEAIEARLAEAGFCHYETSAF 255

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNLNYW +GDY+GIG GAH ++      V     K P+++L+ V +      
Sbjct: 256 ARPGFESRHNLNYWTFGDYLGIGAGAHGKISFADRIVRQMKHKQPQAYLEAVARGQAVQN 315

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           E E ++   +  EF+M  LRL  G+    +    G  L           RQG ++    +
Sbjct: 316 EHE-IAVVDRPFEFMMNALRLTGGVPTPLFSERTGVPLARISRELAEAVRQGLLD-ADPA 373

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           RL  T +G   L+ ++  L +
Sbjct: 374 RLAPTPQGQRFLNDLLT-LFL 393


>gi|114769779|ref|ZP_01447389.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
 gi|114549484|gb|EAU52366.1| coproporphyrinogen III oxidase [alpha proteobacterium HTCC2255]
          Length = 384

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 176/386 (45%), Positives = 258/386 (66%), Gaps = 3/386 (0%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M    +   G+Y+HWPFC  KCPYCDFNSHVR+  V Q  ++ +   E++     T  R+
Sbjct: 1   MDDWENGGFGIYIHWPFCAAKCPYCDFNSHVRKS-VDQSRWLSAICLELKNSAIRTRGRT 59

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           +++IFFGGGTPSL+EP+ +A I+  IAK W ++ ++EI++EANP+SVE   F  +RKAG+
Sbjct: 60  VNTIFFGGGTPSLMEPETVAGIIKEIAKLWVLALDIEISLEANPTSVEAQKFSDFRKAGI 119

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NRIS+G+QSL    L+ LGR H+ +EA  A  +A++ F R+SFDLIYA   Q+   WE+E
Sbjct: 120 NRISMGIQSLRNDDLKALGRMHSVNEARKAFDIAKDNFKRVSFDLIYARQDQSKVDWEIE 179

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLH 249
           L+ A S AVDHLSLYQLTIE GT F  +++ G L     +  A D+Y++TQ +T  + + 
Sbjct: 180 LKEASSMAVDHLSLYQLTIEDGTRFGDLYERGSLKGMPNDSLAADMYDITQEVTLQNDMP 239

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
           AYEISNH+  GAES HNL YWRYGDYIG+GPGAH R+    +++A +  ++PE+WL+ V 
Sbjct: 240 AYEISNHAIEGAESRHNLIYWRYGDYIGVGPGAHGRISENGNKIATTTIENPENWLRGVE 299

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
            NG + ++ E ++   QA E+LMM LRL EG+ ++ ++ ++G  LD +        G I+
Sbjct: 300 LNGTSTIDDEVINHIDQASEYLMMSLRLIEGVDMERYKKISGVALDNKLIDKNIENGLIK 359

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
            +  + L  TQRG  +L+++I +L +
Sbjct: 360 VINNN-LIATQRGRIILNTLIKDLLI 384


>gi|167586473|ref|ZP_02378861.1| coproporphyrinogen III oxidase [Burkholderia ubonensis Bu]
          Length = 404

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 214/382 (56%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEHALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+A++A AA+ +A N F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNETHLKALGRIHDAAQARAAVEVAANTFDNFNLDLMFALPNQTLDECRADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYERYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPHHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLIAR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|146284286|ref|YP_001174439.1| coproporphyrinogen III oxidase [Pseudomonas stutzeri A1501]
 gi|145572491|gb|ABP81597.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas stutzeri A1501]
          Length = 392

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 129/381 (33%), Positives = 207/381 (54%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L  YVH P+CV+KCPYCDFNSH     + +E ++ + L +++   +    R +SSIFF
Sbjct: 18  PPLAAYVHIPWCVRKCPYCDFNSHTAGPALPEEAYVAALLADLRADLEHVQGRRLSSIFF 77

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +A I++G+      +  +EIT+EANP + E   F+ YR+ G+NR+S+G
Sbjct: 78  GGGTPSLFSARALAAIVEGLEHLVGFADGIEITLEANPGTFEQAKFRDYRQLGINRLSIG 137

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+  EAI A  +AR   F   + DL++ LP Q++     +L+ A+
Sbjct: 138 VQSFQAAKLKALGRIHDGDEAIRAADMARAAGFENFNLDLMHGLPDQSLEDALSDLRTAI 197

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLT+E  TLF+         LP +++  D+    Q++   HG   YE S 
Sbjct: 198 AQQPTHLSWYQLTLEPNTLFWSQPPQ----LPEDDILWDIQEAGQALLGEHGYRQYETSA 253

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G ++ HNLNYW +GD++GIG GAH+++     R+  S +         +       
Sbjct: 254 YAQPGRQARHNLNYWTFGDFLGIGAGAHAKLSHADGRILRSWKTRL--PKDYLDPAKAFR 311

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
             ++ L++++   EFLM  LRL +G+    +    G  LD      R+ + +G +     
Sbjct: 312 AGEKQLTADELPFEFLMNVLRLTDGVPAVLFTQRTGLALDAIAKPRRDAEARGLLS-NDP 370

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RL  T +G   L+ ++ +  
Sbjct: 371 DRLVATPKGQLFLNDLLQSFL 391


>gi|126730099|ref|ZP_01745911.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
 gi|126709479|gb|EBA08533.1| coproporphyrinogen III oxidase [Sagittula stellata E-37]
          Length = 385

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 174/378 (46%), Positives = 232/378 (61%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   ++ Q  +  +  +E++ +   T  R + SIFFG
Sbjct: 9   GFGLYVHWPFCEAKCPYCDFNSHVV-REIDQTRWAAALASEVRRVAAETSGRVLGSIFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D     WT  +N+EIT+EANP SVE   F+GY +AGVNR+SLGV
Sbjct: 68  GGTPSLMAPETVAAVIDAARDGWTFGNNIEITLEANPRSVEAARFEGYARAGVNRVSLGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QSL E  LR LGR H+ +EA AA  +AR +F R+SFDLIYA   QT+  WE EL  AL  
Sbjct: 128 QSLREPDLRKLGRLHDVTEARAAFAIARQVFDRVSFDLIYARQGQTLAGWEEELGEALDM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE GT F+   + G L     +    D+Y LTQ + +  G+ AYE+SNH
Sbjct: 188 AVDHLSLYQLTIEPGTAFWDRSQAGKLRGLPSDDLGADMYELTQEMCARAGMPAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +   AES HNL YWRYGD++G+GPGAH R  +   R+     + P  WL  V +      
Sbjct: 248 AGADAESRHNLVYWRYGDWVGVGPGAHGRFDLNRQRMESVAWRMPGRWLTAVEEVKSGDE 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  +    QA E+LMMGLRL EG+ +     ++     ++  ++LQ    +E     RL
Sbjct: 308 LRSSVDGNDQAIEYLMMGLRLSEGLDLARLHQMSRNVATLKQIKDLQEMQLLEVY-SGRL 366

Query: 377 RCTQRGMTMLDSVIANLA 394
             T RG  +L+SVI +L 
Sbjct: 367 VATPRGRLVLNSVIESLL 384


>gi|126438587|ref|YP_001059968.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 668]
 gi|167720745|ref|ZP_02403981.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei DM98]
 gi|217420410|ref|ZP_03451915.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 576]
 gi|237813384|ref|YP_002897835.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei MSHR346]
 gi|254181026|ref|ZP_04887624.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1655]
 gi|254298854|ref|ZP_04966304.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 406e]
 gi|126218080|gb|ABN81586.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 668]
 gi|157808917|gb|EDO86087.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 406e]
 gi|184211565|gb|EDU08608.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1655]
 gi|217395822|gb|EEC35839.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 576]
 gi|237505440|gb|ACQ97758.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei MSHR346]
          Length = 405

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 211/383 (55%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPERDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTPV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +E   G +L          +++G +    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSLAAIGPALAQAEQRGLLVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|260753400|ref|YP_003226293.1| coproporphyrinogen III oxidase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552763|gb|ACV75709.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 393

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 174/380 (45%), Positives = 243/380 (63%), Gaps = 10/380 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+HWPFC+ KCPYCDFNSHVR   +    +  + L++M     LT  R +SSIFFG
Sbjct: 18  PLALYIHWPFCLAKCPYCDFNSHVRP-DIDAALWQDALLSDMAHEAALTQGRRLSSIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D   + W  +S++EIT+EANPSSVE + FQ    AGVNR+SLG+
Sbjct: 77  GGTPSLMSPETVAALIDAATRYWQPTSDIEITLEANPSSVEADRFQSLALAGVNRLSLGI 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ SL FLGR HN  EA++A+ +A+  F R+SFDLIY  P Q++  WE EL++AL++
Sbjct: 137 QALDDTSLHFLGRIHNVQEALSALDIAQKNFSRVSFDLIYGRPNQSLKDWEEELKQALAF 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             DHLSLYQLTIE+GT F+ + + G       + A DL++LT+ +T A G+ AYEISNH+
Sbjct: 197 GSDHLSLYQLTIEEGTRFHSLVRQGQFTPMDGDKAADLFDLTRDMTKAAGIPAYEISNHA 256

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
              +ES HNL YWRYGDYIGIG GAH               K PE+WL  V+K    + E
Sbjct: 257 RKNSESRHNLTYWRYGDYIGIGAGAH----GRRLNNVTIRHKKPENWLSAVQKQQQGIQE 312

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQF 373
           +  LS + QA E ++MGLRL EGI  ++ +   G +    LDI   +    QG +     
Sbjct: 313 ETPLSPKDQAIEAVLMGLRLTEGIHPENIQKRTGLDISEFLDIAAIQYYSDQGLLT-FNN 371

Query: 374 SRLRCTQRGMTMLDSVIANL 393
             LR T++G+ + D++I  +
Sbjct: 372 GLLRITEQGVLLTDALIREI 391


>gi|254461596|ref|ZP_05075012.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678185|gb|EDZ42672.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 384

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 171/378 (45%), Positives = 236/378 (62%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   ++ +  ++ ++L E+         R ++++FFG
Sbjct: 9   GFGIYVHWPFCEAKCPYCDFNSHVS-REIDEARWLNAYLCELDRAAVELSGRVVNAVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A I++ I K+W V ++ EIT+EANP SVE   F+GY   GV RIS+GV
Sbjct: 68  GGTPSLMHPDTVAAIIERIRKHWPVPNDPEITLEANPGSVEAGRFRGYADGGVTRISMGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L ++ L+ LGR H   EA  A ++AR+ F R+SFDLIYA   QT+  W+ EL  AL  
Sbjct: 128 QALNDRDLKRLGRIHTVDEAKKAFNIARSTFERVSFDLIYARQDQTLENWKKELNEALCL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A+DHLSLYQLTIEKGT F   ++ G L   P E++A D+Y+ T  +    GL  YE+SN+
Sbjct: 188 AIDHLSLYQLTIEKGTAFSARYEKGGLTGLPVEDLAADMYDATNELCERAGLFGYEVSNY 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HN+ YWRYGDY+GIGPGAH R+ V   + A    + P +WL+   +     +
Sbjct: 248 AKPGAESRHNMIYWRYGDYLGIGPGAHGRLTVDGTKYATEHFRMPSAWLENSERGKGEKI 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
               LS+  QA+E+L+MGLR+ EGI     E LAG  +D     +L     I +   + L
Sbjct: 308 RD-GLSNTDQANEYLIMGLRITEGIDRARLENLAGVPVDQSSLDHLNDLNLITQ-DGANL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L+SVI  L 
Sbjct: 366 RTTPQGRLLLNSVIGELV 383


>gi|254246046|ref|ZP_04939367.1| Coproporphyrinogen III oxidase [Burkholderia cenocepacia PC184]
 gi|124870822|gb|EAY62538.1| Coproporphyrinogen III oxidase [Burkholderia cenocepacia PC184]
          Length = 404

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 214/382 (56%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   + +++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPEADYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAVKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDTAQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTAVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 TQIAPTPLGQRFLND-LQELFL 401


>gi|293605629|ref|ZP_06688009.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
 gi|292816009|gb|EFF75110.1| coproporphyrinogen III oxidase [Achromobacter piechaudii ATCC
           43553]
          Length = 406

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 124/382 (32%), Positives = 216/382 (56%), Gaps = 8/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +  ++ +  ++++        R + S+F 
Sbjct: 30  PPLSIYVHVPWCVRKCPYCDFNSHAAPGEIPERAYLDALRSDLEQALPSIWGRQVVSVFI 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     +  + EIT+EANP + E + F+ Y  +GV R SLG
Sbjct: 90  GGGTPSLLSSAGLDELLAMLRACLNLWPDAEITMEANPGTAEASRFRDYAASGVTRFSLG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS ++  L+ LGR H+A++A AAI +A++   R++ D+++ALP QT+     +L++A+S
Sbjct: 150 IQSFDDAQLKKLGRIHDAAQARAAIDMAQHAVSRVNLDMMFALPGQTLEACVADLRQAIS 209

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLY LT+E  T+F K        LP ++ +  + +  ++  +A GL  YE+S +
Sbjct: 210 FGTEHLSLYHLTMEPNTVFAKFPPA---ELPDDDTSAAMQDAVEAELAAAGLSRYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAV 315
           +  GA   HNLNYW +GDY+GIGPGAH ++      V  +  + P+SW++     +G  +
Sbjct: 267 ARAGARCRHNLNYWEFGDYLGIGPGAHGKLSFHDRIVREARLRSPDSWMQAAMARDGSHL 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E   +  ++   EF++  LRL++G+    +    G +L           ++G ++    
Sbjct: 327 AESRQVGPDELPFEFMLNALRLKDGVPATAFNERTGLSLAAIAHQLEAASKRGLLD-ADP 385

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL+ T  G   L+  +  + +
Sbjct: 386 TRLKATPLGWRFLND-LQEMFL 406


>gi|167903811|ref|ZP_02491016.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei NCTC
           13177]
          Length = 405

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 211/383 (55%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPERDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTPV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +E   G +L          +++G +    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSLAAIGPALAQAEQRGLLVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|163745106|ref|ZP_02152466.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
 gi|161381924|gb|EDQ06333.1| coproporphyrinogen III oxidase [Oceanibulbus indolifex HEL-45]
          Length = 388

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 175/378 (46%), Positives = 249/378 (65%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV   ++ Q  +  ++L E+Q     T  R ++++FFG
Sbjct: 13  GFGLYIHWPFCEAKCPYCDFNSHVS-RQIDQSAWRDAYLAELQRAADETPGRILNAVFFG 71

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A I+  I ++W  ++++EIT+EANP SVE   F  YR+AGV+R+S+G+
Sbjct: 72  GGTPSLMDPDVVADIIAAIRRHWPTANDLEITLEANPGSVEAGRFAAYRQAGVSRVSMGI 131

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  L+ LGR H+A EA+ A  +ARN F R+SFDLIY    QT  QWE EL++ALS 
Sbjct: 132 QALNDADLKRLGRLHSADEAMTAFDIARNTFERVSFDLIYGRQDQTAAQWEAELKQALSL 191

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A+DH+SLYQLTIE+GT F   +  G L   P E++  D++ +TQ I +  G+ AYE+SNH
Sbjct: 192 AIDHISLYQLTIEQGTAFGDRYARGKLGGLPDEDLGADMFMMTQEICNEMGMPAYEVSNH 251

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GA+S HNL YWRYGDYIGIGPGAH R+ +   ++A     +P+ WL  V KN     
Sbjct: 252 ARDGAQSRHNLIYWRYGDYIGIGPGAHGRLTLNGQKLATVAYSNPQRWLDGVAKNEAEKP 311

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
               +S  +QA EFL+MGLRL+EG+ +  +  ++G  +D     +LQ  G  ER Q  RL
Sbjct: 312 RV-AISRGEQATEFLLMGLRLKEGVDLARYAAISGHAIDENAVAHLQDIGMAER-QGDRL 369

Query: 377 RCTQRGMTMLDSVIANLA 394
             + +G+ +L++VI  L 
Sbjct: 370 IVSDQGVIVLNAVIETLL 387


>gi|107022074|ref|YP_620401.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia AU 1054]
 gi|116689018|ref|YP_834641.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia HI2424]
 gi|170732307|ref|YP_001764254.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia MC0-3]
 gi|105892263|gb|ABF75428.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia cenocepacia AU 1054]
 gi|116647107|gb|ABK07748.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia cenocepacia HI2424]
 gi|169815549|gb|ACA90132.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           cenocepacia MC0-3]
          Length = 404

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 214/382 (56%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   + +++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPEADYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDTAQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTAVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 TQIAPTPLGQRFLND-LQELFL 401


>gi|313618877|gb|EFR90746.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria innocua FSL S4-378]
          Length = 385

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 107/379 (28%), Positives = 193/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMEMTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I +   + + +E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIQEILPLKNEIEFSFEANPGDLSISKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R + F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKVGFENVSIDLIFSLPGQTEADFKDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLTEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ +++N     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQENKLPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G++   ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVNKIHFKQKFGQDLDTTFAHAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|171315532|ref|ZP_02904768.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria MEX-5]
 gi|171099369|gb|EDT44107.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           ambifaria MEX-5]
          Length = 404

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 124/382 (32%), Positives = 210/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAGGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP Q++ +   +++ AL
Sbjct: 147 GIQSFNEGHLKALGRIHDTAQARAAVEIAAKTFDNFNLDLMFALPNQSLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  T+F K        +P ++ + D+       T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTMFAKFPPA----VPDDDASADMQEWIHERTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFVERTGLPIGTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|53720178|ref|YP_109164.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei K96243]
 gi|53726004|ref|YP_103674.1| coproporphyrinogen III oxidase [Burkholderia mallei ATCC 23344]
 gi|67643941|ref|ZP_00442684.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei GB8 horse 4]
 gi|121598921|ref|YP_992154.1| coproporphyrinogen III oxidase [Burkholderia mallei SAVP1]
 gi|124383729|ref|YP_001028599.1| coproporphyrinogen III oxidase [Burkholderia mallei NCTC 10229]
 gi|126448733|ref|YP_001081502.1| coproporphyrinogen III oxidase [Burkholderia mallei NCTC 10247]
 gi|166998296|ref|ZP_02264156.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei PRL-20]
 gi|167739727|ref|ZP_02412501.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 14]
 gi|167816930|ref|ZP_02448610.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 91]
 gi|167912077|ref|ZP_02499168.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 112]
 gi|254175530|ref|ZP_04882190.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei ATCC 10399]
 gi|254196044|ref|ZP_04902469.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei S13]
 gi|254202372|ref|ZP_04908735.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei FMH]
 gi|254207706|ref|ZP_04914056.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei JHU]
 gi|254356394|ref|ZP_04972670.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei 2002721280]
 gi|52210592|emb|CAH36575.1| putative coproporphyrinogen III oxidase family protein
           [Burkholderia pseudomallei K96243]
 gi|52429427|gb|AAU50020.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Burkholderia mallei ATCC 23344]
 gi|121227731|gb|ABM50249.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei SAVP1]
 gi|124291749|gb|ABN01018.1| coproporphyrinogen dehydrogenase [Burkholderia mallei NCTC 10229]
 gi|126241603|gb|ABO04696.1| coproporphyrinogen dehydrogenase [Burkholderia mallei NCTC 10247]
 gi|147746619|gb|EDK53696.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei FMH]
 gi|147751600|gb|EDK58667.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei JHU]
 gi|148025391|gb|EDK83545.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei 2002721280]
 gi|160696574|gb|EDP86544.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia mallei ATCC 10399]
 gi|169652788|gb|EDS85481.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei S13]
 gi|238525410|gb|EEP88838.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei GB8 horse 4]
 gi|243065371|gb|EES47557.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           mallei PRL-20]
          Length = 405

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 210/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPERDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++     S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRRSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTPV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +E   G +L          +++G +    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSLAAIGPALAQAEQRGLLVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|313623722|gb|EFR93868.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria innocua FSL J1-023]
          Length = 399

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 110/379 (29%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 27  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMEMTAAKGPIAPVDTVFVGGG 85

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I +   + + +E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 86  TPTTLNEAQIARLCTAIQEILPLKNEIEFSFEANPGDLSISKLQAMQNYGVNRISMGVQS 145

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R + F  +S DLI++LP QT   ++  L++AL   
Sbjct: 146 FNNELLKKIGRIHTVKDVYQSVENMRKVGFENVSIDLIFSLPGQTEADFKDTLKQALDLD 205

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 206 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLTEMEKHGRKQYEISNFAK 265

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +     I+K+ E        N     ++
Sbjct: 266 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFGPIKKYMEPLQD----NKLPTFQQ 321

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G++   ++   G++LD      +Q+   +G++E  + + 
Sbjct: 322 KELTLKEKMEEEMFLGLRKVDGVNKIHFKQKFGQDLDTTFAHAIQKTAAKGWLENNEEN- 380

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 381 VALTRSGRFLGNNVFQEFL 399


>gi|254464716|ref|ZP_05078127.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacterales bacterium Y4I]
 gi|206685624|gb|EDZ46106.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacterales bacterium Y4I]
          Length = 384

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 170/378 (44%), Positives = 237/378 (62%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   K+ Q  +++++L+E+  + +    R +++IFFG
Sbjct: 8   GFGLYVHWPFCQAKCPYCDFNSHVSA-KIDQTLWVRAYLSELDRLSEHFSGRVLNTIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A ++    + W  ++++EI++EANP SVE   F GYR AGVNR+S+G+
Sbjct: 67  GGTPSLMHPDTVAAVIARAREIWPFANDMEISLEANPGSVEAGRFAGYRDAGVNRVSMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L ++ LR LGR H+ +EA AA  +AR  F R+SFDLIY    QT+  W+ EL+ ALS 
Sbjct: 127 QALNDEDLRKLGRIHSVAEARAAFDIARECFDRVSFDLIYVRQGQTLEAWKAELKEALSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI-TSAHGLHAYEISNH 256
           A+DHLSLYQLTIE GT F   +  G L    E+       L     T+AHG+  YEISNH
Sbjct: 187 AIDHLSLYQLTIEDGTAFGDRYARGKLRGLPEDDTAADMYLATQDLTAAHGMACYEISNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDY GIGPGAH R+ +G  R A      P +WL+  +      +
Sbjct: 247 ARPGAESRHNLIYWRYGDYAGIGPGAHGRLTLGGVRYATETHLAPGAWLQAAKAGNGESL 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
               L+ E  A E+LMMG+RL EG+ +  +  L+GR+L      +L   G +   +  RL
Sbjct: 307 RV-PLTREDAAAEYLMMGMRLSEGLDMVRFSQLSGRHLPESKLNDLVDLGMVTISEK-RL 364

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L++V+ +L 
Sbjct: 365 RATAQGRAVLNAVLRDLL 382


>gi|294012807|ref|YP_003546267.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           japonicum UT26S]
 gi|292676137|dbj|BAI97655.1| oxygen-independent coproporphyrinogen III oxidase [Sphingobium
           japonicum UT26S]
          Length = 391

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 173/387 (44%), Positives = 240/387 (62%), Gaps = 10/387 (2%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
                  L +YVHWPFCV KCPYCDFNSHV R ++  + +  + L+++     L+G R +
Sbjct: 9   AAAPDEPLALYVHWPFCVSKCPYCDFNSHV-RAEIDNDAWRAALLSDLAHEAALSGGRPL 67

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
           SSIFFGGGTPSL+ P  +  ++D   + W  ++++EIT+EANPSSVE   F     AGVN
Sbjct: 68  SSIFFGGGTPSLMPPDIVEALIDAATRRWRPTNDIEITLEANPSSVEAARFADLAAAGVN 127

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLG+Q+LE+++L FLGR H+  E +AA+ +A++ F R++FDLIYA P Q++T WE EL
Sbjct: 128 RVSLGLQALEDEALHFLGRAHDVREGLAALDVAQSAFGRVNFDLIYARPDQSLTDWESEL 187

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            R LS+   HLSLYQLTIE GT F  +   G L     + A DLY  TQ++T+A GL AY
Sbjct: 188 ARGLSFGTGHLSLYQLTIEPGTRFATLAAQGRLKPADPDHAADLYEATQAMTAAAGLPAY 247

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISNH+  G ES HNL YWRYGDY+G+GPGAH         +A    + PE+W+  V +N
Sbjct: 248 EISNHARPGQESRHNLTYWRYGDYVGVGPGAH----GRRDGLATLRHRKPENWMNAVARN 303

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGF 367
           GH +  +E L    +A E L+MGLRL EG+ ++    L+       +D E    L   G 
Sbjct: 304 GHGLQGEEPLDGRDRAREALLMGLRLAEGVELERIARLSSLPVEDLVDAEAVARLAGHGL 363

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           + R +   L     GM +LD+++  + 
Sbjct: 364 V-RQEGRGLCVEPAGMLLLDAILPEIV 389


>gi|303258093|ref|ZP_07344101.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderiales bacterium 1_1_47]
 gi|302859112|gb|EFL82195.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderiales bacterium 1_1_47]
          Length = 379

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 135/379 (35%), Positives = 208/379 (54%), Gaps = 6/379 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+HWP+C+KKCPYCDFNSH  R    +  +  + +  ++          + SIFFG
Sbjct: 5   PLSLYIHWPWCLKKCPYCDFNSHGLRGPAPEALYEAAIIEGLKEQGARVQRGKLKSIFFG 64

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ I  I++    N     N+EIT+EANP + E   F+ +R+AGVNR+S+G+
Sbjct: 65  GGTPSLMAPETIGRIIEAADNNIPFHENIEITLEANPGTFEEQKFKDFREAGVNRLSIGI 124

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QS ++  LR LGR HN+ EA  A   A  IF   + DL++ LP QT+ + + EL+ A S+
Sbjct: 125 QSFDDAKLRALGRVHNSQEARRAAESAGKIFENFNLDLMFGLPGQTIQELDEELETAFSF 184

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
              HLS YQLT+E  T F K    G   +P ++V  D+ +L +  T+A G   YE+S ++
Sbjct: 185 GSTHLSCYQLTLEPNTYFAKFPPKG---IPDDDVLSDMSDLVRDKTAARGFDHYEVSAYA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G    HNLNYW +GDY  +GPGAH ++ +          + P  WL   +++   + E
Sbjct: 242 KGGYRCRHNLNYWEFGDYFAVGPGAHGKITIQGRPERFYNYRDPARWLLSFKEHQTQIAE 301

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQFSR 375
           ++ +  E    EF++  LRLREG+    +    G + D        L+ +G +      R
Sbjct: 302 RKLIDPEDLPFEFMLNALRLREGVPFDFYTERTGLDFDVIESIWTELREKGLV-CDHLKR 360

Query: 376 LRCTQRGMTMLDSVIANLA 394
           ++ T++G   L+ V+    
Sbjct: 361 IKTTEKGWLFLNEVLEAFL 379


>gi|162148169|ref|YP_001602630.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786746|emb|CAP56329.1| putative oxygen-independent coproporphyrinogen III oxidase-like
           protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 393

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 177/392 (45%), Positives = 238/392 (60%), Gaps = 11/392 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT---GPRS 70
             +  L +Y+HWPFC+ KCPYCDFNSHV R  + Q  F  +   E+          GPR 
Sbjct: 3   SDAAPLALYIHWPFCLAKCPYCDFNSHV-RDVIPQARFAAALRRELAQDAARLNADGPRR 61

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + SIFFGGGTPSL++P  +A ++      +T   ++EIT+EANP+SVE    + +R AG+
Sbjct: 62  LGSIFFGGGTPSLMDPATVAALIADATTLFTPLPDLEITLEANPTSVEAGRLRAFRDAGI 121

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+QSL++ +LR LGR H+A++AI A+ LAR +F R+SFDLIYA P Q++  W  E
Sbjct: 122 NRVSLGIQSLDDDALRLLGREHSATQAIDALDLARGLFDRISFDLIYARPGQSLPAWRAE 181

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RALS   DHLSLYQLTIE GT F  +H+ G L LP E+ A  LY  T  +   HGL  
Sbjct: 182 LDRALSLVSDHLSLYQLTIEPGTRFEGLHRQGLLALPDEDDAARLYEETAIVAGRHGLMG 241

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN++  GAES HNL YWRYGDY+GIGPGAHSR+ +     A    + PE W + V +
Sbjct: 242 YEVSNYARPGAESRHNLTYWRYGDYLGIGPGAHSRLTLDGTLHATRRHRAPEPWAERVER 301

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR----NLDIECERNLQRQG 366
            G  V++ E LS+  +A E L+MGLRL EGI    +    G      LD         +G
Sbjct: 302 QGSGVMQDETLSARDRAREMLLMGLRLSEGIPEDRFARRTGMAMADALDPAILAAALEEG 361

Query: 367 FI---ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++   E      LR T  G   L++++  L +
Sbjct: 362 YLLRDETTDGPVLRATPSGRLRLEALLGALVL 393


>gi|121603727|ref|YP_981056.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas naphthalenivorans CJ2]
 gi|120592696|gb|ABM36135.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas naphthalenivorans CJ2]
          Length = 396

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 134/388 (34%), Positives = 212/388 (54%), Gaps = 9/388 (2%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
            +       L +YVH P+C+KKCPYCDFNSH    ++ ++ +I + + +++    L   R
Sbjct: 14  TLQLAALPPLSLYVHLPWCIKKCPYCDFNSHEAPGELPEQRYIDALVADLEASLPLVWGR 73

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
           ++ SIF GGGTPSL  PQ I  +L  I     + ++ EIT+EANP + E + F+ +  AG
Sbjct: 74  TVHSIFIGGGTPSLFSPQAIDRLLGDIRARLRLEADCEITLEANPGTFEKDRFRAFCSAG 133

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR+S+GVQS ++  L+ LGR H+ ++AIAA+  A   F   + D++YALP QT+     
Sbjct: 134 VNRLSIGVQSFDDVHLKALGRVHDRAQAIAAVEEAAQAFDTFNLDIMYALPGQTLENQAQ 193

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           ++++AL+    H+S+Y LTIE  T F K       ++P E+ A  + +    +T   GL 
Sbjct: 194 DMRQALAMQPPHISIYHLTIEPNTYFAKFPP----LIPEEDTAYAMLDQITEMTEGAGLQ 249

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G    HNLNYW++GDY+GIG GAHS++      V     + P  ++    
Sbjct: 250 RYEVSAYARPGHRCFHNLNYWQFGDYLGIGAGAHSKLSFAHRVVRQVRAREPRLYMDKAL 309

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
                  E E +S      EF++  LRL++G  ++D+    G             +R+G 
Sbjct: 310 AGNAVAQETE-VSRADLPFEFMLNALRLKDGFKLQDFAEKTGLPFTAIQKGLEEAERKGL 368

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLAV 395
           IER  F   + T+RG   L+  + +L +
Sbjct: 369 IER-DFVHAKPTERGFDFLND-LQSLFL 394


>gi|16800581|ref|NP_470849.1| coproporphyrinogen III oxidase [Listeria innocua Clip11262]
 gi|16413986|emb|CAC96744.1| hemN [Listeria innocua Clip11262]
          Length = 385

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 107/379 (28%), Positives = 193/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+          + ++F GGG
Sbjct: 13  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMEMTAAKGPIAPVDTVFVGGG 71

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I +   + + +E + EANP  + ++  Q  +  GVNRIS+GVQS
Sbjct: 72  TPTTLNEAQIARLCTAIREILPLKNEIEFSFEANPGDLSISKLQAMQDHGVNRISMGVQS 131

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +   ++   R + F  +S DLI++LP QT   ++  L++AL   
Sbjct: 132 FNNELLKKIGRIHTVKDVYQSVENMRKVGFENVSIDLIFSLPGQTEADFKDTLKQALDLD 191

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    HG   YEISN + 
Sbjct: 192 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLTEMEKHGRKQYEISNFAK 251

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G +S HN+ YW    Y G G GAH  V    +          + +++ +++N     ++
Sbjct: 252 EGFQSKHNITYWSNEHYYGFGAGAHGYVGNTRYSNFG----PIKKYMEPLQENKLPTFQQ 307

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR  +G++   ++   G++LD      +Q+   +G++E  + + 
Sbjct: 308 KELTLKEKMEEEMFLGLRKVDGVNKIHFKQKFGQDLDTTFAHAIQKTTAKGWLENNEEN- 366

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 367 VALTRSGRFLGNNVFQEFL 385


>gi|206561361|ref|YP_002232126.1| coproporphyrinogen III oxidase [Burkholderia cenocepacia J2315]
 gi|198037403|emb|CAR53338.1| putative coproporphyrinogen III oxidase family protein
           [Burkholderia cenocepacia J2315]
          Length = 404

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 213/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEGHLKALGRIHDTAQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SFAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGAAVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMSTIEPALKEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 TQIAPTPLGQRFLND-LQELFL 401


>gi|313199821|ref|YP_004038479.1| oxygen-independent coproporphyrinogen iii oxidase [Methylovorus sp.
           MP688]
 gi|312439137|gb|ADQ83243.1| oxygen-independent coproporphyrinogen III oxidase [Methylovorus sp.
           MP688]
          Length = 405

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 204/384 (53%), Gaps = 9/384 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
           +    L +Y+H P+CV+KCPYCDFNSH  R  + +  ++ + + +++    L   R + S
Sbjct: 27  RNPPPLSLYIHIPWCVRKCPYCDFNSHESRNPIPESTYVDALIADLEQATPLVWGRKVRS 86

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL   ++I  IL  +     +    EIT+EANP + E   F GYR AGVNRI
Sbjct: 87  IFFGGGTPSLFSAESIDRILSHVRMLTPLEYEAEITLEANPGTFEAERFAGYRDAGVNRI 146

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS   + L+ LGR HN+ EA  A   A  IF  ++ DL+YALP+QT+ +   +++ 
Sbjct: 147 SIGIQSFNPRHLQALGRIHNSEEAQYAAEHAIKIFGNVNLDLMYALPEQTLEEALQDMRT 206

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A++    H+S Y LT+E  T FY         LP ++ +  +    + + + HG   YE 
Sbjct: 207 AIALGPTHISAYHLTLEPNTPFYYKPPA----LPDDDTSATMQEAIEHLLAEHGYSHYET 262

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S     G    HNLNYW +GDY+GIG GAHS++      +  S  K P +++K V + GH
Sbjct: 263 SAFGKAGKRCRHNLNYWVFGDYLGIGAGAHSKLSFHDRILRQSRIKQPNAYMKAVAETGH 322

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
              E+  L       EF+M  LRL EG     +  + G+ L       +  +++G I R 
Sbjct: 323 IEEER-LLDRSDLGFEFMMNALRLTEGFDPMLFTTMTGQALSTVEPALQQAEQRGLITRT 381

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +  T  G   L+ ++  L +
Sbjct: 382 -PELIAPTALGQRFLNELL-QLFL 403


>gi|300024894|ref|YP_003757505.1| oxygen-independent coproporphyrinogen III oxidase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526715|gb|ADJ25184.1| oxygen-independent coproporphyrinogen III oxidase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 474

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 255/427 (59%), Gaps = 39/427 (9%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
             +++     + S GVYVHWPFC +KCPYCDFNSHVR     +  F+ +++ E+     L
Sbjct: 39  DLQSSGLRDDAPSFGVYVHWPFCAQKCPYCDFNSHVRFGGWDEARFLAAYVREIDATADL 98

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
            G R++SSIFFGGGTPSL++P   A ILD IAK WT++ + EIT+EANP+SVE   F+G+
Sbjct: 99  IGARTVSSIFFGGGTPSLMQPATTAAILDHIAKRWTIAPDAEITLEANPNSVEAARFRGF 158

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           R+AGVNR+S+GVQSL +  LR LGR H+ +EA AA+ +A + F R SFDLIYA PKQT  
Sbjct: 159 REAGVNRVSIGVQSLRDDELRKLGRIHSVAEAKAALDVAHSTFDRFSFDLIYARPKQTPD 218

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
            W  EL  AL  A DHLSLYQLTIE  T +  +H  G LV+P ++ A  LY +T  +T+A
Sbjct: 219 AWRAELSEALDLAGDHLSLYQLTIEPDTAYAALHAKGKLVIPDDDAARALYEITDELTAA 278

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            GL AYE+SN++  G+ES HNL YWRYG+Y GIG GAH R+ V   R A   E++PE+W 
Sbjct: 279 RGLAAYEVSNYARPGSESRHNLLYWRYGEYAGIGAGAHGRIIVKGQRTATVTERNPEAWA 338

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQ 365
           + V  +G  VVE   L+ E+QADE L+MGLRL EG+ +     L G          L   
Sbjct: 339 ERVEASGTGVVESTVLTLEEQADEMLLMGLRLSEGVDLDQLAALGGVRPAAHVVGGLIAM 398

Query: 366 GFIERV---------------------------------------QFSRLRCTQRGMTML 386
           G +E V                                         SR+R T+ G  +L
Sbjct: 399 GLLEVVAASSAGRSGVVLAQDDDRDIIRGCAGPGLAPETFAAHVTSPSRIRVTRAGRLVL 458

Query: 387 DSVIANL 393
           ++V+A L
Sbjct: 459 NAVVAEL 465


>gi|300690922|ref|YP_003751917.1| coproporphyrinogen dehydrogenase [Ralstonia solanacearum PSI07]
 gi|299077982|emb|CBJ50623.1| Coproporphyrinogen dehydrogenase [Ralstonia solanacearum PSI07]
          Length = 424

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 135/386 (34%), Positives = 210/386 (54%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + +E F+ +   +++    +   R + +
Sbjct: 40  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEPGIPEERFLAAIRQDLEAALPMVWGRRVHT 99

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+    +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 100 IFIGGGTPSLLSAHGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 159

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  LR LGR H+A+EA AAI LAR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 160 SIGIQSFNDAHLRALGRIHSAAEARAAIDLARAHFDNINLDLMFALPGQTLAECEADVEA 219

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F          LP ++ A  + +   +  +  G   YE+
Sbjct: 220 ALSFDTSHVSLYHLTLEPNTYF----AKHPPALPDDDTAFAMQDWIHARLAGAGYEHYEV 275

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     KHPE++L+       
Sbjct: 276 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVIREMRHKHPETYLRQAETAGG 335

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              V E+  + +     EF++  LRL +G  V  ++   G  L          +++G + 
Sbjct: 336 AAMVQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLRSIERELDAAEQRGLLA 395

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R     +R T+ G   L+  +  L +
Sbjct: 396 R-DHVAIRPTELGQRFLND-LQALFL 419


>gi|49474877|ref|YP_032918.1| coproporphyrinogen III oxidase [Bartonella henselae str. Houston-1]
 gi|49237682|emb|CAF26869.1| Oxygen-independent coproporphyrinogen III oxidase [Bartonella
           henselae str. Houston-1]
          Length = 399

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 204/397 (51%), Positives = 264/397 (66%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+ +F  E++      GPR I SIF
Sbjct: 2   NEPFGIYIHWPFCAAKCPYCDFNSHVRLHGVDQPRFVTAFEREIETQYHKIGPRCIKSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ PQ +  +L  +A+ W +    EIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMTPQTVDALLQILARTWNIDDKAEITMEANPSSVEAERFRGYRVAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQ+L +++LR LGR H+  +A+ AI LAR IFPR+SFDLIYA P QT+ QW+ EL +A+
Sbjct: 122 GVQALNDKALRQLGRLHDVKQALHAIALARKIFPRLSFDLIYARPGQTLEQWKCELFQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F ++H  G L LP   +A DLY LTQ IT+ HGL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTAFKRLHAAGRLFLPESELAADLYQLTQEITALHGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISI 297
           H+  GAES+HNL YWRY +Y G GPGAH R                        R     
Sbjct: 242 HAISGAESVHNLLYWRYHEYAGFGPGAHGRFIEHSQNHSSASSKADPSQIENRERSVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EK+PE WL++V K GH  +E E L++EQQA+E L+MGLRL EG+ +  ++ L+ +NL +E
Sbjct: 302 EKYPEHWLELVEKTGHGCIETEQLTTEQQANEMLLMGLRLCEGLDLIRYKSLSSKNLPME 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ+QG +E V+  RL+ T +G  +LD +I  LA
Sbjct: 362 KLIDLQQQGLVEMVENQRLKATNKGRILLDYIINQLA 398


>gi|253997757|ref|YP_003049820.1| oxygen-independent coproporphyrinogen III oxidase [Methylovorus sp.
           SIP3-4]
 gi|253984436|gb|ACT49293.1| oxygen-independent coproporphyrinogen III oxidase [Methylovorus sp.
           SIP3-4]
          Length = 405

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 201/384 (52%), Gaps = 9/384 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
           +    L +Y+H P+CV+KCPYCDFNSH  R  + +  ++ + + +++    L   R + S
Sbjct: 27  RNPPPLSLYIHIPWCVRKCPYCDFNSHESRNPIPESAYVDALIADLEQATPLVWGRKVRS 86

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL   ++I  IL  +     +    EIT+EANP + E   F GYR AGVNRI
Sbjct: 87  IFFGGGTPSLFSAESIDRILSHVRMLTPLEYEAEITLEANPGTFEAERFAGYRDAGVNRI 146

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS   + L+ LGR HN+ EA  A   A  IF  ++ DL+YALP+QT+ +   ++  
Sbjct: 147 SIGIQSFNPRHLQALGRIHNSEEAQYAAEHAIKIFGNVNLDLMYALPEQTLEEALQDMHT 206

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A++    H+S Y LT+E  T FY         LP ++ +  +    + + + HG   YE 
Sbjct: 207 AIALGPTHISAYHLTLEPNTPFYYKPPA----LPDDDTSATMQEAIEHLLADHGYGHYET 262

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S     G    HNLNYW +GDY+GIG GAHS++      +  S  K P +++K       
Sbjct: 263 SAFGKAGKRCRHNLNYWVFGDYLGIGAGAHSKLSFHDRILRQSRIKQPNAYMKA-VAEMS 321

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
            V E+  L       EF+M  LRL EG   K +  + G+ L       +  +++G I R 
Sbjct: 322 HVEEERLLDRADLGFEFMMNALRLTEGFDPKLFTTMTGQALSTVDPALQQAEQRGLITRT 381

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +  T  G   L+ ++  L +
Sbjct: 382 -PELIAPTALGQRFLNELL-QLFL 403


>gi|91787237|ref|YP_548189.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas sp. JS666]
 gi|91696462|gb|ABE43291.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Polaromonas sp. JS666]
          Length = 394

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 138/399 (34%), Positives = 224/399 (56%), Gaps = 11/399 (2%)

Query: 1   MKYLSAYENN--MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTE 58
           MK +  Y  +  +       L +YVH P+C+KKCPYCDFNSH    ++ ++ ++ + + +
Sbjct: 1   MKDIQHYMRSGTLQLAALPPLSLYVHLPWCLKKCPYCDFNSHEVSGEMPEQRYLDALIAD 60

Query: 59  MQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVE 118
           ++    L   R++ SIF GGGTPSL  PQ I  +L  I     + ++ EIT+EANP + E
Sbjct: 61  LEAALPLVWGRTVHSIFIGGGTPSLFSPQAIDRLLGDIRARLRLEADCEITLEANPGTFE 120

Query: 119 VNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYA 178
            + F+ +R AGV R+S+GVQS +++ L+ LGR H+ ++AIAA+  A   F   + D++YA
Sbjct: 121 KDRFKAFRSAGVTRLSVGVQSFDDRHLKALGRVHDRAQAIAAVEEAAQAFDTFNLDIMYA 180

Query: 179 LPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNL 238
           LP QT+     ++++AL+    H+S+Y LTIE  T F K        +P E++A  + + 
Sbjct: 181 LPGQTLDNLAQDMRQALALQPPHISIYHLTIEPNTYFAKFPPA----IPEEDMAYAMLDK 236

Query: 239 TQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE 298
              +T   GL  YE+S ++  G +  HNLNYW++GDY+GIG GAH ++      V     
Sbjct: 237 ITEMTEGAGLQRYEVSAYARAGHQCFHNLNYWQFGDYLGIGAGAHGKLSFAHRVVRQVRY 296

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC 358
           + P+ +++          E E +S  +   EF++  LRLREG  ++D+    G  L    
Sbjct: 297 RDPKLYMEKALAGDAVTQETE-VSRTELPFEFMLNALRLREGFKLQDFCDKTGLPLTAIQ 355

Query: 359 --ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
                 +R+G +ER  F R++ T+RG   L+  + +L +
Sbjct: 356 QGLEEGERKGLLER-DFVRVKPTERGFDFLND-LQSLFL 392


>gi|257092564|ref|YP_003166205.1| coproporphyrinogen III oxidase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045088|gb|ACV34276.1| oxygen-independent coproporphyrinogen III oxidase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 417

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 138/401 (34%), Positives = 208/401 (51%), Gaps = 17/401 (4%)

Query: 5   SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHV---------RRYKVGQENFIQSF 55
           SA  N +  +    L +YVH P+CV+KCPYCDFNSH          R+  + + +++ + 
Sbjct: 19  SAAGNPVEFRNPPPLALYVHVPWCVQKCPYCDFNSHALPVGSSIGQRQTAIPESDYLAAL 78

Query: 56  LTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPS 115
           + +++    L   R + S+F GGGTPSL+  + +  +L  +     +  N EIT+EANP 
Sbjct: 79  IADLESALPLVWGRRVDSVFIGGGTPSLLSGEGVDELLAAVRSRLPLLPNAEITLEANPG 138

Query: 116 SVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDL 175
           +VE   F  +R AGVNR+SLG+QS   + L  LGR H+  +A  AI +A + F   + DL
Sbjct: 139 TVEAGKFAAFRAAGVNRLSLGIQSFNSRHLTALGRIHDDRDARLAIGIAASHFDNFNLDL 198

Query: 176 IYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDL 235
           +Y LP QT+ +   ++  AL+ A  HLS YQLTIE  T F          LP  +   D+
Sbjct: 199 MYGLPGQTLAEALADVDAALACAPPHLSCYQLTIEANTAFAARPPA----LPDPDTCADM 254

Query: 236 YNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAI 295
            +  ++  +A G   YEIS  +  G E  HNLNYW++GDY+GIG GAH ++ +       
Sbjct: 255 QDAIETKLAAAGYRHYEISAFARAGQECRHNLNYWQFGDYLGIGAGAHGKLTLHDRVQRQ 314

Query: 296 SIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL- 354
              K PE +L  V        E   ++  +   EF+M  LRL EG +   +EM     L 
Sbjct: 315 MRWKRPEQYLAKVAAGTPVQQEF-TVAPAELPCEFMMNALRLVEGFAAPLFEMRTALPLI 373

Query: 355 -DIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
                 R  +R G ++R Q  R+  ++RG   L+ ++    
Sbjct: 374 SIESQLRQAERDGLLQR-QGQRIAPSERGRRFLNQLVQRFL 413


>gi|186475431|ref|YP_001856901.1| coproporphyrinogen III oxidase [Burkholderia phymatum STM815]
 gi|184191890|gb|ACC69855.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           phymatum STM815]
          Length = 404

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 214/382 (56%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  +     ++ ++ +  ++++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHESKGGTFPEDEYLDALRSDLERSLPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+  + +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLMSAKGLDRLLSDVRALLPLDADAEITLEANPGTFEAEKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++++A  A+ +A N F   + DL++ALPKQT+ + + +++ AL
Sbjct: 147 GIQSFNEAHLKALGRIHDSTQARHAVEVAANTFGNFNLDLMFALPKQTLAECQADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYA  HLSLY LT+E  TLF K        LP ++ + D+ +     T   G   YE+S 
Sbjct: 207 SYAPPHLSLYHLTLEPNTLFAKFPP----PLPDDDSSADMQDWIHERTREAGYERYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  +     KHP ++++  R      
Sbjct: 263 YAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQMRYKHPATFIEEARSGNAVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E + +     EF++  LRL EG  V  +    G  +       +  +R+G I R  F
Sbjct: 323 EEHE-VGARDLPFEFMLNALRLVEGFPVHRFIERTGLPITSIEPALQEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 381 EKIAPTPLGQAFLND-LQALFL 401


>gi|78065575|ref|YP_368344.1| coproporphyrinogen III oxidase [Burkholderia sp. 383]
 gi|77966320|gb|ABB07700.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia sp. 383]
          Length = 404

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 213/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + +IF
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTIF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNETHLKALGRIHDTTQARAAVEIAAKNFDNFNLDLMFALPNQTLDECRTDVETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYA  HLSLY LT+E  TLF K       V+P ++ + D+     + T+  G   YE+S 
Sbjct: 207 SYAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHARTAEAGYGHYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTAVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V ++    G  +       +  +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHNFAERTGLPMSTIEPALQEAERRGLIAR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 AQIAPTPLGQRFLND-LQELFL 401


>gi|241663554|ref|YP_002981914.1| coproporphyrinogen III oxidase [Ralstonia pickettii 12D]
 gi|240865581|gb|ACS63242.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia
           pickettii 12D]
          Length = 422

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 134/386 (34%), Positives = 214/386 (55%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + +E F+ +   +++    +   R + +
Sbjct: 38  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEQGIPEERFLAAVRQDLEAALPMVWGRHVHT 97

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 98  IFIGGGTPSLLSAQGLDRLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 157

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 158 SIGIQSFNDAHLQALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 217

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+  +H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 218 ALSFDTNHVSLYHLTLEPNTYFAKYPPA----LPDDDAAFAMQDWIHARLAAAGYEHYEV 273

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     KHP+++L+       
Sbjct: 274 SAYAKAGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVIREMRHKHPDTYLRQAETAGG 333

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              + E+  + +     EF++  LRL +G  V  ++   G  L          +++G + 
Sbjct: 334 AAVMQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLRSIERQLDVAEQRGLLT 393

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R     +R T+ G   L+  +  L +
Sbjct: 394 R-DHVAIRLTELGQRFLND-LQELFL 417


>gi|187929361|ref|YP_001899848.1| coproporphyrinogen III oxidase [Ralstonia pickettii 12J]
 gi|309781784|ref|ZP_07676517.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia sp.
           5_7_47FAA]
 gi|187726251|gb|ACD27416.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia
           pickettii 12J]
 gi|308919425|gb|EFP65089.1| oxygen-independent coproporphyrinogen III oxidase [Ralstonia sp.
           5_7_47FAA]
          Length = 422

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 134/386 (34%), Positives = 214/386 (55%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + +E F+ +   +++    +   R + +
Sbjct: 38  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEQGIPEERFLAAVRQDLEAALPMVWGRHVHT 97

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 98  IFIGGGTPSLLSAQGLDRLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 157

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 158 SIGIQSFNDAYLQALGRIHSAAEARAAIDMARAHFDNINLDLMFALPGQTLAECEADVEA 217

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+  +H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 218 ALSFDTNHVSLYHLTLEPNTYFAKYPPA----LPDDDAAFAMQDWIHARLAAAGYEHYEV 273

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     KHP+++L+       
Sbjct: 274 SAYAKAGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVIREMRHKHPDTYLRQAETAGG 333

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              + E+  + +     EF++  LRL +G  V  ++   G  L          +++G + 
Sbjct: 334 AAVMQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLRSIERQLDAAEQRGLLT 393

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R     +R T+ G   L+  +  L +
Sbjct: 394 R-DHVAIRPTELGQRFLND-LQELFL 417


>gi|171463500|ref|YP_001797613.1| oxygen-independent coproporphyrinogen III oxidase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193038|gb|ACB43999.1| oxygen-independent coproporphyrinogen III oxidase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 393

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 133/397 (33%), Positives = 218/397 (54%), Gaps = 11/397 (2%)

Query: 4   LSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKV---GQENFIQSFLTEMQ 60
           L++  N +T      L +Y+H+P+C KKCPYCDFNSH  +       +  +I++ + +++
Sbjct: 2   LNSNSNKVTLSALPPLALYIHFPWCEKKCPYCDFNSHQIKKDKSGFDEARYIKALIADLE 61

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
                T  R + SIF GGGTPSL+  + +  +L  I     +    EIT+EANP SVE  
Sbjct: 62  TELPNTWGRQVHSIFIGGGTPSLLSAEGMDQLLCAIRARINLEPAAEITMEANPGSVEAE 121

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
            F G+ +AG+NR+SLG+QS +++ L+ LGR HN  EA  AI +A   F  ++ DL+Y LP
Sbjct: 122 KFAGFAEAGINRVSLGIQSFQDEQLKALGRIHNGEEAKCAIQIALRHFKSVNLDLMYGLP 181

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            QT+   + +++ ALS+   HLS Y LT+E  T F          LPSE+    +     
Sbjct: 182 NQTLELAKADIETALSFKTHHLSFYNLTLEPNTYFASFPPK----LPSEDEIDAIQEQNL 237

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            + +  G   YE+S ++    E  HNLNYWR+GDYIGIG GAH +V           E+ 
Sbjct: 238 DLLTKAGYQHYEVSAYAHKNQECKHNLNYWRFGDYIGIGAGAHGKVSYPDRITRQVRERQ 297

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--EC 358
           PE+++  +   G+A++E   ++++    EF++  LRL++G+    +    G  L++  + 
Sbjct: 298 PEAYMTAMESKGNALIENREIAAKDLPFEFMLNALRLKDGVDTSTFSERTGLPLNVISKG 357

Query: 359 ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
                ++G ++    +RL+ T  G+  L++ +  + +
Sbjct: 358 LGEASKKGLLDE-NPNRLKATAMGIRYLNN-LQEIFL 392


>gi|76808674|ref|YP_334428.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 1710b]
 gi|126453675|ref|YP_001067260.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 1106a]
 gi|167825333|ref|ZP_02456804.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 9]
 gi|167846835|ref|ZP_02472343.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei B7210]
 gi|167895427|ref|ZP_02482829.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei 7894]
 gi|167920051|ref|ZP_02507142.1| coproporphyrinogen III oxidase [Burkholderia pseudomallei BCC215]
 gi|226193887|ref|ZP_03789489.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pakistan 9]
 gi|242315904|ref|ZP_04814920.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1106b]
 gi|254191872|ref|ZP_04898375.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254258471|ref|ZP_04949525.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1710a]
 gi|76578127|gb|ABA47602.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1710b]
 gi|126227317|gb|ABN90857.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1106a]
 gi|157939543|gb|EDO95213.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|225934192|gb|EEH30177.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei Pakistan 9]
 gi|242139143|gb|EES25545.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1106b]
 gi|254217160|gb|EET06544.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 1710a]
          Length = 405

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 211/383 (55%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPERDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYTKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTPV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +E   G +L          +++G +    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSLAAIGPALAQAEQRGLLVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|148260690|ref|YP_001234817.1| coproporphyrinogen III oxidase [Acidiphilium cryptum JF-5]
 gi|146402371|gb|ABQ30898.1| coproporphyrinogen III oxidase, anaerobic [Acidiphilium cryptum
           JF-5]
          Length = 382

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 174/382 (45%), Positives = 239/382 (62%), Gaps = 6/382 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFC  KCPYCDFNSHV R ++ +   + + L E+ +     GPR ++SIFF
Sbjct: 2   TPLALYIHWPFCKAKCPYCDFNSHV-RERIPERRIVAALLAELDFEAARLGPRRLTSIFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P+ ++ ++    + +  + ++EIT+EANP+S+E   F+ YR+AGVNR+S+G
Sbjct: 61  GGGTPSLMAPEGVSALIARACRLFAPAPDLEITLEANPTSIEAGRFRAYREAGVNRVSIG 120

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQSL + +LRFLGR H A+EA+AA+ L R IFPR+SFDLIYA P QT+  W  EL  AL+
Sbjct: 121 VQSLNDDALRFLGREHGAAEAMAAVELGRAIFPRLSFDLIYARPGQTLAAWRAELGAALA 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             +DHLSLYQLTIE GT F   H  GD  LP ++ A  LY+ T    +  GL  YEISN+
Sbjct: 181 VGLDHLSLYQLTIEPGTRFATAHARGDFALPEDDDAAALYDATAEEAARFGLGPYEISNY 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRY DY GIG GAH R+ +G   +A    + PE W   V   GH   
Sbjct: 241 AKPGEESRHNLAYWRYRDYAGIGAGAHGRISLGGTLLATRRHRAPEEWAARVEAAGHGST 300

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
           E+  + ++++A E L+MGLRL EGI    +    GR+    LD +        G+++   
Sbjct: 301 EEIEIGADERAREALLMGLRLAEGIDRDAYAARTGRDLMDMLDPDVTAQAIEAGYLDVT- 359

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
            +R+  T  G   LDS++A L 
Sbjct: 360 PARVSATYEGRKRLDSLLAALL 381


>gi|77464802|ref|YP_354306.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides 2.4.1]
 gi|77389220|gb|ABA80405.1| putative Coproporphyrinogen III oxidase and related Fe-S
           oxidoreductases [Rhodobacter sphaeroides 2.4.1]
          Length = 385

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 178/378 (47%), Positives = 238/378 (62%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+FFG
Sbjct: 8   GFGLYLHWPFCQSKCPYCDFNSHVAAT-IDQGRWQRAYLSEIRRLGAETEGRVLNSVFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVE   F+GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMEPDLVAAILETVRATWPLANDLEVTLEANPGSVEAGRFRGYRAAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q +  W  EL  AL+ 
Sbjct: 127 QALNDADLRKLGRLHTVAEARAAFDVARTTFDRVSFDLIYARQDQPLEHWRSELTEALTM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLS+YQLT+E GT F    K G L    E   + D+Y LTQ +  A GL AYE+SNH
Sbjct: 187 AADHLSMYQLTVEDGTAFGDRFKRGKLRGLPEEELSADMYALTQDLCEAAGLPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWR GDY G+GPGAH R+   + R A    + P +WL+ V ++G    
Sbjct: 247 ARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPRAPAAWLERVERDGTGEG 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L +E  A E+LMM LRLREG+       LAGR LD     +L+  G I+     R+
Sbjct: 307 PRVRLDAEDHALEYLMMSLRLREGLDRGRHAALAGRPLDERRVADLREMGMID-TDDERI 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T  G  +L+SVI  LA
Sbjct: 366 FATTEGRMVLNSVITALA 383


>gi|295677346|ref|YP_003605870.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1002]
 gi|295437189|gb|ADG16359.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1002]
          Length = 409

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 132/382 (34%), Positives = 213/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  +     + +++ +   +++    L   R + ++F
Sbjct: 31  PPLALYVHFPWCVRKCPYCDFNSHEWKGASFPESDYLDALRADLEMALPLIWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  I     + ++ EIT+EANP + E + F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEADKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+A++A  A+ +A   F   + DL++ALPKQT+ + + +++ AL
Sbjct: 151 GIQSFNETQLKALGRIHDAAQARHAVEVAATTFDNFNLDLMFALPKQTLAECQADVETAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP ++ + D+ +     T+A G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIHQRTAAAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  V  +  KHP ++++  R      
Sbjct: 267 YARPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRIVRQARYKHPTTFIEQARAGASVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E +       EF++  LRL EG  V  +    G ++       +  +R+  I R   
Sbjct: 327 EEHE-VGPRDLPFEFMLNALRLVEGFPVHRFIERTGLSITTIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            R+  T  G   L+  +  L +
Sbjct: 385 ERIAPTPLGQAFLND-LQALFL 405


>gi|114564030|ref|YP_751544.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella frigidimarina NCIMB 400]
 gi|114335323|gb|ABI72705.1| coproporphyrinogen III oxidase, anaerobic [Shewanella frigidimarina
           NCIMB 400]
          Length = 379

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 126/383 (32%), Positives = 200/383 (52%), Gaps = 14/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L +++        R + +IF 
Sbjct: 6   PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQQYVDALLDDLKQDLAYVQGRKVHTIFI 65

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  IL+G         N+EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 66  GGGTPSLFDASQIQRILEGAQALIPFEDNIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 125

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  ++ L  LGR HN  EA   A    +  +   + DL++ LP Q+  +   ++  A 
Sbjct: 126 VQSFSKEKLNLLGRIHNEDEAKVAAEKAKQADYLSFNLDLMHGLPNQSFDEAMHDIDTAT 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 186 ALAPPHLSWYQLTIEPNTLFHSKPPQ----LPDDENLWQIYEQGQQRLAALGYEQYEISA 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSR--VKVGSHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +  +   +  V     KHP+ +L        
Sbjct: 242 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKITLPDSNRIVRTVKIKHPKGYLAA----DK 297

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERV 371
              E   +  E +  E+LM  LRL   I   ++E   G++ ++     +    +G +   
Sbjct: 298 YTFETTDVVEEDRPLEYLMNRLRLMTPIPKTEFEQRTGQSAEVVKLGMQKSIERGLLTET 357

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
           + +  + T +G   ++ +++   
Sbjct: 358 K-THWQLTSKGHMFVNDLLSQFI 379


>gi|325569967|ref|ZP_08145926.1| coproporphyrinogen dehydrogenase [Enterococcus casseliflavus ATCC
           12755]
 gi|325156934|gb|EGC69103.1| coproporphyrinogen dehydrogenase [Enterococcus casseliflavus ATCC
           12755]
          Length = 415

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 108/386 (27%), Positives = 188/386 (48%), Gaps = 10/386 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
           + + ++  Y+H PFC   C YCDFN          + +I++ L E++            +
Sbjct: 32  KSAQNISAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIEALLKEIELTLLRQPLNEAKT 90

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           I+ GGGTP+ +    +  +L G+ +     +  E T+EANP  +        +   VNR+
Sbjct: 91  IYIGGGTPTSLSANQLDRLLSGVHELLPTHTTEEFTVEANPGDLSEEKMLVLKNHQVNRL 150

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHL-ARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQ+ + + L+ +GR H A +  + I L  ++ F  ++ DLIYALP Q++  +   L 
Sbjct: 151 SMGVQTFDNRLLKKIGRKHTAEDVYSTIQLLEKHDFQNVTIDLIYALPGQSIESFRDTLT 210

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           RA+   + H ++Y L +E  T+F    + G + LPS+     +++   +  +  GL+ YE
Sbjct: 211 RAIDLGLPHYAMYSLILENKTMFMNWVRQGRMALPSQEAETQMFDEAIAAMTKAGLNQYE 270

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           ISN +  G ESLHNL YW    Y G G GA   +    ++    I+ + +   +    N 
Sbjct: 271 ISNFARTGYESLHNLVYWNNEHYFGFGAGASGYLGQTRYKNKGPIQHYLKPLQE----NQ 326

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE---RNLQRQGFIE 369
             + E E L++  Q +E L +GLR + GIS   +    G++           L ++G++ 
Sbjct: 327 LPIHEIEELTTSNQMEEELFLGLRKKVGISKIQFAEKFGKSFQEIYGSTSEQLIQKGWLA 386

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
             Q  R+  T+ GM + + V     +
Sbjct: 387 -SQGDRVFLTKAGMFIGNEVFEAFLL 411


>gi|103485753|ref|YP_615314.1| coproporphyrinogen III oxidase [Sphingopyxis alaskensis RB2256]
 gi|98975830|gb|ABF51981.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Sphingopyxis alaskensis RB2256]
          Length = 381

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 171/380 (45%), Positives = 233/380 (61%), Gaps = 10/380 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVHWPFCV KCPYCDFNSHV R  V QE +  + L +++    +   R ++SIFF
Sbjct: 3   EPLALYVHWPFCVSKCPYCDFNSHV-RDSVEQEVWRAALLADLRHEAAVLPGRRVASIFF 61

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +A ++   A  W ++ + EIT+EANP+S EV  F     AGVNR+S+G
Sbjct: 62  GGGTPSLMPAATVAAVIAEAAALWGLTDDCEITLEANPNSAEVAAFADLAAAGVNRVSIG 121

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS + Q+L FLGR H+  EA  AI +A+  F R+SFDLIYA P QT+  WE EL  AL 
Sbjct: 122 VQSFDAQALAFLGRAHSEDEARRAIAMAQEHFARVSFDLIYARPGQTLAAWEGELADALG 181

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLYQLTIE GT F+ +   G+L +P  + A DL++ TQ++T A GL  YE+SNH
Sbjct: 182 FGTGHLSLYQLTIEPGTRFWALAAKGELTIPDGDAAADLFDATQAMTRAAGLPRYEVSNH 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRY DY G+GPGAH        R A    + PE+++  V +NGH + 
Sbjct: 242 ARPGEESRHNLAYWRYADYAGVGPGAH----GRRLRQATERHRKPENFIAAVTRNGHGLK 297

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
            +  LS  ++A E ++MGLRL EG+ +   E  +G      +D +    L  QG +    
Sbjct: 298 VETDLSGRERATEAMLMGLRLTEGVDLARVEARSGLPRADFVDADAVARLAGQGLLV-AD 356

Query: 373 FSRLRCTQRGMTMLDSVIAN 392
             RL  T  G+ +LDS+++ 
Sbjct: 357 GDRLAVTGAGILLLDSILSE 376


>gi|126738499|ref|ZP_01754204.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
 gi|126720298|gb|EBA17004.1| coproporphyrinogen III oxidase [Roseobacter sp. SK209-2-6]
          Length = 384

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 179/379 (47%), Positives = 247/379 (65%), Gaps = 4/379 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   K+ QE + +++L E++        R ++SIFFG
Sbjct: 8   GFGLYVHWPFCQAKCPYCDFNSHVSA-KIDQEIWAKAYLAELERNAPALDGRVLNSIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +  +++  AK W  ++++EI++EANP SVE   F GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMHPDTVTTVIEAAAKIWPFANDIEISLEANPGSVEAGRFAGYRDAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L ++ LR LGR H+ +EA AA  +ARN F R+SFDLIYA   Q +  W+ EL  ALS 
Sbjct: 127 QALNDEDLRRLGRIHSVAEARAAFDIARNCFDRVSFDLIYARQGQDLRHWQAELTEALSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A+DHLSLYQLTIE+GT F   +  G L   P+++ A D+Y  TQ I  AHG+ AYE+SNH
Sbjct: 187 AIDHLSLYQLTIEEGTAFGDRYARGKLRDLPTDDTAADMYQATQDICDAHGMPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDY+GIGPGAH RV +   + A    K P  WL  +RK     +
Sbjct: 247 AREGAESRHNLIYWRYGDYLGIGPGAHGRVTLAGRKYATETHKAPGKWLDQIRKGSGESL 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             E L+   Q+ E++MM +RL EG+ +  ++ L+G  L  E  ++L   G +  +   R+
Sbjct: 307 R-EELTFVDQSIEYMMMSMRLSEGMDIPRYQQLSGSELPAERVQDLVNLGMVT-ISDQRI 364

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T +G ++L++V+  L V
Sbjct: 365 RATAQGRSVLNAVLRELLV 383


>gi|167580994|ref|ZP_02373868.1| coproporphyrinogen III oxidase [Burkholderia thailandensis TXDOH]
          Length = 405

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 125/383 (32%), Positives = 210/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPEHDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LTFAPPHLSLYHLTLEPNTYFAKFPPA----VPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGAAV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +    G +L          Q++G I    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPTHSFAERTGMSLASIGPALAQAQQRGLIVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|116872907|ref|YP_849688.1| coproporphyrinogen III oxidase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741785|emb|CAK20909.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 385

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 106/388 (27%), Positives = 194/388 (50%), Gaps = 10/388 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M    + S  VY+H PFC   C YCDFN          + ++   + EM+          
Sbjct: 4   MNQSSNESSAVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMELTAAKGPIAP 62

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + ++F GGGTP+ +    IA +   I     +  ++E + EANP  + ++  Q  +  GV
Sbjct: 63  VDTVFVGGGTPTTLNEAQIARLCTAIQDILPLKKDIEFSFEANPGDLSLSKVQTMQDHGV 122

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEM 189
           NRIS+GVQS   + L+ +GR H   +   ++   R I F  +S DLI++LP Q    ++ 
Sbjct: 123 NRISMGVQSFNNELLKKIGRIHTVKDVYQSVENMRKIGFENVSIDLIFSLPGQKEADFKD 182

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
            L++A+   + H S Y L IE  T+FY + + G L LP ++   ++Y+L  +    +   
Sbjct: 183 TLKQAIDLDLPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLNEMEKNNRK 242

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YEISN +  G +S HN+ YW    Y G G GAH  +    +          + +++ ++
Sbjct: 243 QYEISNFAKEGFQSKHNITYWSNEHYYGFGAGAHGYIGDTRYSNFG----PIKKYMEPLQ 298

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QG 366
           +N     +++ L+ +++ +E + +GLR  +G++   ++   G+NLD    + +++   +G
Sbjct: 299 ENQLPTFQQKELTLKEKMEEEMFLGLRKVDGVNKIHFKQKFGQNLDTTFAKAIEKTTAKG 358

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++E  Q + +  T+ G  + ++V     
Sbjct: 359 WLENNQEN-VALTRSGRFLGNNVFQEFL 385


>gi|56550908|ref|YP_161747.1| coproporphyrinogen III oxidase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56542482|gb|AAV88636.1| oxygen-independent coproporphyrinogen III oxidase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 393

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 173/380 (45%), Positives = 242/380 (63%), Gaps = 10/380 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+HWPFC+ KCPYCDFNSHVR   +    +  + L++M     LT  R +SSIFFG
Sbjct: 18  PLALYIHWPFCLAKCPYCDFNSHVRP-DIDAALWQDALLSDMAHEAALTQGRRLSSIFFG 76

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D   + W  +S++EIT+EANPSSVE + FQ    AGVNR+SLG+
Sbjct: 77  GGTPSLMSPETVAALIDAATRYWQPTSDIEITLEANPSSVEADRFQSLALAGVNRLSLGI 136

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L++ SL FLGR HN  EA++A+ +A+  F R+SFDLIY  P Q++  WE EL++AL++
Sbjct: 137 QALDDTSLHFLGRIHNVQEALSALDIAQKNFSRVSFDLIYGRPNQSLKDWEEELKQALAF 196

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             DHLSLYQLTIE+GT F+ + + G       + A DL++LT+ +T A G+ AYEISNH+
Sbjct: 197 GSDHLSLYQLTIEEGTRFHSLVRQGQFTPMDGDKAADLFDLTRDMTKAAGIPAYEISNHA 256

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
              +ES HNL YWRYGDYIGIG GAH               K PE+WL  V+K    + E
Sbjct: 257 RKNSESRHNLTYWRYGDYIGIGAGAH----GRRLNNVTIRHKKPENWLSAVQKQQQGIQE 312

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQF 373
           +  LS + QA E ++MGLRL EGI  ++ +   G +    LD+   +    QG +     
Sbjct: 313 ETPLSPKDQAIEAVLMGLRLTEGIHSENIQKRTGLDISEFLDLAAIQYYSDQGLLT-FNN 371

Query: 374 SRLRCTQRGMTMLDSVIANL 393
             LR T +G+ + D++I  +
Sbjct: 372 GLLRITAQGVLLTDALIREI 391


>gi|307730702|ref|YP_003907926.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1003]
 gi|307585237|gb|ADN58635.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1003]
          Length = 409

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 212/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   + +++ +   +++    L   R + ++F
Sbjct: 31  PPLSLYVHFPWCVRKCPYCDFNSHEWKGETFPENDYLDALRADLEMALPLVWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++ +A  A+ +A   F   + DL++ALP+QT+ + E +++ AL
Sbjct: 151 GIQSFNEAHLKALGRIHDSKQARQAVEVAATTFDNFNLDLMFALPQQTLAECEADVETAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+   HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S 
Sbjct: 211 SFEPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIHERTSAAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 267 YAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPATFIEQAKAGAAVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E +S+     EF++  LRL EG  V  +    G  +       +  +R+  I R   
Sbjct: 327 EEHE-VSARDLPFEFMLNALRLMEGFPVHRFIERTGLPMTSIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 385 EKIAPTPLGQAFLND-LQALFL 405


>gi|89067429|ref|ZP_01154942.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
 gi|89046998|gb|EAR53052.1| coproporphyrinogen III oxidase [Oceanicola granulosus HTCC2516]
          Length = 369

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 181/372 (48%), Positives = 243/372 (65%), Gaps = 6/372 (1%)

Query: 24  HWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSL 83
           HWPFC  KCPYCDFNSHV    + Q  + ++  +E+   R+ TGPR + S+FFGGGTPSL
Sbjct: 2   HWPFCQAKCPYCDFNSHVV-SGIDQTRWARALASEIARYREETGPRLLRSVFFGGGTPSL 60

Query: 84  IEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQ 143
           + P+ +  +L  + + W + ++ E+T+EANP+SVE   F+GYR AGVNR+SLGVQ+L + 
Sbjct: 61  MLPETVDTVLQAVRRAWPMVNDPEVTLEANPTSVEAGRFRGYRDAGVNRVSLGVQALNDA 120

Query: 144 SLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLS 203
            LR LGR H+  EA AA  LAR++FPR+SFDLIYA   Q +  W  EL++AL+ AVDHLS
Sbjct: 121 DLRRLGRLHDMREARAAFELARDVFPRVSFDLIYARQDQELAAWRAELEQALTMAVDHLS 180

Query: 204 LYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAE 262
           LYQLTIE+GT F   ++ G L   P+E+ AVDL+ +TQ + +A G+  YE+SNH+   AE
Sbjct: 181 LYQLTIEEGTAFGDRYRAGKLAGLPNEDRAVDLWEVTQEVCAAAGMENYEVSNHARPEAE 240

Query: 263 SLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLS 322
           S HNL YWRYGDY+G+GPGAH R+ V   R+A    + P +WL  V   GH  V +E L 
Sbjct: 241 SRHNLVYWRYGDYVGVGPGAHGRITVDGRRIATEALRAPGAWLAQVEATGHGDVAREALD 300

Query: 323 SEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRG 382
           +E Q  E L+MG+RLREG+ +   E L     D+   R L   GF+E     RLR T  G
Sbjct: 301 AEAQLAEVLLMGMRLREGVDLARVEAL---GFDVAAARGLVDGGFVELT-GGRLRLTPAG 356

Query: 383 MTMLDSVIANLA 394
             +L+ V+  L 
Sbjct: 357 WPVLNGVLRELL 368


>gi|134295023|ref|YP_001118758.1| coproporphyrinogen III oxidase [Burkholderia vietnamiensis G4]
 gi|134138180|gb|ABO53923.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia vietnamiensis G4]
          Length = 404

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 210/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   +  ++ +   +++    L   R + ++F
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKGERFPETEYLDALRADLEQALPLVWGRQVHTVF 86

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 87  IGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 146

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+ ++A AA+ +A   F   + DL++ALP QT+ +   +++ AL
Sbjct: 147 GIQSFNEGHLKALGRIHDTAQARAAVEIAAQTFDNFNLDLMFALPNQTLAECRADIETAL 206

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           SYA  HLSLY LT+E  TLF K       V+P ++ + D+       T+  G   YE+S 
Sbjct: 207 SYAPPHLSLYHLTLEPNTLFAKFPP----VVPDDDASADMQEWIHERTAEAGYGRYEVSA 262

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 263 YAKPNHQCKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAMAGTPVQ 322

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G  +          +R+G I R  F
Sbjct: 323 EERE-VGARDLPFEFMLNTLRLVEGFPVHSFAERTGLPMGTIEPALNEAERRGLITR-DF 380

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +++  T  G   L+  +  L +
Sbjct: 381 TQIAPTPLGQRFLND-LQELFL 401


>gi|163732968|ref|ZP_02140412.1| coproporphyrinogen III oxidase [Roseobacter litoralis Och 149]
 gi|161393503|gb|EDQ17828.1| coproporphyrinogen III oxidase [Roseobacter litoralis Och 149]
          Length = 385

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 174/378 (46%), Positives = 239/378 (63%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWP+C  KCPYCDFNSHV   ++ Q  +  ++L E++     T  R + S+FFG
Sbjct: 9   GFGLYIHWPYCEAKCPYCDFNSHVV-RQIDQAAWRDAYLVELRRAAAETRGRVLRSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A ++  I   W V++++EIT+EANPSSVE   F  +R+ G+ RIS+G+
Sbjct: 68  GGTPSLMDPDTVADVIREIRALWPVANDLEITLEANPSSVEAGRFAAFREGGITRISMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H   EA  A  +AR+ F R+SFDLIYA   Q++  WE EL++AL  
Sbjct: 128 QALNDDDLRRLGRIHTVKEAQTAFDIARSTFERVSFDLIYARQGQSLQAWEQELKQALDM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE+GT F   +  G L   P E+++ DLY LTQ +  + G+  YE+SNH
Sbjct: 188 AVDHLSLYQLTIEQGTAFGDRYNAGKLRDLPDEDLSADLYTLTQDLCGSAGMPGYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GA+S HNL YWRYGDY+GIGPGAH R+     R A     +P  WL  V     A  
Sbjct: 248 ARDGAQSRHNLIYWRYGDYLGIGPGAHGRLTANRQRWATECHSNPNRWLNSVT-GKDAEK 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L+S+ QA EFL+MGLRL+EGI    +E L+G+ LD     +L   G I   +  RL
Sbjct: 307 PRAALTSQDQASEFLLMGLRLKEGIDKNRYETLSGKPLDANAISDLVNLGMISDSEN-RL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
               +G  +L++VI+ L 
Sbjct: 366 VVLDQGFIVLNAVISRLL 383


>gi|260431970|ref|ZP_05785941.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415798|gb|EEX09057.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 384

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 178/378 (47%), Positives = 239/378 (63%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV R  + Q+ ++ ++L+E++     T  R +++IFFG
Sbjct: 9   GFGLYVHWPFCEAKCPYCDFNSHVSRN-IDQQQWLDAYLSELKRSAAETPDRVLNTIFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D     W  ++++EIT+EANP SVE   F  YR AGVNRIS+G+
Sbjct: 68  GGTPSLMAPETVAAVIDTARSLWRPANDMEITLEANPGSVEAGRFAAYRDAGVNRISMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q++ ++ LR LGR H  +EA AA  +AR  F R+SFDLIYA   QT+  W  EL  ALS 
Sbjct: 128 QAMNDEDLRRLGRIHTVAEARAAFDIARTCFDRVSFDLIYARQYQTLEDWRAELTEALSM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVA-VDLYNLTQSITSAHGLHAYEISNH 256
           A+DHLSLYQLTIE GT F   +  G L    E+    D+Y  TQ I  AHG+ AYE+SNH
Sbjct: 188 AIDHLSLYQLTIEAGTAFGDRYSVGKLRGLPEDDNAADMYLATQEICEAHGMPAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDY+GIGPGAH R+ V   R+A      P +WL  V +     +
Sbjct: 248 AVPGAESRHNLIYWRYGDYVGIGPGAHGRITVNGQRIATETHLAPRAWLDAVAQGNGEKL 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
               L+ ++Q+ E+LMM +RL EG+ +  +  LAGR+L       LQ  G I + +  RL
Sbjct: 308 RV-PLAPDEQSSEYLMMCIRLAEGLDIDRFHALAGRSLPQRKLDYLQEIGMITQQEN-RL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T  G  +L++VI  L 
Sbjct: 366 AATADGRAVLNAVIRELL 383


>gi|71909464|ref|YP_287051.1| coproporphyrinogen III oxidase [Dechloromonas aromatica RCB]
 gi|71849085|gb|AAZ48581.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Dechloromonas aromatica RCB]
          Length = 399

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 135/391 (34%), Positives = 214/391 (54%), Gaps = 8/391 (2%)

Query: 6   AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL 65
           +  +++  + S  L +YVH P+CV+KCPYCDFNSH     + +  ++ + + ++Q    L
Sbjct: 15  SVSSSLEFRVSPPLALYVHVPWCVQKCPYCDFNSHEANGTIPEREYVDALIADLQSALPL 74

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R + S+FFGGGTPSL+ P  +  ++        ++ + EIT+EANP +VE   F G+
Sbjct: 75  IWGRPVVSVFFGGGTPSLLSPAAVDELIATFRALAMLAPDAEITLEANPGTVEAEKFAGF 134

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMT 185
           R AGVNR+SLG+QS  ++ L+ LGR H A EA  A  LA   F   + DL+Y LP QT  
Sbjct: 135 RSAGVNRLSLGIQSFNDEHLQALGRIHGAEEAKRAAQLAGEHFDSFNLDLMYGLPGQTHE 194

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
           Q   +++ ALS++  HLS YQLT+E  T F     +    LP  ++  D+    ++  +A
Sbjct: 195 QALSDVETALSFSPSHLSCYQLTLEPNTRFAAFPPE----LPESDICADMQESIEARLAA 250

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YE S  +  G +  HNLNYW +GDY+GIG GAHS++ +    +     KHP+++L
Sbjct: 251 AGFSNYETSAFAQRGKQCKHNLNYWYFGDYLGIGAGAHSKLTLHDRVLRQMRWKHPKAYL 310

Query: 306 KMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQ 363
           +   ++GHAV E   +       EF+M  LRL +G     +E    ++L+  +   +  +
Sbjct: 311 E-NIRSGHAVQEDNQVEVASLPFEFMMNALRLADGFHPSLFEARTAQSLNRVLPQMKAAE 369

Query: 364 RQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
             G +  V   ++  T +G   L+ ++    
Sbjct: 370 SDGLL-IVGPEKIAPTAKGRRFLNVLLERFL 399


>gi|326403884|ref|YP_004283966.1| putative coproporphyrinogen III oxidase [Acidiphilium multivorum
           AIU301]
 gi|325050746|dbj|BAJ81084.1| putative coproporphyrinogen III oxidase [Acidiphilium multivorum
           AIU301]
          Length = 382

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 174/382 (45%), Positives = 240/382 (62%), Gaps = 6/382 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFC  KCPYCDFNSHV R ++ +   + + L E+ +     GPR ++SIFF
Sbjct: 2   TPLALYIHWPFCKAKCPYCDFNSHV-RERIPERRIVAALLAELDFEAARLGPRRLTSIFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P++++ ++    + +  + ++EIT+EANP+S+E   F+ YR+AGVNR+S+G
Sbjct: 61  GGGTPSLMAPESVSALIARSCRLFAPAPDLEITLEANPTSIEAGRFRAYREAGVNRVSIG 120

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQSL + +LRFLGR H A+EA+AA+ L R IFPR+SFDLIYA P QT+  W  EL  AL+
Sbjct: 121 VQSLNDDALRFLGREHGAAEAMAAVELGRAIFPRLSFDLIYARPGQTLAAWRAELGAALA 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             +DHLSLYQLTIE GT F   H  GD  LP ++ A  LY+ T    +  GL  YEISN+
Sbjct: 181 VGLDHLSLYQLTIEPGTRFATAHARGDFALPEDDDAAALYDATAEEAARFGLGPYEISNY 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRY DY GIG GAH R+ +G   +A    + PE W   V   GH   
Sbjct: 241 AKPGEESRHNLAYWRYRDYAGIGAGAHGRISLGETLLATRRHRAPEEWAARVEAAGHGST 300

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
           E+  + ++++A E L+MGLRL EGI    +    GR+    LD +        G+++   
Sbjct: 301 EEIEIGADERAREALLMGLRLAEGIDRDAYAARTGRDLMDMLDPDVTAQAIEAGYLDVT- 359

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
            +R+  T  G   LDS++A L 
Sbjct: 360 PARVSATYEGRKRLDSLLAALL 381


>gi|152980187|ref|YP_001353024.1| coproporphyrinogen III oxidase [Janthinobacterium sp. Marseille]
 gi|151280264|gb|ABR88674.1| oxygen-independent coproporphyrinogen III oxidase
           [Janthinobacterium sp. Marseille]
          Length = 414

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 130/388 (33%), Positives = 215/388 (55%), Gaps = 9/388 (2%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
            ++      L +YVH+P+CVKKCPYCDFNSH       ++ ++ +   +++    L   R
Sbjct: 32  ALSLTALPPLSLYVHFPWCVKKCPYCDFNSHEATGGFPEDEYLSALRADLEMALPLIWGR 91

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            I +IF GGGTPSL+    +  +L  I     +   VEIT+EANP + E   F+ YR +G
Sbjct: 92  KIYTIFIGGGTPSLLSAAGLDRLLSDIRTLLPLDGAVEITMEANPGTFEAEKFKSYRASG 151

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           +NR+S+G+QS   + L  LGR HN  EA  A+ +A + F   + DL+YALP QT+ +  +
Sbjct: 152 INRLSIGIQSFNSRHLDALGRIHNGDEAQRAVDIAASNFDNFNLDLMYALPSQTLDEARL 211

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           ++Q A++YA  HLSLY LT+E  T+F K       V+P ++ + D+ ++ +  T A G  
Sbjct: 212 DVQTAIAYAPPHLSLYHLTMEPNTVFAKYPP----VVPDDDASADMQDMIEQETGAAGYQ 267

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++    ++ HNLNYW++GDY+GIG GAH+++      +  +  K P+S+++ +R
Sbjct: 268 HYEVSAYAQPKRQARHNLNYWQFGDYLGIGAGAHTKLSFPHRVIRQARYKQPKSYMEQMR 327

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                  EKE ++  +   EF++  +RL EG+ V  +    G  L+         + +G 
Sbjct: 328 LGNPIQEEKE-ITRSELGFEFMLNAMRLVEGVEVNMFAERTGMPLNAVERALNEAEAKGL 386

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLAV 395
           + R     ++ T  G   L+  +  + +
Sbjct: 387 LYR-DHKTIKPTVLGQRFLND-LQEMFL 412


>gi|99082710|ref|YP_614864.1| coproporphyrinogen III oxidase [Ruegeria sp. TM1040]
 gi|99038990|gb|ABF65602.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Ruegeria sp. TM1040]
          Length = 384

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 179/378 (47%), Positives = 246/378 (65%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV   ++ Q  ++ ++  E++ M +L   R ++SIFFG
Sbjct: 8   GFGLYVHWPFCQAKCPYCDFNSHVV-SQIDQSAWVTAYQAELRRMGELLPDRLLNSIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P  +A +++   +NWT ++++EI++EANP SVE   F GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMHPDTVAAVIEAARENWTFANDIEISLEANPGSVEAGRFAGYRDAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L ++ LR LGR H+  EA  A  +ARN F R+SFDLIYA   QT+  W+ EL  ALS 
Sbjct: 127 QALNDEDLRRLGRIHSVEEARKAFDVARNCFDRVSFDLIYARQGQTLNAWKAELSEALSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A+DHLSLYQLTIE GT F   +  G L   P+++ A D+Y  TQ I   +GL  YEISNH
Sbjct: 187 AIDHLSLYQLTIEDGTAFGDRYARGKLRDLPTDDHAADMYLATQEICELYGLPGYEISNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDY+GIGPGAH R+ +   R A    + P +WL    + G+ ++
Sbjct: 247 ARPGAESRHNLIYWRYGDYVGIGPGAHGRITLNGTRFATEAPRAPGAWLSA-VEQGNGLL 305

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             + L+SE Q +E +MMGLRL EG+ +     LA + L     + L   G ++ +  SRL
Sbjct: 306 PFDALNSEDQVNEHMMMGLRLFEGVDLDRHTALAQKPLSPSKIQELCNLGMLD-LDGSRL 364

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L++V+  L 
Sbjct: 365 RATSQGRAVLNAVLRELL 382


>gi|209519148|ref|ZP_03267953.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           H160]
 gi|209500448|gb|EEA00499.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           H160]
          Length = 409

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 212/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   + +++++   +++    L   R + ++F
Sbjct: 31  PPLALYVHFPWCVRKCPYCDFNSHEWKGETFPEGDYLEALRADLEMALPLIWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  I     + ++ EIT+EANP + E + F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDSMLSDIRALLPLDADAEITLEANPGTFEADKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H+A++A  A+ +A   F   + DL++ALP QT+ + + +++ AL
Sbjct: 151 GIQSFNEAHLKALGRIHDAAQARHAVEVAATTFDNFNLDLMFALPGQTLAECQADVETAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP ++ + D+ +     T+  G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIHQRTAEAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  V  +  KHP ++++  R      
Sbjct: 267 YARPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRIVRQARYKHPTTFIEQARAGASVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E +       EF++  LRL EG  V  +    G ++          +R+  I R   
Sbjct: 327 EEHE-VGPRDLPFEFMLNALRLVEGFPVHRFIERTGLSITTIEAALEEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            R+  T  G   L+  +  L +
Sbjct: 385 ERIAPTPLGQAFLND-LQALFL 405


>gi|17546880|ref|NP_520282.1| coproporphyrinogen III oxidase [Ralstonia solanacearum GMI1000]
 gi|17429180|emb|CAD15868.1| putative cog0635, coproporphyrinogen III oxidase and related fe-s
           oxidoreductases oxidoreductase protein [Ralstonia
           solanacearum GMI1000]
          Length = 424

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 133/386 (34%), Positives = 212/386 (54%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + ++ F+ +   +++    +   R + +
Sbjct: 40  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPEAGIPEDRFLAAIRQDLEAALPMVWGRRVHT 99

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  + +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 100 IFIGGGTPSLLSARGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 159

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 160 SIGIQSFNDTHLQALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 219

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F          LP ++ A  + +   +  +A G   YE+
Sbjct: 220 ALSFGTSHVSLYHLTLEPNTYF----AKHPPALPDDDTAFAMQDWIHARLAAAGYEHYEV 275

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     KHPE++L+       
Sbjct: 276 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVIRDMRHKHPETYLRQAETAGG 335

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              V E+  + +     EF++  LRL +G  V  ++   G  L          +R+G + 
Sbjct: 336 ATVVQEQREVDAADLPFEFMLNALRLTDGFPVTLFQERTGLPLRGIERELDAAERRGLLV 395

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
               + +R T+ G   L+  +  L +
Sbjct: 396 H-DHATIRPTELGQRFLND-LQALFL 419


>gi|167619071|ref|ZP_02387702.1| coproporphyrinogen III oxidase [Burkholderia thailandensis Bt4]
          Length = 405

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 209/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPEHDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LTFAPPHLSLYHLTLEPNTYFAKFPPA----VPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYW +GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQSKHNLNYWCFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGAAV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +    G +L          Q++G I    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPTHSFAERTGMSLASIGPALAQAQQRGLIVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|289434758|ref|YP_003464630.1| oxygen-independent coproporphyrinogen III oxidase [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
 gi|289171002|emb|CBH27544.1| oxygen-independent coproporphyrinogen III oxidase [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
          Length = 384

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EMQ          I ++F GGG
Sbjct: 12  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMQITAANKQMEPIDTVFVGGG 70

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I + + +   VE + EANP  + V   Q  +  GVNRIS+GVQS
Sbjct: 71  TPTTLNEAQIAKLCTAIQEIFPMKEEVEFSFEANPGDLSVAKVQTMKDYGVNRISMGVQS 130

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
                L+ +GR H   +   ++   R + F  +S DLI++LP QT   ++  L +AL+  
Sbjct: 131 FNNDLLKKIGRIHTVKDVYQSVENMRTVGFENVSIDLIFSLPGQTEADFQDTLNQALALD 190

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L       HG   YEISN + 
Sbjct: 191 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLVEMEKHGRKQYEISNFAK 250

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HN+ YW    Y G G GAH  +    +          + +++ +++N   V ++
Sbjct: 251 EGFESKHNITYWSNEHYYGFGAGAHGYIGNTRYSNFG----PIKKYMEPLQENKLPVFQQ 306

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR   G+S   ++   G++LD   +  +Q+   +G++E  + + 
Sbjct: 307 KELTLKEKMEEEMFLGLRKVSGVSKARFQRKFGQDLDATFQNAIQKTMAKGWLENNEEN- 365

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 366 VALTRNGRFLGNNVFQEFL 384


>gi|308050659|ref|YP_003914225.1| coproporphyrinogen III oxidase, anaerobic [Ferrimonas balearica DSM
           9799]
 gi|307632849|gb|ADN77151.1| coproporphyrinogen III oxidase, anaerobic [Ferrimonas balearica DSM
           9799]
          Length = 379

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 133/381 (34%), Positives = 207/381 (54%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C +KCPYCDFNSH R+  + ++ +I + L ++     L   R ++SIF 
Sbjct: 4   PPLSLYIHIPWCEQKCPYCDFNSHARKGAIPEQEYIAALLADLDRDLALAQGRMLTSIFI 63

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSLI P  IA +L G+A+    +   E+T+EANP ++E + F+ YR+AGVNR+S+G
Sbjct: 64  GGGTPSLISPAGIASLLSGVAERLPFAPQCEVTMEANPGTLEADRFRPYREAGVNRLSVG 123

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS ++  L  LGR H A EA  A + AR   F R + DL++ LP Q++T    +L++A+
Sbjct: 124 VQSFQQDKLLILGRIHGAEEARRAANEARKAGFERFNLDLMHTLPGQSVTDALYDLEQAI 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  T F     +    LP ++    ++   +++  A G   YEIS 
Sbjct: 184 ALKPPHLSWYQLTIEPNTQFASKPPE----LPDDDTQWAIFEQGKAMLEAAGYRQYEISA 239

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            +  G +  HNLNYWR+GDY+GIG GAH ++        +      +     +      +
Sbjct: 240 WAQPGYQCEHNLNYWRFGDYLGIGCGAHGKITQPDG--TLLRTVKVKHPKGYLEPGRDPM 297

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
            E+  +  E QA E+ M  LRL E + + +         D          ++G IER   
Sbjct: 298 AEQYSVEREDQALEYYMNRLRLMEPMPLSELSERTQLTPDDVAKPLNWALQRGLIER-DN 356

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            +++ T++G   L+ ++A   
Sbjct: 357 QQMQLTEQGHRFLNELLAQFL 377


>gi|83950769|ref|ZP_00959502.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
 gi|83838668|gb|EAP77964.1| coproporphyrinogen III oxidase [Roseovarius nubinhibens ISM]
          Length = 385

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 183/378 (48%), Positives = 249/378 (65%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV    + Q+ +++S+L E++    L   R ++SIFFG
Sbjct: 9   GFGIYVHWPFCQSKCPYCDFNSHVTAS-IDQDAWLESYLAEIKRYSDLLPGRVVNSIFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +  ++D I K WT++++VEIT+EANP SVE   F GYR+AGVNRIS+G+
Sbjct: 68  GGTPSLMQPHVVGGVIDAIGKGWTLANDVEITLEANPGSVEAGRFLGYREAGVNRISMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H+ SEA+ A  +AR+ F R+SFDLIYA   QT+  WE EL RAL+Y
Sbjct: 128 QALNDPDLRRLGRLHSVSEALQAFDVARSTFSRVSFDLIYARQDQTLADWEAELTRALTY 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVA-VDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE+GT F   +  G L     + +  D+Y+LTQ+I + HG+ AYEISNH
Sbjct: 188 AVDHLSLYQLTIEQGTAFGDRYNRGLLKGLPADDSAADMYDLTQTICADHGMPAYEISNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GA+S HNL YWRYGDY+GIGPGAH R+ VG  + A    + P  WL  V+       
Sbjct: 248 AGPGAQSRHNLIYWRYGDYVGIGPGAHGRITVGGRKFATEAHRAPGKWLAEVKNGSGDSA 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           + E +   +Q  E+L+M LRL EG+    +  LA R+   +    L+  G I       L
Sbjct: 308 KNEVIGP-EQGLEYLLMCLRLTEGLDRDRYRTLAQRDFAPDTLAELRDMGMIV-ADDQNL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T++G  +L++++A LA
Sbjct: 366 RLTEKGRPVLNAILAELA 383


>gi|332559698|ref|ZP_08414020.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
 gi|332277410|gb|EGJ22725.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides WS8N]
          Length = 385

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 173/378 (45%), Positives = 230/378 (60%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+FFG
Sbjct: 8   GFGLYLHWPFCQSKCPYCDFNSHVAAT-IDQGRWQRAYLSEIRRLGTETEGRVLNSVFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVE   F+GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMEPDLVAAILETVRTTWPLANDLEVTLEANPGSVEAGRFRGYRAAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H  +EA AA  +AR  F R+SFDLIYA   Q +  W  EL  AL+ 
Sbjct: 127 QALNDADLRKLGRLHTVAEARAAFDVARATFDRVSFDLIYARQDQPLEHWRSELTEALTM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI-TSAHGLHAYEISNH 256
           A DHLS+YQLT+E GT F    K G L    E                A GL AYE+SNH
Sbjct: 187 AADHLSMYQLTVEDGTAFGDRFKRGKLRGLPEEELSADMYTLTQDLCEAAGLPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWR GDY G+GPGAH R+   + R A    + P +WL+ V ++G    
Sbjct: 247 ARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPRAPAAWLERVERDGTGEG 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L +E  A E+LMM LRLREG+       LAGR LD     +L+  G I+     R+
Sbjct: 307 PRVRLDAEDHALEYLMMSLRLREGLDRGRHAALAGRPLDERRIADLREMGMID-TDDERI 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T  G  +L+SVI  LA
Sbjct: 366 FATTEGRMVLNSVITALA 383


>gi|209542808|ref|YP_002275037.1| coproporphyrinogen III oxidase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530485|gb|ACI50422.1| oxygen-independent coproporphyrinogen III oxidase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 393

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 177/392 (45%), Positives = 239/392 (60%), Gaps = 11/392 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT---GPRS 70
             +  L +Y+HWPFC+ KCPYCDFNSHV R  + Q  F  +   E+          GPR 
Sbjct: 3   SDAAPLALYIHWPFCLAKCPYCDFNSHV-RDVIPQARFAAALRRELAQDAARLNADGPRR 61

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + SIFFGGGTPSL++P  +A ++      +T   ++EIT+EANP+SVE    + +R AG+
Sbjct: 62  LGSIFFGGGTPSLMDPATVAALIADATTLFTPLPDLEITLEANPTSVEAGRLRAFRDAGI 121

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+QSL++ +LR LGR H+A++AI A+ LAR +F R+SFDLIYA P Q++  W  E
Sbjct: 122 NRVSLGIQSLDDDALRLLGREHSATQAIDALDLARGLFDRISFDLIYARPGQSLPAWRAE 181

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L RALS   DHLSLYQLTIE GT F  +H+ G L LP E+ A  LY  T  +   HGL  
Sbjct: 182 LDRALSLVSDHLSLYQLTIEPGTRFEGLHRQGLLALPDEDDAARLYEETAIVAGRHGLMG 241

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN++  GAES HNL YWRYGDY+GIGPGAHSR+ +     A    + PE W + V +
Sbjct: 242 YEVSNYARPGAESRHNLTYWRYGDYLGIGPGAHSRLTLDGTLHATRRHRAPEPWAERVER 301

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR----NLDIECERNLQRQG 366
            G  V++ E LS+  +A E L+MGLRL EGI+   +    G      LD         +G
Sbjct: 302 QGSGVMQDETLSARDRAREMLLMGLRLSEGITEDRFARRTGMAMADALDPAILAAALEEG 361

Query: 367 FI---ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++   E      LR T  G   L++++  L +
Sbjct: 362 YLLRDETTDGPVLRATPSGRLRLEALLGALVL 393


>gi|313637790|gb|EFS03140.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Listeria seeligeri FSL S4-171]
          Length = 384

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 191/379 (50%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EMQ          I ++F GGG
Sbjct: 12  AVYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVDLLIKEMQITAANKQMEPIDTVFVGGG 70

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    IA +   I + + +   VE + EANP  + V   Q  +  GVNRIS+GVQS
Sbjct: 71  TPTTLNEAQIAKLCTAIQEIFPMKEEVEFSFEANPGDLSVAKVQTMKDYGVNRISMGVQS 130

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
                L+ +GR H   +   ++   R + F  +S DLI++LP QT   ++  L +AL+  
Sbjct: 131 FNNDLLKKIGRIHTVKDVYQSVENMRTVGFENVSIDLIFSLPGQTEADFQDTLNQALALD 190

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L LP ++   ++Y+L       HG   YEISN + 
Sbjct: 191 LPHYSAYSLIIEPKTIFYNLMQKGKLFLPGQDAEANMYDLLLVEMEKHGRKQYEISNFAK 250

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HN+ YW    Y G G GAH  +    +          + +++ +++N   V ++
Sbjct: 251 EGFESKHNITYWSNEHYYGFGAGAHGYIGNTRYSNFG----PIKKYMEPLQENKLPVFQQ 306

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
           + L+ +++ +E + +GLR   G+S   ++   G++LD   +  +Q+   +G++E  + + 
Sbjct: 307 KELTLKEKMEEEMFLGLRKVSGVSKARFQRKFGQDLDATFQNAIQKTMAKGWLENNEEN- 365

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 366 VALTRNGRFLGNNVFQEFL 384


>gi|326387917|ref|ZP_08209523.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207963|gb|EGD58774.1| coproporphyrinogen III oxidase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 384

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 180/382 (47%), Positives = 246/382 (64%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+HWPFC+ KCPYCDFNSHV R +V    + ++ L +M     LTG R++ SIFF
Sbjct: 2   EPLALYIHWPFCLAKCPYCDFNSHV-RDRVDVAAWQEALLADMAHEASLTGGRTLGSIFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +  +L   A++W+ + N+EIT+EANPSSVE   F     AGVNR+SLG
Sbjct: 61  GGGTPSLMPPQLVETLLSAAARHWSFAPNIEITLEANPSSVEAARFAALAGAGVNRVSLG 120

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L++++LRFLGR H+A E +AA+ +A+  F R+SFDLIYA P QT  QW+ EL RAL 
Sbjct: 121 LQALDDETLRFLGRLHDAREGLAALEVAQRHFARVSFDLIYARPGQTPEQWQAELDRALG 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLYQLTIE GT F  + ++G L    ++ A DL+ LT+ +T+A G+ AYEISNH
Sbjct: 181 FGTGHLSLYQLTIEPGTRFATLVREGKLEPLDDDAAADLFTLTRDMTAAAGIPAYEISNH 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HNL YWRYGDY+GIGPGAH          A    + PE+WL  + ++GH + 
Sbjct: 241 ARPGEESRHNLTYWRYGDYVGIGPGAH----GRRLAQATVRHRKPENWLAAIDRDGHGIA 296

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQ 372
           E+  L+  +QA E L+MGLRL EGI +       G      +D +  R  +  G +  + 
Sbjct: 297 EQRPLALGEQASEALLMGLRLGEGIDLAALSKRFGLPQEALIDPDKARFYRDLGLVSEI- 355

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RL  T RGM +LD+++  L 
Sbjct: 356 HGRLVVTPRGMPLLDALLGELV 377


>gi|134095309|ref|YP_001100384.1| coproporphyrinogen III oxidase [Herminiimonas arsenicoxydans]
 gi|133739212|emb|CAL62261.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Herminiimonas arsenicoxydans]
          Length = 414

 Score =  258 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 129/388 (33%), Positives = 214/388 (55%), Gaps = 9/388 (2%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
            +       L +YVH+P+CVKKCPYCDFNSH       ++ ++ +   +++    L   R
Sbjct: 32  ALNLTALPPLSLYVHFPWCVKKCPYCDFNSHEATGGFPEDEYLSALRADLEQALPLIWGR 91

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            I +IF GGGTPSL+  + +  +L  I     +   VEIT+EANP + E   F+ YR +G
Sbjct: 92  KIYTIFIGGGTPSLLSAKGLDRLLSDIRTLLPLDGAVEITMEANPGTFEAEKFKSYRSSG 151

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           VNR+S+G+QS   + L+ LGR H+  EA  A+ +A   F   + DL+YALP QT+ +   
Sbjct: 152 VNRLSIGIQSFNARHLQALGRIHDGDEARRAVDIAMANFENFNLDLMYALPSQTLEEARQ 211

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           ++Q A+++A  HLSLY LT+E  T+F K       V+P ++ + D+ ++    T+A G  
Sbjct: 212 DVQTAIAFAPPHLSLYHLTMEPNTVFAKYPP----VVPDDDASADMQDMIAEETTAAGYQ 267

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++    ++ HNLNYW++GDY+GIG GAH+++      +  +  K P+S+++ +R
Sbjct: 268 HYEVSAYAQPKRQARHNLNYWQFGDYLGIGAGAHTKLSFPHRVIRQARYKQPKSYMEQMR 327

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                  E E +S  +   EF++  +RL  G+ V  +    G  L+      R  + +G 
Sbjct: 328 LGNPIQEETE-ISRSELGFEFMLNAMRLTNGVEVNLFADRTGMPLNAIERALRAAEDKGL 386

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLAV 395
           + R     ++ T+ G   L+  +  + +
Sbjct: 387 LYR-DHKTIKPTELGQRFLND-LQQMFL 412


>gi|323527038|ref|YP_004229191.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1001]
 gi|323384040|gb|ADX56131.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           CCGE1001]
          Length = 409

 Score =  258 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 214/382 (56%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  + +   + +++ +   +++    L   R + ++F
Sbjct: 31  PPLSLYVHFPWCVRKCPYCDFNSHEWKGETFPENDYLDALRADLEMALPLVWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++++A  A+ +A + F   + DL++ALP+QT+ + + +++ AL
Sbjct: 151 GIQSFNEAHLKALGRIHDSTQARRAVEVAASTFDNFNLDLMFALPRQTLAECQADVETAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIHERTSAAGYGRYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYW +GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 267 YAKPHRQSKHNLNYWGFGDYLGIGAGAHTKLSFPNRVLRQARYKHPATFIEQAKAGAAVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
            E E +S+     EF++  LRL EG  V  +    G  +       +  +R+  I R   
Sbjct: 327 EEHE-VSARDLPFEFMLNALRLVEGFPVHRFIERTGLPMTSVEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 385 EKIAPTPLGQAFLND-LQALFL 405


>gi|24374870|ref|NP_718913.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Shewanella oneidensis MR-1]
 gi|24349568|gb|AAN56357.1|AE015773_2 oxygen-independent coproporphyrinogen III oxidase, putative
           [Shewanella oneidensis MR-1]
          Length = 385

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 204/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L +++    L   R + +IF 
Sbjct: 12  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQAYVDALLADLRQDLHLVQGRKLHTIFI 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILD        S  +EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 72  GGGTPSLFDANQIKRILDDANALIPFSDGIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA  A   AR   +   + DL++ LP Q+  +   ++  A 
Sbjct: 132 VQSFSKDKLNLLGRIHDQNEAQTAAQKARQADYLSFNLDLMHGLPNQSFEEAMADIDTAA 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 192 SLNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEDLWQIYEQGQQKLAALGYEQYEISA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 248 YAKPGYQCQHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLTA----DN 303

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E+  ++ E +A E+LM  LRL   I  +++E   G  R++  +     +++G +   
Sbjct: 304 YTFEQTEVAQEDRALEYLMNRLRLMTPIPKQEFEDRTGLPRDVLKDGMEKAKQRGLLTE- 362

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 363 SAEHWQLTNKGHMFVNDLLTQF 384


>gi|160897476|ref|YP_001563058.1| oxygen-independent coproporphyrinogen III oxidase [Delftia
           acidovorans SPH-1]
 gi|160363060|gb|ABX34673.1| oxygen-independent coproporphyrinogen III oxidase [Delftia
           acidovorans SPH-1]
          Length = 414

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 212/384 (55%), Gaps = 12/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
             L +YVH P+C++KCPYCDFNSH       ++ ++ +I + + +++    L   R++ S
Sbjct: 36  PPLSLYVHLPWCIRKCPYCDFNSHEHGRDGPELPEDRYIDALVADLESALPLIWGRTVHS 95

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL  P++I  +L  I     + ++ EIT+EANP + E + F+ +R AGV R+
Sbjct: 96  IFIGGGTPSLFAPESIDRLLAAIRARLRMEADCEITMEANPGTFETDRFRAFRAAGVTRL 155

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+GVQS +++ L+ +GR H+ ++A AA+  A + F   + DL+YALP QT      +L  
Sbjct: 156 SIGVQSFDDRLLQAVGRVHDGAQARAAVREAADSFETFNIDLMYALPGQTELDLARDLDV 215

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A+S+A  HLS+Y LTIE  T F K        +P +++A D+ +   + T+A G+  YEI
Sbjct: 216 AMSFAPPHLSVYHLTIEPNTYFAKFPPA----IPEDDLAYDMLDRITARTAAAGMQRYEI 271

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++  G +  HN NYW++GDY+GIG GAHS++      V     + P  ++        
Sbjct: 272 SAYAREGHQCWHNRNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRFRDPARYMDQALAGAP 331

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERV 371
              + E +       E+++  LRLREG +++D+    G  L          Q +G I R 
Sbjct: 332 LAQDGE-VRRADLPFEYMLNALRLREGFALQDFMERTGLPLSSIAKGLDAAQAKGLITR- 389

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+  T+RG   L   +  L +
Sbjct: 390 DLGRVVPTERGFDFLSD-LQELFL 412


>gi|170693636|ref|ZP_02884794.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           graminis C4D1M]
 gi|170141418|gb|EDT09588.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           graminis C4D1M]
          Length = 409

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 212/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  +     + +++ +   +++    L   R + ++F
Sbjct: 31  PPLSLYVHFPWCVRKCPYCDFNSHEWKGDTFPENDYLDALRADLEMALPLVWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  I     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDIRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++++A  A+ +A + F   + DL++ALP+QT+ + + ++  AL
Sbjct: 151 GIQSFNEAHLKALGRIHDSTQARRAVEVAASTFDNFNLDLMFALPQQTLAECQADIDTAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP ++ + D+ +  Q  TSA G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIQERTSAAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 267 YAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPATFIEQAKAGAAVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E +       EF++  LRL EG  V  +    G  +       +  +R+  I R   
Sbjct: 327 EEHE-VGPRDLPFEFMLNALRLVEGFPVHRFIERTGLPMTSIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 385 EKIAPTPLGQAFLND-LQALFL 405


>gi|114326692|ref|YP_743849.1| coproporphyrinogen III oxidase [Granulibacter bethesdensis CGDNIH1]
 gi|114314866|gb|ABI60926.1| oxygen-independent coproporphyrinogen-III oxidase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 394

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 168/384 (43%), Positives = 242/384 (63%), Gaps = 6/384 (1%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +  L +Y+HWPFC+ KCPYCDFNSHV R ++ Q  F  +   E+ W     G R ++S+F
Sbjct: 13  TEPLALYIHWPFCLSKCPYCDFNSHV-RDEIPQARFAAALRAELAWEASRLGRRPLASVF 71

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P+ +A +++   + +    ++EIT+EANP+SVE   F+ +R+AGVNR+SL
Sbjct: 72  FGGGTPSLMAPETVAALIEEATRYFPPCDDLEITLEANPTSVEAGRFRAFRQAGVNRVSL 131

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QSL +++L+ LGR H+A +A+AA+ LA  IFPR+SFDLIYA P QT+  W  EL++AL
Sbjct: 132 GIQSLHDEALKGLGRQHDAGQAMAALELAHTIFPRLSFDLIYARPGQTVAAWRQELRQAL 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S A DHLSLYQLTIE GT +    + G+++LPS+  A +LY +T    +  G+ AYE+SN
Sbjct: 192 SLAGDHLSLYQLTIEPGTAYEASFRRGEIILPSDEQAAELYEVTGEEAAQFGMTAYEVSN 251

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  GAES HNL YWRY DY GIGPGAH RV       A    + PE W ++V + GH  
Sbjct: 252 YARSGAESRHNLAYWRYADYAGIGPGAHGRVSHSGSLFATRRHRAPEPWAELVERQGHGS 311

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL----DIECERNLQRQGFIERV 371
             +E +  +++A E L+MGLR+ +GI    +    G  L    D E         ++ R 
Sbjct: 312 TLEEEVEPQERAREMLLMGLRITDGIDEARFRQRTGLTLEQAVDQEILSLALDNAYLSR- 370

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           +   LR    G   L++++  L +
Sbjct: 371 EHGNLRALPEGRVRLNALLQALVL 394


>gi|161170275|gb|ABX59245.1| coproporphyrinogen III oxidase-related FeS oxidoreductase
           [uncultured marine bacterium EB000_55B11]
          Length = 384

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 173/379 (45%), Positives = 254/379 (67%), Gaps = 3/379 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHVR+  V Q  ++ +   E++     T  R++++IFFG
Sbjct: 8   GFGIYIHWPFCAAKCPYCDFNSHVRKS-VDQSRWLSAXRLELKNXAIRTKGRTVNTIFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP+ +A I+  IAK W ++ ++EI++EANP+SVE   F  +RKAG+NRIS+G+
Sbjct: 67  GGTPSLMEPEXVAGIIKEIAKLWVLALDIEISLEANPTSVEAQKFSDFRKAGINRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QSL    L+ LGR H+ +EA  A  +A++ F R+SFDLIYA   Q+   WE+ L+ A S 
Sbjct: 127 QSLRNDDLKALGRMHSVNEARKAFDIAKDNFERVSFDLIYARQDQSKVDWEIXLKEASSM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE GT F  +++ G L     +  A D+Y++TQ +T  + + AYEISNH
Sbjct: 187 AVDHLSLYQLTIEDGTRFGDLYERGSLKGMPNDSLAADMYDITQEVTLQNDMPAYEISNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWRYGDYIG+GPGAH R+    +++A +  ++PE+WL+ V  NG + +
Sbjct: 247 AIEGAESRHNLIYWRYGDYIGVGPGAHGRISENGNKIATTTIENPENWLRGVELNGTSTI 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           + E ++   QA E+LMM LRL EG+ ++ ++ ++G  LD +        G I+ +  + L
Sbjct: 307 DDEVINHIDQASEYLMMSLRLIEGVDMERYKKISGVALDNKLIDKNIENGLIKVINNN-L 365

Query: 377 RCTQRGMTMLDSVIANLAV 395
             TQ G  +L+++I +L +
Sbjct: 366 IATQXGRIILNTLIKDLLI 384


>gi|319427159|gb|ADV55233.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           putrefaciens 200]
          Length = 387

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 129/380 (33%), Positives = 200/380 (52%), Gaps = 10/380 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R + +IF 
Sbjct: 14  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLAQGRQVHTIFI 73

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + + I  IL+G       S N+EIT+EANP ++E ++F  YR AG+ R+S+G
Sbjct: 74  GGGTPSLFDAKQIKRILEGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGITRLSIG 133

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 134 VQSFAKDKLNLLGRIHDQNEAKIAAQKASQAKYLSFNLDLMHGLPNQSFDEAMADIDTAA 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 194 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQRLAALGYEQYEISA 249

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYW++GDY+GIG GAH +V +      I   K      K    +    
Sbjct: 250 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEQNRIIRTVKI--KHPKGYLSSNQYT 307

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERVQF 373
           VE   ++ E +A E+LM  LRL   I  +++E   G  R    E     +++G +     
Sbjct: 308 VELTEVAEEDRALEYLMNRLRLMTPIPKQEFEQRTGLHRETLSEGMEKAKQRGLLTE-SA 366

Query: 374 SRLRCTQRGMTMLDSVIANL 393
              + T +G   ++ ++   
Sbjct: 367 EYWQLTPKGHMFVNDLLTQF 386


>gi|187925063|ref|YP_001896705.1| coproporphyrinogen III oxidase [Burkholderia phytofirmans PsJN]
 gi|187716257|gb|ACD17481.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia
           phytofirmans PsJN]
          Length = 409

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 210/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  +     +  ++ +   +++    L   R + ++F
Sbjct: 31  PPLALYVHFPWCVRKCPYCDFNSHEWKGDTFPENEYLDALRADLEMALPLVWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++++A  A+ +A   F   + DL++ALP QT+ Q + +++ AL
Sbjct: 151 GIQSFNEAHLKALGRIHDSAQARHAVEVAATTFDNFNLDLMFALPGQTLAQCQADVETAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP  + + D+ +     TSA G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDADSSADMQDWIHERTSAAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++         
Sbjct: 267 YARPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPTTFIERALAGTAVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E+E + +     EF++  LRL EG  V  +    G ++       +  +R+  I R   
Sbjct: 327 EERE-VGTRDLPFEFMLNALRLVEGFPVHRFIERTGMSMTSIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 385 EKIAPTPLGQAFLND-LQELFL 405


>gi|134280350|ref|ZP_01767061.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 305]
 gi|134248357|gb|EBA48440.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia pseudomallei 305]
          Length = 405

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 123/383 (32%), Positives = 210/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPERDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LAFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDASADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGTPV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +E   G +L          +++  +    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPAYSFEARTGMSLAAIGPALAQAEQRDLLVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|326318284|ref|YP_004235956.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323375120|gb|ADX47389.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 416

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 214/384 (55%), Gaps = 12/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG---QENFIQSFLTEMQWMRQLTGPRSISS 73
             L +YVH P+C+KKCPYCDFNSH  R   G   ++ ++ + + +++    L   R++ S
Sbjct: 38  PPLSLYVHLPWCLKKCPYCDFNSHEARGGAGALQEQRYLDALMADLEAALPLVWGRTVHS 97

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL  P+ I  ++ G+     + ++ EIT+EANP + E + F+ YR AGV R+
Sbjct: 98  VFIGGGTPSLFSPEAIDRLISGVRARLRLEADAEITLEANPGTFEKDRFRAYRTAGVTRL 157

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+GVQS +++ L+ LGR H+ ++A+AA+  A   F   + D++YALP Q++   E ++  
Sbjct: 158 SVGVQSFDDRFLQALGRVHDRAQALAAVQEAAQAFDTFNLDIMYALPGQSLEDLEQDVAL 217

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS    HLS+Y LTIE  T F K       V+P +++A  + +    +T   GL  YEI
Sbjct: 218 ALSLQPPHLSIYHLTIEPNTYFAKFPP----VVPEDDLAYAMLDRITEMTETAGLRRYEI 273

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++  G + +HN NYW++GDY+GIG GAH ++      V     + P+ +++       
Sbjct: 274 SAYARPGHQCVHNTNYWQFGDYLGIGAGAHGKLSFAHRVVRQVRFRDPQRYMEQALAGNA 333

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERNLQRQGFIERV 371
              + E +       EF++  LRLREG +++D+    G  L           R+G I R 
Sbjct: 334 VAQDHE-VRRADLPFEFMLNALRLREGFALQDFADRTGLPLSAIAGALDEAGRKGLIVR- 391

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
             +R+R T+RG   L   +  L +
Sbjct: 392 DAARVRPTERGFDFLSD-LQELFL 414


>gi|163856586|ref|YP_001630884.1| coproporphyrinogen III oxidase [Bordetella petrii DSM 12804]
 gi|163260314|emb|CAP42616.1| putative porphyrin oxidoreductase [Bordetella petrii]
          Length = 405

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 218/382 (57%), Gaps = 9/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L VYVH P+CV+KCPYCDFNSH    ++ +  ++ +   +++        R + S+F 
Sbjct: 30  PPLSVYVHVPWCVRKCPYCDFNSHAAPAELPERAYLDALRADLEQALPSVWGRQVVSVFL 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     V  + EIT+EANP + E   F+ Y  +GVNR+SLG
Sbjct: 90  GGGTPSLLSAAGLDELLAMLRACLNVLPDAEITMEANPGTAEAGRFRDYAASGVNRLSLG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS ++  L+ LGR H+AS+A AAI +A+    R++ DL++ALP Q MT    ++++ALS
Sbjct: 150 IQSFDDAQLKKLGRIHDASQARAAIEMAQRAVDRVNLDLMFALPGQDMTACLDDVRQALS 209

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++   A GL  YE+S +
Sbjct: 210 FGTEHLSLYHLTLEPNTVFAKYPPE----LPDDDASAAMQDAVEAALQAAGLLRYEVSAY 265

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAV 315
           +  GA   HNLNYW +GDY+G+GPGAH ++      V  +  ++P+SW+      +G  +
Sbjct: 266 ARPGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRIVREARLRNPDSWMAAAIARDGSHI 325

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
            E   +  ++   EF++  LRL++G++   ++   G +L       +   ++G ++    
Sbjct: 326 AEARTVGPDELPFEFMLNALRLKDGVAASSFQERTGLSLAAIAQPLQAATKRGLLDP-DP 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RLR T  G   L+  +  + +
Sbjct: 385 TRLRATPLGWRFLND-LQEMFL 405


>gi|253995544|ref|YP_003047608.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           mobilis JLW8]
 gi|253982223|gb|ACT47081.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           mobilis JLW8]
          Length = 385

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 129/384 (33%), Positives = 214/384 (55%), Gaps = 12/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
             L +Y+H P+CV+KCPYCDFNSH  RY   ++ +  ++++ + +++        R I S
Sbjct: 8   PPLALYIHIPWCVQKCPYCDFNSHESRYKNGELPEAAYVEALIKDLELSTPKVWGRKIKS 67

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IFFGGGTPSL  P+ I  IL  +     +  + EIT+EANP +V++ NF GY++AGVNR+
Sbjct: 68  IFFGGGTPSLFSPEAIDTILSQVRALTPLEYDAEITLEANPGTVDIANFAGYKQAGVNRL 127

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLG+QS     L+ LGR H+  +AI A  LA   F R++ D++Y LP+Q++     + ++
Sbjct: 128 SLGIQSFNAGYLKALGRIHDDKQAIKAAELALATFDRVNLDVMYGLPQQSLADALADAKQ 187

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A+    DHLS Y LT+E  T FY    +    LP ++ + ++    ++  + HG   YE 
Sbjct: 188 AVQLNPDHLSFYHLTLEPNTPFYHTPPN----LPDDDTSAEMQIEIENFLAQHGYEHYET 243

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S  +  G+++ HNLNYW++GDY+GIG GAHS++         +  KHP+++++       
Sbjct: 244 SAFAKTGSQARHNLNYWQFGDYLGIGAGAHSKLSYHDKITRETRPKHPKAYMEKALAGNA 303

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERV 371
              E   +S +    EF+M  LRL +G+ +  ++   G NL       +  Q++  +   
Sbjct: 304 VERES-IVSQDALGFEFMMNALRLIDGVPLTLFQQHTGLNLMTLQPAIKAAQQKKLLT-T 361

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           +   ++ T  G   L+ ++    +
Sbjct: 362 ENGYIKPTLLGQRYLNELL-QFFL 384


>gi|257865921|ref|ZP_05645574.1| coproporphyrinogen III oxidase [Enterococcus casseliflavus EC30]
 gi|257872254|ref|ZP_05651907.1| coproporphyrinogen III oxidase [Enterococcus casseliflavus EC10]
 gi|257799855|gb|EEV28907.1| coproporphyrinogen III oxidase [Enterococcus casseliflavus EC30]
 gi|257806418|gb|EEV35240.1| coproporphyrinogen III oxidase [Enterococcus casseliflavus EC10]
          Length = 396

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 107/386 (27%), Positives = 187/386 (48%), Gaps = 10/386 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
           + + ++  Y+H PFC   C YCDFN          + +I++ L E++            +
Sbjct: 13  KSAQNISAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIEALLKEIELSLLRQPINEAET 71

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           I+ GGGTP+ +    +  +L G+ +     +  E T+EANP  +        +   V R+
Sbjct: 72  IYIGGGTPTSLSANQLDRLLSGVHELLPTHTTKEFTVEANPGDLSEEKMLVLKNHQVTRL 131

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHL-ARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQ+ + + L+ +GR H A +  + I L  ++ F  ++ DLIYALP Q++  +   L 
Sbjct: 132 SMGVQTFDNRLLKKIGRKHTAEDVYSTIQLLEKHDFQNVTIDLIYALPGQSIESFRDTLT 191

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           RA+   + H ++Y L +E  T+F    + G + LPS+     +++   +  +  GL+ YE
Sbjct: 192 RAIDLGLPHYAMYSLILENKTMFMNWVRQGRMALPSQEAETQMFDEAIAAMTKAGLNQYE 251

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           ISN +  G ESLHNL YW    Y G G GA   +    ++    I+ + +   +    N 
Sbjct: 252 ISNFARPGYESLHNLVYWNNEHYFGFGAGASGYIGQTRYKNKGPIQHYLKPLQE----NQ 307

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE---RNLQRQGFIE 369
             + E E L++  Q +E L +GLR + GIS   +    G++           L ++G++ 
Sbjct: 308 LPIHETEELTTSNQMEEELFLGLRKKAGISKIRFAEKFGKSFQEIYGSTSEQLIQKGWLA 367

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
             Q  R+  T+ GM + + V     +
Sbjct: 368 -SQGDRVFLTKAGMFIGNEVSEAFLL 392


>gi|329113970|ref|ZP_08242737.1| Oxygen-independent coproporphyrinogen-III oxidase-like protein
           [Acetobacter pomorum DM001]
 gi|326696717|gb|EGE48391.1| Oxygen-independent coproporphyrinogen-III oxidase-like protein
           [Acetobacter pomorum DM001]
          Length = 384

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 170/383 (44%), Positives = 254/383 (66%), Gaps = 6/383 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           ++L +Y+HWPFC+ KCPYCDFNSHV R ++ Q  F Q+  TE+       G R ++SIFF
Sbjct: 4   DALALYIHWPFCLAKCPYCDFNSHV-RAEIPQARFAQALRTELAHEANRLGRRRLTSIFF 62

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +A ++D     +  + N+EIT+EANP+SVE    + +R++G+NR+SLG
Sbjct: 63  GGGTPSLMAPQTVASLIDDATSLFDAAPNLEITLEANPTSVEAERLKDFRQSGINRVSLG 122

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +++L FLGR H+A++A+AA+ LAR++FPR++FDLIYA P Q++  W+ EL+ AL 
Sbjct: 123 IQALNDKALHFLGRQHSATQALAALELARSLFPRITFDLIYARPNQSVAAWKTELETALQ 182

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              DH+SLYQLTIE GT F  +++ G   LP E  A +LY  T +IT AHGL+AYE+SN+
Sbjct: 183 LVADHVSLYQLTIEPGTKFEALYRQGSFSLPDEETAAELYETTTAITHAHGLNAYEVSNY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G+ES HNL YW YGDY+G+GPGAH R+ +     A    + PE W ++V + G    
Sbjct: 243 AKPGSESRHNLTYWHYGDYLGLGPGAHGRITLDGQLYATRRHRAPEPWAELVERTGSGQT 302

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR----NLDIECERNLQRQGFIERVQ 372
            +E L  +++A E L+MGLRL+EG+++K +E   G      LD         +G++ +  
Sbjct: 303 SQEPLVPQERAREMLLMGLRLQEGVALKHFEARTGLHLSETLDPVILAAAVEEGYLVQT- 361

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            + L  T+ G   L++++  L +
Sbjct: 362 PTHLHATEEGRLRLEALLHALVL 384


>gi|257875548|ref|ZP_05655201.1| coproporphyrinogen III oxidase [Enterococcus casseliflavus EC20]
 gi|257809714|gb|EEV38534.1| coproporphyrinogen III oxidase [Enterococcus casseliflavus EC20]
          Length = 396

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 107/386 (27%), Positives = 186/386 (48%), Gaps = 10/386 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
           + + ++  Y+H PFC   C YCDFN          + +I++ L E++            +
Sbjct: 13  KSAQNISAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIEALLKEIELTLLRQPINEAET 71

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           I+ GGGTP+ +    +  +L G+ +     +  E T+EANP  +        +   V R+
Sbjct: 72  IYIGGGTPTSLSANQLDRLLSGVHELLPTHTTKEFTVEANPGDLSEEKMLVLKNHQVTRL 131

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHL-ARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           S+GVQ+ + + L+ +GR H A +  + I L  ++ F  ++ DLIYALP Q++  +   L 
Sbjct: 132 SMGVQTFDNRLLKKIGRKHTAEDVYSTIQLLEKHDFQNVTIDLIYALPGQSIESFRDTLT 191

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
           RA+   + H ++Y L +E  T+F    + G + LPS+     +++   +  +  GL+ YE
Sbjct: 192 RAIDLGLPHYAMYSLILENKTMFMNWVRQGRMALPSQEAETQMFDEAIAAMTKAGLNQYE 251

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
           ISN +  G ESLHNL YW    Y G G GA   +    ++    I+ + +   +    N 
Sbjct: 252 ISNFARPGYESLHNLVYWNNEHYFGFGAGASGYLGQTRYKNKGPIQHYLKPLQE----NQ 307

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE---RNLQRQGFIE 369
             + E E L++  Q +E L +GLR + GIS   +    G++           L  +G++ 
Sbjct: 308 LPIHETEELTTSNQMEEELFLGLRKKAGISKIRFAEKFGKSFQEIYGSTSEQLILKGWLA 367

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
             Q  R+  T+ GM + + V     +
Sbjct: 368 -SQGDRVFLTKAGMFIGNEVFEAFLL 392


>gi|113969531|ref|YP_733324.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. MR-4]
 gi|113884215|gb|ABI38267.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. MR-4]
          Length = 385

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 206/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L +++    L   R + +IF 
Sbjct: 12  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQKAYVDALLADLRQDLHLVQGRKLHTIFI 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S ++EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 72  GGGTPSLFDANQIKRILDGANALIPFSDDIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 132 VQSFSKDKLNLLGRIHDQNEAQTAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 192 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEDLWQIYEQGQQKLAALGYEQYEISA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L   + N  
Sbjct: 248 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLAADKYN-- 305

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E+  ++ E +A E+LM  LRL   I  +++E   G  R+   E     +++G +   
Sbjct: 306 --FEQTEVAEEDRALEYLMNRLRLMTPIPKQEFENRTGLHRDTLKEGMEKAKQRGLLTE- 362

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 363 SAEHWQLTSKGHMFVNDLLTQF 384


>gi|85708629|ref|ZP_01039695.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
 gi|85690163|gb|EAQ30166.1| coproporphyrinogen III oxidase [Erythrobacter sp. NAP1]
          Length = 383

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 174/379 (45%), Positives = 237/379 (62%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +Y+HWPFC KKCPYCDFNSHV R  V  + + ++ + +++   +  G   ++SIFFGGG
Sbjct: 4   ALYIHWPFCAKKCPYCDFNSHV-RESVDIDLWERALIADLRAEAREGGYEKLTSIFFGGG 62

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ P+ ++ +L+   K W  +  +EIT+EANPSSVE  NF     AG+NR+SLGVQS
Sbjct: 63  TPSLMPPKLVSALLNEAEKLWGFAPEIEITLEANPSSVEAANFAALASAGINRVSLGVQS 122

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           L++++LR+LGR H A EAI A+ +A+  F R+SFDLIYALP QT  QWE +L RALS+  
Sbjct: 123 LDDKTLRWLGRLHGAQEAIGALDVAQAHFARVSFDLIYALPDQTAEQWEAQLTRALSFGT 182

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H+SLYQLTIE GT F    + G       + A +L+ LTQS+TSA GL AYE SNH+  
Sbjct: 183 SHMSLYQLTIEPGTRFETDVRLGRFAPLDNDEAAELFALTQSLTSAAGLPAYETSNHAHP 242

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             ES HNL YWRY DY G+GPGAH          A    K PE++LK V +  H + E+ 
Sbjct: 243 DDESRHNLTYWRYQDYAGVGPGAH----GRRGGFATVRHKKPENFLKAVNERAHGISEQR 298

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLA----GRNLDIECERNLQRQGFIERVQFSR 375
            L  ++ A E LMMGLRL EG+ +   E       G  +D    ++L+  G I + +  R
Sbjct: 299 LLDPKEAASEALMMGLRLVEGVDLSALEARFRQDRGEMVDAGKLKHLKDIGLIWQ-EDER 357

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T  G  +LD+V+ +L 
Sbjct: 358 IGLTDAGRPVLDAVLGDLL 376


>gi|330505400|ref|YP_004382269.1| coproporphyrinogen III oxidase [Pseudomonas mendocina NK-01]
 gi|328919686|gb|AEB60517.1| coproporphyrinogen III oxidase [Pseudomonas mendocina NK-01]
          Length = 384

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 211/382 (55%), Gaps = 11/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++    Q    R ++SIFF
Sbjct: 10  PPLALYIHIPWCVRKCPYCDFNSHAAGPTLPEEEYVDALLADLDIDLQHVHGRPLTSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    + ++EIT+EANP + E   F+GYR  G+NR+S+G
Sbjct: 70  GGGTPSLFSDRALGRLLEGVEQRVGFAPDIEITLEANPGTFEQAKFKGYRSLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +E  L+ LGR H+ SEA+ A  +AR   F   + DL++ LP+Q++     +L+ A+
Sbjct: 130 VQSFQEAKLKALGRIHDGSEAVRAADMARAAGFDNFNLDLMHGLPEQSIEDALFDLRTAI 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S    HLS YQLT+E  T+F+         LP +++  D+    Q++ +A G   YE+S 
Sbjct: 190 SQGPTHLSWYQLTMEPNTVFWSQPP----TLPEDDLLWDIQEAGQALLAAEGYAQYEVSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G ++ HNLNYW +GD++GIG GAH+++   + R+              +       
Sbjct: 246 YARPGKQARHNLNYWTFGDFLGIGAGAHAKLSAPAGRIQR--TWKTRLPKDYLDPAKVFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
             +  L + +   E+LM  LRL  G   + +    G  L    +  R  +RQG + +   
Sbjct: 304 AGERVLEASELPFEYLMNVLRLTGGAPAELFSQRTGLPLQQLEQARREAERQGLL-QADP 362

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++  L +
Sbjct: 363 TRLVATAKGQLFLNDLL-QLFL 383


>gi|144897366|emb|CAM74230.1| oxygen-independent coproporphyrinogen III oxidase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 385

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 177/388 (45%), Positives = 246/388 (63%), Gaps = 10/388 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +    S   GVYVHWPFC+ KCPYCDFNSH     + Q+ + ++ L E++          
Sbjct: 2   LPVTPSPGFGVYVHWPFCLSKCPYCDFNSHAA-DTIDQDRWRRALLAELEHFAARKPEAE 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           ++SIFFGGGTPSL++P  IA ++D I + W     +EIT+EANPS+VE   F+ +R AG+
Sbjct: 61  VTSIFFGGGTPSLMDPATIAALIDRIHQLWPCDPLIEITLEANPSTVEAQRFRDFRAAGI 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L +  L FLGR H+A+EA+AA+ +A   F R SFDLIYA P QTM  W+ E
Sbjct: 121 NRLSLGVQALNDADLHFLGRRHDAAEALAALDVAAATFERFSFDLIYARPGQTMAAWQTE 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L +AL+    HLS YQLTIE+GT FY +H  G+  LP E++A DL+ LT+S+ +  GL A
Sbjct: 181 LTQALALTGGHLSAYQLTIEEGTAFYPIHARGEFQLPDEDLAADLFALTRSMAAEAGLPA 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEISNH+  G ES HNL YWR GDY+GIGPGAH R+   + R      + P+ WL+ V  
Sbjct: 241 YEISNHARPGQESRHNLTYWRGGDYVGIGPGAHGRLNHRATR----QHRAPDVWLRRVEA 296

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL----DIECERNLQRQG 366
           +GHA   +E L +  +A+E +MMGLRL EGI    +    G +L    D++   +L++ G
Sbjct: 297 HGHACQGEEALDARTRAEELVMMGLRLNEGIHADHFRDQCGLDLWQVIDVQAHAHLEQDG 356

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
            + R     +  T+ G+ +L+S+   L 
Sbjct: 357 LLRRTAHG-IAATEAGLLVLNSLTGALL 383


>gi|114046764|ref|YP_737314.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. MR-7]
 gi|113888206|gb|ABI42257.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. MR-7]
          Length = 385

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 205/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L +++    L   R + +IF 
Sbjct: 12  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQAYVDALLADLRQDLHLVQGRKLHTIFI 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S ++EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 72  GGGTPSLFDANQIKRILDGANALIPFSDDIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 132 VQSFSKDKLNLLGRIHDQNEAQTAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 192 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEDLWQIYEQGQQKLAALGYEQYEISA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 248 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLAA----DN 303

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E+  ++ E +A E+LM  LRL   I  +++E   G  R+   E     +++G +   
Sbjct: 304 YHFEQTEVAEEDRALEYLMNRLRLMTPIPKQEFEDRTGLHRDTLKEGMEKAKQRGLLTE- 362

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 363 SAEHWQLTSKGHMFVNDLLTQF 384


>gi|119382770|ref|YP_913826.1| coproporphyrinogen III oxidase [Paracoccus denitrificans PD1222]
 gi|119372537|gb|ABL68130.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Paracoccus denitrificans PD1222]
          Length = 394

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 168/378 (44%), Positives = 230/378 (60%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV    + Q  ++ ++  E+  + + T  R ++SIFFG
Sbjct: 19  GFGLYVHWPFCAAKCPYCDFNSHVAA-AIEQGRWLAAYRAEIARLGRETPGRVLNSIFFG 77

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A +++     W  ++++EIT+EANP+SVE   F+ Y  AGVNR+S+GV
Sbjct: 78  GGTPSLMAPETVAGVIEAARAAWPFANDIEITLEANPTSVETGRFRAYADAGVNRVSMGV 137

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H+A EA AA  +AR+ F R+SFDLIYA   Q    W  EL  AL  
Sbjct: 138 QALNDDDLRRLGRMHSAGEARAAFDIARDCFTRVSFDLIYARQDQDRAHWRRELGEALGM 197

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLS YQLTIE GT F   H  G L    ++  + D+Y  TQ I +A G+  YEISNH
Sbjct: 198 AVDHLSAYQLTIEPGTAFGARHAKGGLKGLPDDDLSADMYLDTQEICAAAGMPTYEISNH 257

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWR GD+  +GPGAH R+ + S R A      P +WL+ V   G+   
Sbjct: 258 ARPGAESRHNLIYWRQGDWAAVGPGAHGRLTLPSGRWATEAHLAPGAWLEAVEARGNGDS 317

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           ++E L    +A E+L+M +RL EG+ V  +    G  L  +   NL   G I  ++  RL
Sbjct: 318 QREMLGLSDRALEYLLMSMRLVEGLDVPRYLA-HGAELPQDRLMNLAELGLIS-LRGDRL 375

Query: 377 RCTQRGMTMLDSVIANLA 394
             T  G  +L++++  LA
Sbjct: 376 AATAAGRPVLNAILRELA 393


>gi|30248297|ref|NP_840367.1| coproporphyrinogen III oxidase [Nitrosomonas europaea ATCC 19718]
 gi|30138183|emb|CAD84189.1| Coproporphyrinogen III oxidase and related FeS oxidoreductases
           [Nitrosomonas europaea ATCC 19718]
          Length = 399

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 129/387 (33%), Positives = 204/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
             LG+Y+H P+CV+KCPYCDFNSH       + +  ++ +   +++    L   R ++S+
Sbjct: 18  PPLGLYIHLPWCVRKCPYCDFNSHAINSGGDLPESEYVTALKRDLELALPLIWGRPVTSV 77

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           FFGGGTPSL     I  IL  +     ++  VEIT+EANP ++E   F  +  AG+NR+S
Sbjct: 78  FFGGGTPSLFSATAIDAILSHVRMLLPLAPGVEITLEANPGTLEAQKFTDFHSAGINRLS 137

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS   + L+ LGR H+ +EA+ A  LA   F  ++ DL+YALP QT  +   +++ A
Sbjct: 138 IGIQSFNSRHLQALGRIHDGAEALRAAELALQHFSNVNLDLMYALPGQTRDEALQDIETA 197

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
            +  V H+S Y LTIE  T FY+        LP E+ + D+  + + I +  G   YE S
Sbjct: 198 CNRGVAHISAYHLTIEPNTPFYRYPPQ----LPDEDTSADMQVMIEHILAERGYRHYETS 253

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
             +  G   LHN+NYW+YGDY+GIG GAHS++      +     KHP  +L+        
Sbjct: 254 AFAQPGKPCLHNMNYWQYGDYLGIGAGAHSKISFRDRIIRQMRHKHPRQYLEQAMAGNAC 313

Query: 315 VVE----KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFI 368
           +      ++ +  + +  EF+M  LRL EG     +    G  +    +     +++G I
Sbjct: 314 LENLLATEQEVGPQDRIFEFMMNALRLTEGFDPGLFHTRTGLTIASIQKSLAEAEQRGLI 373

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E  Q   +R T  G   L+ ++  + +
Sbjct: 374 EW-QHDCIRPTPEGRRFLNDLL-EIFL 398


>gi|145589265|ref|YP_001155862.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047671|gb|ABP34298.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 392

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 128/387 (33%), Positives = 216/387 (55%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV------RRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
             L +Y+H+P+C KKCPYCDFNSH             +  +I++ + +++        R 
Sbjct: 11  PPLALYIHFPWCEKKCPYCDFNSHQIKDAKSSTNGFDEPRYIKALIADLETELPNIWGRQ 70

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+F GGGTPSL+ P+ +  +L  +     +  + EIT+EANP SVE   F  + K+G+
Sbjct: 71  VHSVFIGGGTPSLLSPEGMDQLLSAVRARINLEPDAEITMEANPGSVEAEKFAAFAKSGI 130

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+QS +++ L+ LGR HN +EA  A+ +A + F  ++ DL+Y LP Q +   + +
Sbjct: 131 NRVSLGIQSFQDEQLKALGRIHNGAEAKRAVQIALDHFKSVNIDLMYGLPNQNLDSAKTD 190

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           ++ ALS+   HLSLY LT+E  T F          LP+E V   +++    + S  G   
Sbjct: 191 IETALSFNTPHLSLYNLTLEPNTYFANFPPK----LPNEEVIDAMFDQNVDLLSKAGYRR 246

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YEIS ++    E  HNLNYWR+GDYIGIG GAH ++   +       E+HPE++++++  
Sbjct: 247 YEISAYAKKDQECKHNLNYWRFGDYIGIGAGAHGKISYPNKITRQVRERHPETYMQLMES 306

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFI 368
            G+A++E   + ++    EF++  LRL +G+    +    G  L    +      ++G +
Sbjct: 307 KGNALIESREIEAKDLPFEFMLNTLRLSDGVDTNTYSERTGLPLSTISKGLNEACKKGLL 366

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           +    S+L+ T +G+  L++ +  + +
Sbjct: 367 DE-NPSKLKATDQGLRYLNN-LQEIFL 391


>gi|312795399|ref|YP_004028321.1| Oxygen-independent coproporphyrinogen-III oxidase [Burkholderia
           rhizoxinica HKI 454]
 gi|312167174|emb|CBW74177.1| Oxygen-independent coproporphyrinogen-III oxidase (EC 1.3.99.22)
           [Burkholderia rhizoxinica HKI 454]
          Length = 426

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 127/393 (32%), Positives = 206/393 (52%), Gaps = 14/393 (3%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-----GQENFIQSFLTEMQWMRQ 64
            +       L +YVH+P+CV KCPYCDFNSH            +  ++ +   +++    
Sbjct: 37  RIRLTALPPLSLYVHFPWCVHKCPYCDFNSHAFTRGPNDAQFPETEYLDALRADLEAALP 96

Query: 65  LTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQG 124
           L   R + ++F GGGTPSL+  Q I  +L  +     + ++ EIT+EANP + E   F  
Sbjct: 97  LIWGRPVHTVFIGGGTPSLLSAQAIDRLLSDLRALLPLDADAEITLEANPGTFEAAKFAS 156

Query: 125 YRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTM 184
           +R +G+NR+S+G+QS  +  L+ LGR H+A++A  A+ +A + F   + DL++ALP Q +
Sbjct: 157 FRSSGINRLSIGIQSFNDAHLQALGRIHDAAQARRAVEIAHSSFDNFNLDLMFALPGQRL 216

Query: 185 TQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS 244
            Q + +++ ALS+A  HLSLY LT+E  T F+K        LP ++ + D+     + T 
Sbjct: 217 AQCQADVETALSFAPPHLSLYHLTLEPNTYFHKYPPA----LPDDDTSADMQEWIHARTH 272

Query: 245 AHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESW 304
             G + YE+S ++    +S HNLNYW++GDY+GIG GAHS++      V     KHP ++
Sbjct: 273 EAGYNRYEVSAYARTHRQSRHNLNYWQFGDYLGIGAGAHSKLSFPERIVRQMRYKHPATY 332

Query: 305 LKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNL 362
           L      G  + E+  +       EF++  LRL +G  V  +    G  +          
Sbjct: 333 L-AQTAAGAPIQEQHEVGVRDLPFEFMLNALRLTQGFPVHRFIERTGLTMTSIEPALAQA 391

Query: 363 QRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           +R+G I R   + +  T  G   L+  +  L +
Sbjct: 392 ERRGLI-RRDHASIAPTPLGQRFLND-LQALFL 422


>gi|300311451|ref|YP_003775543.1| anaerobic coproporphyrinogen III oxidase oxidoreductase
           [Herbaspirillum seropedicae SmR1]
 gi|300074236|gb|ADJ63635.1| anaerobic coproporphyrinogen III oxidase oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 414

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 131/388 (33%), Positives = 216/388 (55%), Gaps = 9/388 (2%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR 69
           ++       L +YVH+P+CV+KCPYCDFNSH  +    ++ ++ +   +++    L   R
Sbjct: 32  SLQLTALPPLSLYVHFPWCVRKCPYCDFNSHEVKDGFPEQEYLDALRLDLEQALPLIWGR 91

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
            I SIF GGGTPSL+    +  +L  +     + +++EIT+EANP + E + F+ YR +G
Sbjct: 92  KIYSIFIGGGTPSLLSAAGLDRLLSDLRTLLPLDADIEITMEANPGTFEADKFRSYRDSG 151

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
           +NR+S+G+QS     L+ LGR H+  +A  A+ +A   F   + DL+YALP+QT+ Q   
Sbjct: 152 INRLSIGIQSFNSAHLQALGRIHDGGQAHQAVEIAHANFDNFNLDLMYALPQQTLEQART 211

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           ++Q A+ +A  HLSLY LT+E  TLF K        +P E+ + D+ ++   +T+  G  
Sbjct: 212 DIQTAIDFAPPHLSLYHLTLEPNTLFAKFPPA----VPDEDTSADMQDMIGELTTQAGYG 267

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G  + HNLNYW++GDY+GIG GAHS++      V     KHP+++L+ ++
Sbjct: 268 NYEVSAYAQPGRRARHNLNYWQFGDYLGIGAGAHSKLSFPHRIVRQMRYKHPQAYLQHIK 327

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGF 367
              H   E E +  +    EF++  LRL EG     +    G  L+   +     +R+G 
Sbjct: 328 AGTHIQEEAE-IGRDALGFEFMLNALRLTEGFPPNLFAERTGLALNQIGKQLDLAERKGM 386

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLAV 395
           + R   + +R T  G   L+  +  + +
Sbjct: 387 LYR-DHALIRPTPLGRRFLND-LQEIFL 412


>gi|126463645|ref|YP_001044759.1| coproporphyrinogen III oxidase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105309|gb|ABN77987.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 385

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 177/378 (46%), Positives = 237/378 (62%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q  + +++L+E++ +   T  R ++S+FFG
Sbjct: 8   GFGLYLHWPFCQSKCPYCDFNSHVAAT-IDQGRWQRAYLSEIRRLGTETEGRVLNSVFFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP  +A IL+ +   W +++++E+T+EANP SVE   F+GYR AGVNRIS+G+
Sbjct: 67  GGTPSLMEPDLVAAILETVRTTWPLANDLEVTLEANPGSVEAGRFRGYRAAGVNRISMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H  +EA AA  +A   F R+SFDLIYA   Q +  W  EL  AL+ 
Sbjct: 127 QALNDADLRKLGRLHTVAEARAAFDVAHTTFDRVSFDLIYARQDQPLEHWRSELTEALTM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLS+YQLT+E GT F    K G L    E   + D+Y LTQ +  A GL AYE+SNH
Sbjct: 187 AADHLSMYQLTVEDGTAFGDRFKRGKLRGLPEEELSADMYALTQDLCEAAGLPAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HNL YWR GDY G+GPGAH R+   + R A    + P +WL+ V ++G    
Sbjct: 247 ARPGAESRHNLIYWRGGDYAGVGPGAHGRLTFPTGRWATEAPRAPGAWLERVERDGTGEG 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L +E  A E+LMM LRLREG+       LAGR LD     +L+  G I+     R+
Sbjct: 307 PRVRLDAEDHALEYLMMSLRLREGLDRGRHAALAGRPLDERRVADLREMGMID-TDDERI 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T  G  +L+SVI  LA
Sbjct: 366 FATTEGRMVLNSVITALA 383


>gi|299066244|emb|CBJ37428.1| Coproporphyrinogen dehydrogenase [Ralstonia solanacearum CMR15]
          Length = 424

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 135/386 (34%), Positives = 212/386 (54%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + ++ F+ +   +++    +   R + +
Sbjct: 40  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPDQGIPEDRFLAAIRQDLEAALPMVWGRRVHT 99

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  + +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 100 IFIGGGTPSLLSARGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 159

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  L+ LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 160 SIGIQSFNDAHLQALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 219

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F          LP ++ A  + +   +  +A G   YE+
Sbjct: 220 ALSFGTSHVSLYHLTLEPNTYF----AKHPPALPDDDTAFAMQDWIHARLAAAGYEHYEV 275

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     KHPE++L+       
Sbjct: 276 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVIREMRHKHPETYLRQSETAGG 335

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              V E+  + +     EF++  LRL EG  V  ++   G  L          +R+G + 
Sbjct: 336 ATVVQEQREVDAADLPFEFMLNTLRLTEGFPVTLFQERTGLPLRGIERELDAAERRGLLV 395

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R     +R T+ G   L+  +  L +
Sbjct: 396 R-DHVAIRPTELGQRFLND-LQALFL 419


>gi|224824835|ref|ZP_03697942.1| oxygen-independent coproporphyrinogen III oxidase [Lutiella
           nitroferrum 2002]
 gi|224603328|gb|EEG09504.1| oxygen-independent coproporphyrinogen III oxidase [Lutiella
           nitroferrum 2002]
          Length = 396

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 131/381 (34%), Positives = 210/381 (55%), Gaps = 8/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H+P+CV+KCPYCDFNSH  +    ++ ++ + L +++        R + +IF 
Sbjct: 18  PPLSLYIHFPWCVRKCPYCDFNSHEVKNGFDEDAYVAALLADLESALPAVWGRPVHTIFM 77

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L GI     +  + EIT+EANP + E + F+G+R+AG+NR+S+G
Sbjct: 78  GGGTPSLFSARAMDTLLAGIRARVRLYPDAEITMEANPGTFESDKFKGFREAGINRLSIG 137

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS +   L+ LGR H+  +A  A+ +A   F  ++ DL+YALP QT+ Q   ++  ALS
Sbjct: 138 IQSFDPAHLKALGRIHHGDDARRAVDIALTHFDNVNLDLMYALPGQTLEQALTDMGTALS 197

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           + V H+S Y LTIE  TLF +        LP + ++ D+    ++  +  G   YE S  
Sbjct: 198 FGVTHVSAYHLTIEPNTLFARYLP---PKLPDDELSADMQEALEARLTEAGFGHYETSAF 254

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G E  HNLNYW++GDY+GIG GAH+++      V     K P ++LK V +      
Sbjct: 255 ARPGRECRHNLNYWQFGDYLGIGAGAHAKISAHDGIVREMRYKQPAAYLKAVAEGRPTQS 314

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQFS 374
             E ++   +  EF+M  LRL +G  ++ +    G  L          + QG IER   +
Sbjct: 315 R-ERIARADRPFEFMMNLLRLTDGFELRLFAERTGLPLTHIQRELAEAEAQGLIER-DLT 372

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            L+ T +G   L+ ++  L +
Sbjct: 373 TLKPTLKGQRFLNDLLT-LFL 392


>gi|270263063|ref|ZP_06191333.1| hypothetical protein SOD_d00780 [Serratia odorifera 4Rx13]
 gi|270042751|gb|EFA15845.1| hypothetical protein SOD_d00780 [Serratia odorifera 4Rx13]
          Length = 379

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 134/382 (35%), Positives = 208/382 (54%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   L ++     L G R IS+IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLLADLDADLPLAGGREISTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     V+ + EIT+EANP +VE + F GY++AGVNRIS+G
Sbjct: 65  GGGTPSLLSAEAMQSLLDGVRARIRVADDAEITMEANPGTVEADRFSGYQRAGVNRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSAEKLTRLGRIHGPEEAKRAAHLATGLGLRSFNLDLMHGLPDQSLEEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF         VLP ++   D++     + SA G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFERGHQLLSAAGYRQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  +     ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTA----KTKHPRGFMQGKYM 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERVQF 373
            ++  +++  +  EF M   RL E     D+    G +  +          +G++E    
Sbjct: 297 DKQHEVTTADRPFEFFMNRFRLLEAAPRADFAHYTGLDESVIRPQLDEALEKGYLEET-A 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T++G   L+S++  L +
Sbjct: 356 EYWQITEKGKLFLNSLL-ELFL 376


>gi|241767031|ref|ZP_04764816.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           delafieldii 2AN]
 gi|241362434|gb|EER58378.1| oxygen-independent coproporphyrinogen III oxidase [Acidovorax
           delafieldii 2AN]
          Length = 418

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 135/386 (34%), Positives = 218/386 (56%), Gaps = 14/386 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRY-----KVGQENFIQSFLTEMQWMRQLTGPRSI 71
             L +YVH P+C+KKCPYCDFNSH  R      ++ +  ++ + + +++    L   RS+
Sbjct: 38  PPLALYVHLPWCLKKCPYCDFNSHEWRSAGGAQELPEARYLDALVADLEAALPLVWGRSV 97

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            SIF GGGTPSL  PQ+I  ++  I     ++++ EIT+EANP + E + F+ +R AGV 
Sbjct: 98  HSIFIGGGTPSLFSPQSIDRLIGDIRARLPLAADCEITLEANPGTFEKDRFRAFRAAGVT 157

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+S+GVQS  ++ L+ LGR H+ ++A+AA+  A + F   + D++YALP QT+ + E ++
Sbjct: 158 RLSVGVQSFNDRHLQALGRVHDRAQALAAVQEAASAFDTFNLDIMYALPGQTLQELEQDM 217

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
             AL+ A  HLS+Y LTIE  T F K        +P ++ A  + +    +T   GL  Y
Sbjct: 218 ATALALAPPHLSVYHLTIEPNTYFAKYPPA----IPEDDQAYAMLDRITEMTGQAGLARY 273

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EIS ++  G    HN NYW++GDY+G+G GAHS++      V  +  + P  ++      
Sbjct: 274 EISAYARPGHACFHNTNYWQFGDYLGLGAGAHSKLSFAHRVVRQARFRDPRLYMDNALAG 333

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERNLQRQGFIE 369
               ++ E +       EF++  LRLREG +++D+    G++L          +R+G I 
Sbjct: 334 RAVALD-EDVRRADLPFEFMLNALRLREGFALQDFVERTGQSLTAIAGALDEAERKGLIT 392

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R    R+R T+RG+  L+  +  L +
Sbjct: 393 R-DLGRVRPTERGVDFLND-LQALFL 416


>gi|240849728|ref|YP_002971116.1| coproporphyrinogen III oxidase [Bartonella grahamii as4aup]
 gi|240266851|gb|ACS50439.1| coproporphyrinogen III oxidase [Bartonella grahamii as4aup]
          Length = 399

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 210/397 (52%), Positives = 266/397 (67%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+ +F  E++      GPR I+SIF
Sbjct: 2   NEPFGIYIHWPFCAAKCPYCDFNSHVRIHGVDQPRFVTAFKREIETQYHKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EPQ +  +L  +AK W V+ NVEIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMEPQTVDALLQALAKKWVVNDNVEITLEANPSSVEAERFRGYRAAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +++LR LGR HN  +A+ AI LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GIQALNDKALRKLGRLHNVEQALCAIDLARQIFPRLSFDLIYARPEQTLEQWKSELVQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F ++H  G L+LP   +A DLYNLTQ IT+ HGL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTAFKRLHDAGRLILPPSELAADLYNLTQEITALHGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVK------------------VGSHRVAISI 297
           H+  GAES HNL YWRY  Y G GPGAH R                        R     
Sbjct: 242 HAIPGAESAHNLLYWRYHQYAGFGPGAHGRFIEHAPNHSSACSKTLSSHLENRERYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           EKHPE WL +V K GH  +E E L++EQQA+E L+MGLRL EG+ +  +E L+ + + +E
Sbjct: 302 EKHPEQWLNLVEKTGHGCIETEHLTTEQQANEMLLMGLRLSEGLELIRYETLSPKRIPME 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ Q  IE V   RL+ T +G  +LD +I+ LA
Sbjct: 362 KLIDLQHQELIEMVDNQRLKATTKGRIVLDHIISQLA 398


>gi|83720503|ref|YP_442123.1| coproporphyrinogen III oxidase [Burkholderia thailandensis E264]
 gi|257138311|ref|ZP_05586573.1| coproporphyrinogen III oxidase [Burkholderia thailandensis E264]
 gi|83654328|gb|ABC38391.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Burkholderia thailandensis E264]
          Length = 405

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 123/383 (32%), Positives = 208/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPEHDYLDALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA+ +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFNEAHLKALGRIHDAAQARAAVEIAARTFENFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLSLY LT+E  T F K        +P ++ + D+ +     T+      YE+S
Sbjct: 207 LTFAPPHLSLYHLTLEPNTYFAKFPPA----VPDDDASADMQDWLHERTAQASYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +S HNLNYW +GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQSKHNLNYWCFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGAAV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL +G+    +    G +L          Q++G I    
Sbjct: 323 QEERE-VGPRDLPFEFMLNALRLVDGVPTHSFAERTGMSLASIGPALAQAQQRGLIVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|227503125|ref|ZP_03933174.1| coproporphyrinogen dehydrogenase [Corynebacterium accolens ATCC
           49725]
 gi|227076186|gb|EEI14149.1| coproporphyrinogen dehydrogenase [Corynebacterium accolens ATCC
           49725]
          Length = 379

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 122/385 (31%), Positives = 183/385 (47%), Gaps = 16/385 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQE---NFIQSFLTEMQWMRQLTGPRSI 71
           +   G+Y+H PFC  +C YCDFN++        ++    ++ +   E++        R+ 
Sbjct: 2   TEPFGLYIHVPFCATRCGYCDFNTYTPGELGSPRDLTGPYLDALDKELEMAAGRV-GRTA 60

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            ++F GGGTPSL+  Q ++ ILD +   + +S + E+T E+NP S     F     AG N
Sbjct: 61  DTVFIGGGTPSLLGGQGLSRILDTVRSTFGLSPDAEVTTESNPESTSPEYFAALADAGFN 120

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEME 190
           RISLG+QS     L+ L R H    A  A   AR   F  ++ D+IY  P +T       
Sbjct: 121 RISLGMQSASHSVLQVLERAHTPGRAFDAAREAREAGFQHVNLDMIYGTPTETDDNVRET 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L R L   VDH+S Y L +E GT   +    G L  P E+V    Y +  S     G   
Sbjct: 181 LDRVLETGVDHVSAYSLIVEDGTRMARKVNKGLLPAPDEDVLARRYEMISSTLEDAGFEW 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN S  G E  HN  YW  G++ G GPGAHS +            KHP  +++ +  
Sbjct: 241 YEVSNWSLPGGECEHNRIYWVDGNWWGAGPGAHSHLGDER----FFNVKHPNRYIQTLGN 296

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
               + + E L+S  +  E +M+GLRLREGI                  +    +G +ER
Sbjct: 297 GELPIKDSETLTSPDRHMEKVMLGLRLREGIPEAWLGSH-----AAPALKGFIDRGLLER 351

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               R+R T+ G  + D ++++L +
Sbjct: 352 -AGQRVRVTKPGRLLADGIVSDLLI 375


>gi|271963813|ref|YP_003338009.1| coproporphyrinogen dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270506988|gb|ACZ85266.1| Coproporphyrinogen dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 403

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 121/395 (30%), Positives = 190/395 (48%), Gaps = 20/395 (5%)

Query: 8   ENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQ 64
           ++ + G G    G YVH PFCV +C YCDFN++           +++  + + E++  R 
Sbjct: 19  DSALHGLGGRPFGFYVHVPFCVTRCGYCDFNTYTASELGPGASHKDYADTAIDEVRRARA 78

Query: 65  LTGP--RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNF 122
             G     + ++FFGGGTP+L+   ++  IL  I + + ++   E+T EANP SV+    
Sbjct: 79  NLGGADLPVETVFFGGGTPTLLPAGDLVRILGAIEEEFGLAPGAEVTTEANPESVDPAYL 138

Query: 123 QGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPK 181
              R  G  R+S G+QS  E  L  L R H       A+  AR   F  ++ DLIY+ P 
Sbjct: 139 SELRGGGFTRMSFGMQSAREHVLEVLERRHTPGRPAHAVREAREAGFDHVNLDLIYSTPG 198

Query: 182 QTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQS 241
           ++   W   L  A+    DH+S Y L +E GT      + G+L +P ++VA D Y +  +
Sbjct: 199 ESDDDWRASLAAAIEAGPDHVSAYSLIVEDGTRLAARIRRGELPMPDDDVAADRYLIADA 258

Query: 242 ITSAHGLHAYEISNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
           + +  G   YE+SN +        HNL YW  GD+ G+GPGAHS V            KH
Sbjct: 259 MLAEAGFEWYEVSNWATSEAGRCRHNLLYWTGGDWWGVGPGAHSHVGGTR----WWNVKH 314

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           P ++ + +         +E L++E +A E LM+ LRL +G  +K+ E             
Sbjct: 315 PAAYARRLASGVSPAHAREVLTAEDRAVERLMLELRLVQGFPLKEIER-------PPVVA 367

Query: 361 NLQRQGFIER--VQFSRLRCTQRGMTMLDSVIANL 393
                G +E    +  R   T RG  + D+++ +L
Sbjct: 368 RALADGLLEMEPFKAGRAVLTLRGRLLADALVRDL 402


>gi|310817158|ref|YP_003965122.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
 gi|308755893|gb|ADO43822.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare Y25]
          Length = 390

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 175/378 (46%), Positives = 235/378 (62%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC+ KCPYCDFNSHV +  + Q  +  ++  E+  +   T  R ++S+FFG
Sbjct: 14  GFGLYIHWPFCMAKCPYCDFNSHVAQ-HIDQSRWAAAYEVEIDRIAAETEGRVLNSVFFG 72

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +  +L  +   W+++++VEIT+EANP+SVE   F GYR AGVNRIS+GV
Sbjct: 73  GGTPSLMLPETVDRVLSRVRARWSLANDVEITLEANPTSVEAGRFHGYRDAGVNRISMGV 132

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           QSL E+ L+ LGR H+ +EA AA  +AR++F R+SFDLIYA   QT   W  EL  ALS 
Sbjct: 133 QSLNERDLKALGRMHSVTEARAAFDIARDVFDRVSFDLIYARQHQTPEDWRAELSEALSM 192

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE  T F   +  G L   P E+ A +++++TQ +    G  AYEISNH
Sbjct: 193 AVDHLSLYQLTIEPNTAFGARYDRGLLRGLPDEDNADEMWDITQEVADRLGFPAYEISNH 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAES HN  YWRYGDY GIGPGAH R+ +   R A      P  WL+ V K G +  
Sbjct: 253 ARAGAESRHNSVYWRYGDYAGIGPGAHGRLTLNGQRYATETPLAPGRWLEDVEKTGKSET 312

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +  L+   Q +EF+MMGLRL EGIS      L G  L       +   G +E+V    L
Sbjct: 313 VRAALTPTDQLEEFVMMGLRLSEGISKARLYRLGGARL-QANIDRVIEIGMLEQV-GDSL 370

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T  G  +L++++  + 
Sbjct: 371 RTTTAGRPVLNAILREVL 388


>gi|91784890|ref|YP_560096.1| coproporphyrinogen III oxidase [Burkholderia xenovorans LB400]
 gi|91688844|gb|ABE32044.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Burkholderia xenovorans LB400]
          Length = 409

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 126/382 (32%), Positives = 212/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  +     +  ++ +   +++    L   R + ++F
Sbjct: 31  PPLALYVHFPWCVRKCPYCDFNSHEWKGDTFPETEYLDALRADLEMALPLVWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E + F  +R +GV+R+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEADKFAQFRASGVSRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++++A  A+ +A   F   + DL++ALP QT+ + + +++ AL
Sbjct: 151 GIQSFNEAHLKALGRIHDSAQARHAVEVASTTFDNFNLDLMFALPGQTLAECQADVEMAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIHERTSAAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 267 YARPHRQSRHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPTTFIEQAKAGTAVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E + +     EF++  LRL EG  V  +    G ++       +  +R+  I R   
Sbjct: 327 EEHE-VGTRDLPFEFMLNALRLVEGFPVHRFIERTGMSMTSIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 385 EKIAPTPLGQAFLND-LQELFL 405


>gi|255323729|ref|ZP_05364857.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Corynebacterium tuberculostearicum SK141]
 gi|255299219|gb|EET78508.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Corynebacterium tuberculostearicum SK141]
          Length = 379

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 121/385 (31%), Positives = 178/385 (46%), Gaps = 16/385 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQE---NFIQSFLTEMQWMRQLTGPRSI 71
           +   G+Y+H PFC  +C YCDFN++        ++    ++ +   E++        R  
Sbjct: 2   TEPFGLYIHVPFCATRCGYCDFNTYTPGELGSPRDLTGPYLDALDRELELAAARV-GRPA 60

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            ++F GGGTPSL+  Q ++ IL+ +   + +    E+T E+NP S     F     AG  
Sbjct: 61  ETVFIGGGTPSLLGGQGLSRILNTVRSTFGLKPGAEVTTESNPESTSPEYFAQLADAGYT 120

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEME 190
           RISLG+QS     L+ L R H    A  A   AR   F  ++ D+IY  P +T       
Sbjct: 121 RISLGMQSASPGVLQVLERAHTPGRAFDAAREARAAGFEHVNLDMIYGTPTETDDNVRET 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L R L   VDH+S Y L +E GT   +    G L  P E+V    Y +  S   + G   
Sbjct: 181 LDRVLETGVDHVSAYSLIVEDGTRMARKVNKGILPAPDEDVLARRYEMISSTLESEGFEW 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN S  G E  HN  YW  G++ G GPGAHS +            KHP  ++  + +
Sbjct: 241 YEVSNWSKPGGECEHNRIYWVDGNWWGAGPGAHSHLGNER----FFNVKHPSRYIDTLGR 296

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
               + E E L+   +  E +M+GLRLREGI     +                 +G +ER
Sbjct: 297 GELPIKETETLTEADRHMEKIMLGLRLREGIPEAWLDTH-----AAPALERFIGRGLLER 351

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               R+R T+ G  + D +I +L V
Sbjct: 352 -AGDRVRITKPGRLLADGIITDLLV 375


>gi|227833636|ref|YP_002835343.1| oxygen-independent coproporphyrinogen III oxidase [Corynebacterium
           aurimucosum ATCC 700975]
 gi|227454652|gb|ACP33405.1| oxygen-independent coproporphyrinogen III oxidase [Corynebacterium
           aurimucosum ATCC 700975]
          Length = 382

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 118/382 (30%), Positives = 178/382 (46%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRY--KVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           +  G+Y+H PFC  +C YCDFN++           +++ +   E++        R   ++
Sbjct: 2   DPFGLYIHVPFCASRCGYCDFNTYTPGELGGDLTSDYLVALEKELEMAAVQV-DREAETV 60

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+  + +  +L  +   + ++   E+T E+NP S     F G   AG  R+S
Sbjct: 61  FIGGGTPSLLGAEGLGRVLSKVRDTFGLAPGAEVTTESNPESTSPEYFAGLLDAGFTRLS 120

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAA-IHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           LG+QS     L  L R H    A  A        F  ++ D+IY  P +      + L+R
Sbjct: 121 LGMQSASPGVLAVLERAHTPGRAFDAAREAIAAGFEHVNLDMIYGTPTEEDADVALTLER 180

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL   VDH+S Y L +E GT   +    G L  P E+V    Y +  S   A G   YE+
Sbjct: 181 ALETGVDHISAYSLIVEDGTRMARKVSKGLLPAPDEDVLARRYEMISSTLEAEGFEWYEV 240

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SN +  G E  HN  YW  G++ G GPGAHS +            K+P +++K V +   
Sbjct: 241 SNWAKPGGECQHNRIYWVDGNWWGAGPGAHSHLGNER----FYNVKNPRTYIKAVGEGEL 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
            + E+E L+   +  E +M+GLRLREG+                       +G +ER   
Sbjct: 297 PIKEREQLTEADRHTERIMLGLRLREGMPASWLA-----PAAEPVAARSIERGLLER-AG 350

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            RLR T+ G  + D +I +L V
Sbjct: 351 DRLRVTKAGRLLADGIITDLLV 372


>gi|77461548|ref|YP_351055.1| coproporphyrinogen III oxidase [Pseudomonas fluorescens Pf0-1]
 gi|77385551|gb|ABA77064.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 401

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 128/376 (34%), Positives = 209/376 (55%), Gaps = 10/376 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R +SSIFFGGGTP
Sbjct: 32  YIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDAMLADLDQDLHAVYGRELSSIFFGGGTP 91

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           SL   + +  +L+G+ +    + ++EIT+EANP + E   F  YRK G+NR+S+G+QS +
Sbjct: 92  SLFSAEALGRLLEGVKQRIPFADDIEITLEANPGTFEQEKFVAYRKLGINRLSIGIQSFQ 151

Query: 142 EQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           ++ L+ LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A+     
Sbjct: 152 QEKLKALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPDQSLDDALSDLRQAIELKPT 211

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           H+S YQLT+E  T+F+        VLP ++   D+    Q++ + HG   YE+S ++  G
Sbjct: 212 HISWYQLTLEPNTVFWNQPP----VLPEDDTLWDIQEAGQALLAEHGYAQYEVSAYAQPG 267

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
             + HNLNYW +GD+IGIG GAH ++     R+              +         ++ 
Sbjct: 268 RPARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVR--TWKTRLPKDYLNPAKSFQAGEKA 325

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQFSRLRC 378
           L++++   EFLM  LRL  G+  + +    G +LD   E  R  ++ G + +V+ SRL  
Sbjct: 326 LTNDEMPFEFLMNALRLTAGVESRLYPERTGLSLDTLAEGRREAEQSGLL-QVEPSRLAT 384

Query: 379 TQRGMTMLDSVIANLA 394
           T+RG   L+ ++    
Sbjct: 385 TERGQLFLNDLLQQFL 400


>gi|58580763|ref|YP_199779.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622694|ref|YP_450066.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578266|ref|YP_001915195.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425357|gb|AAW74394.1| oxidoreductase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366634|dbj|BAE67792.1| oxidoreductase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188522718|gb|ACD60663.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 385

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 134/389 (34%), Positives = 210/389 (53%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  P  I   L   +     + N+E+T+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPDAIDRFLQAASARLRFAPNLEMTLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H++++A  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSADAERAIKLAQDAGYDNFNIDLMYALPEQTLLQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLANAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-SHRVAISIEKHPESWLKMV 308
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G    V    +          
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLAS 297

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQG 366
                ++   E +  E+   E+++  LRL EG  + D+E   G   ++          QG
Sbjct: 298 AGTAASIGGDEIVPRERLPFEYMLNLLRLHEGFRLSDFEASTGLAASVIEVPLARALAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ R Q  R+  T+ G    + V+  L +
Sbjct: 358 WMTR-QDGRVVPTELGRRFTNDVV-ELFL 384


>gi|306836636|ref|ZP_07469602.1| coproporphyrinogen dehydrogenase [Corynebacterium accolens ATCC
           49726]
 gi|304567466|gb|EFM43065.1| coproporphyrinogen dehydrogenase [Corynebacterium accolens ATCC
           49726]
          Length = 379

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 121/385 (31%), Positives = 181/385 (47%), Gaps = 16/385 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQE---NFIQSFLTEMQWMRQLTGPRSI 71
           +   G+Y+H PFC  +C YCDFN++        ++    ++ +   E++        R+ 
Sbjct: 2   TEPFGLYIHVPFCATRCGYCDFNTYTPGELGSPRDLTGPYLDALDKELEMAAGRV-GRTA 60

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            ++F GGGTPSL+  Q ++ ILD +   + +S + E+T E+NP S     F     AG N
Sbjct: 61  DTVFIGGGTPSLLGGQGLSRILDTVRSTFGLSPDAEVTTESNPESTSPEYFAALADAGFN 120

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEME 190
           RISLG+QS     L+ L R H    A  A   AR   F  ++ D+IY  P +T       
Sbjct: 121 RISLGMQSASHSVLQVLERAHTPGRAFDAAREAREAGFQHVNLDMIYGTPTETDDNVRET 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L R L   VDH+S Y L +E GT   +    G L  P E+V    Y +  S     G   
Sbjct: 181 LDRVLETGVDHVSAYSLIVEDGTRMARKVNKGLLPAPDEDVLARRYEMISSTLEEAGFEW 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN S  G E  HN  YW  G++ G GPGAHS +            KHP  +++ +  
Sbjct: 241 YEVSNWSLPGGECEHNRIYWVDGNWWGAGPGAHSHLGDER----FYNVKHPNRYIQTLGN 296

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
               + + E L+   +  E +M+GLRLREGI                       +G +ER
Sbjct: 297 GELPIKDSETLTGADRHMEKVMLGLRLREGIPESWLGSH-----AAPALEGFIDRGLLER 351

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               R+R T+ G  + D ++++L +
Sbjct: 352 -AGQRVRVTKPGRLLADGIVSDLLI 375


>gi|187478425|ref|YP_786449.1| coproporphyrinogen III oxidase [Bordetella avium 197N]
 gi|115423011|emb|CAJ49541.1| putative oxygen-independent coprophorphyrinogen III oxidasee
           [Bordetella avium 197N]
          Length = 405

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 125/383 (32%), Positives = 212/383 (55%), Gaps = 10/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L VYVH P+CV+KCPYCDFNSH      + +  ++ +   +++    L   R + S+F
Sbjct: 29  PPLSVYVHVPWCVRKCPYCDFNSHAMPGQDIPERAYLDALRADLEQAVPLVWGRQVISVF 88

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     +  + EIT+EANP + E + F  Y  +GV R SL
Sbjct: 89  IGGGTPSLLSAAGLDELLAMLRACLNLLPDAEITMEANPGTAEASRFLDYAASGVTRFSL 148

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS ++  L  LGR H++++A AAI +A+    R++ D+++ALP Q +     +L+ AL
Sbjct: 149 GIQSFDDAQLHKLGRIHDSAQARAAIEMAQRAVSRVNLDVMFALPGQDINACVADLREAL 208

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+  +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++  +  GL  YE+S 
Sbjct: 209 SFGTEHLSLYHLTLEPNTVFAKYPPE----LPDDDDSAAMQDAVEATLADAGLARYEVSA 264

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHA 314
           ++  GA   HN+NYW +GDY+G+GPGAH ++      V  +  ++PESW++     +G  
Sbjct: 265 YARQGARCKHNVNYWEFGDYLGLGPGAHGKLSFHDRIVREARHRNPESWMQRAMARDGSH 324

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
           V E   +  ++   EF++  LRL++G++   +    G +L           ++G ++   
Sbjct: 325 VAENRQVGPDELPFEFMLNALRLKDGVAASSFSERTGLSLAAIAHQLDAASQRGLLD-AD 383

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +RLR T  G   L+  +  + +
Sbjct: 384 PTRLRATALGWRFLND-LQEIFL 405


>gi|146309173|ref|YP_001189638.1| coproporphyrinogen III oxidase [Pseudomonas mendocina ymp]
 gi|145577374|gb|ABP86906.1| coproporphyrinogen III oxidase, anaerobic [Pseudomonas mendocina
           ymp]
          Length = 386

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 127/380 (33%), Positives = 211/380 (55%), Gaps = 8/380 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++    +    R ++SIFF
Sbjct: 12  PPLALYIHIPWCVRKCPYCDFNSHAAGPTLPEEEYVDALLADLDANLRHVHGRPLTSIFF 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    + ++EIT+EANP + E   F+GYR  G+NR+S+G
Sbjct: 72  GGGTPSLFSDRALGRLLEGVERRVAFAPDIEITLEANPGTFEQAKFKGYRALGINRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +E  L+ LGR H+ +EA+ A  +AR   F   + DL++ LP+Q++     +L+ A+
Sbjct: 132 VQSFQEAKLKALGRIHDGNEAVRAADMARAAGFDNFNLDLMHGLPEQSIEDALFDLRTAI 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S    HLS YQLT+E  T+F+        VLP +++  D+    Q++ +A G   YE+S 
Sbjct: 192 SQGPTHLSWYQLTMEPNTVFWSQPP----VLPEDDLLWDIQEAGQALLAAEGYAQYEVSA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G ++ HNLNYW +GD++GIG GAH+++     R+  S +         +       
Sbjct: 248 YAQTGKQARHNLNYWTFGDFLGIGAGAHAKLSAPDGRILRSWKTRL--PKDYLDPAKVFQ 305

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQG-FIERVQFS 374
             +  L +++   EFLM  LRL +G+  + +    G  L        + +G  + R +  
Sbjct: 306 AGERVLGADELPFEFLMNVLRLTDGVPARLFSERTGLPLASLDAARAEAEGRKLLRAEPE 365

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RL  T  G   L+ ++ +  
Sbjct: 366 RLCATAEGQLFLNDLLQHFL 385


>gi|296160049|ref|ZP_06842869.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           Ch1-1]
 gi|295889795|gb|EFG69593.1| oxygen-independent coproporphyrinogen III oxidase [Burkholderia sp.
           Ch1-1]
          Length = 409

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 211/382 (55%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH+P+CV+KCPYCDFNSH  +     +  ++ +   +++    L   R + ++F
Sbjct: 31  PPLALYVHFPWCVRKCPYCDFNSHEWKGDTFPENEYLDALRADLEMALPLVWGRQVHTVF 90

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S+
Sbjct: 91  IGGGTPSLLSAAGLDRMLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLSV 150

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS  E  L+ LGR H++++A  A+ +A   F   + DL++ALP QT+ + + +++ AL
Sbjct: 151 GIQSFNEAHLKALGRIHDSAQARHAVEVASTTFDNFNLDLMFALPGQTLAECQTDVETAL 210

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+A  HLSLY LT+E  TLF K        LP ++ + D+ +     TSA G   YE+S 
Sbjct: 211 SFAPPHLSLYHLTLEPNTLFAKFPPA----LPDDDASADMQDWIHERTSAAGYERYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++    +S HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +      
Sbjct: 267 YAQPHRQSKHNLNYWRFGDYLGIGAGAHTKLSFPNRVLRQARYKHPTTFIEQAKAGTAVQ 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E E + +     EF++  LRL EG  V  +    G ++       +  +R+  I R   
Sbjct: 327 EEHE-VGTRDLPFEFMLNALRLVEGFPVHRFIERTGMSMTSIEPALQEAERRKLITR-DH 384

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            ++  T  G   L+  +  L +
Sbjct: 385 EKIAPTPLGQAFLND-LQELFL 405


>gi|325922289|ref|ZP_08184070.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas gardneri
           ATCC 19865]
 gi|325547242|gb|EGD18315.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas gardneri
           ATCC 19865]
          Length = 385

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 137/389 (35%), Positives = 211/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M+      L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MSDLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDNDLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  PQ I   L   A     + N+EIT+E NP + E   F GY  AGV
Sbjct: 61  VHSVFFGGGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFDGYLAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLAQAER 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    H+S YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPTHMSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G+ +  +   KH      +  
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEQHVLRRWKHKHPQSYLAS 297

Query: 310 KNGHAVVEK-EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQG 366
               A +   E +   +   E+++  LRL EG  + D+E   G               QG
Sbjct: 298 AGNAASIGGDEVVPRARLPFEYMLNVLRLHEGFRLSDFEASTGLEASEIAAPLARAVAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++   Q  R+  T+ G    + V+  L +
Sbjct: 358 WMTE-QDGRVIPTELGRRFTNDVV-ELFL 384


>gi|304410077|ref|ZP_07391696.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica OS183]
 gi|307302211|ref|ZP_07581969.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica BA175]
 gi|304351486|gb|EFM15885.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica OS183]
 gi|306914249|gb|EFN44670.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica BA175]
          Length = 388

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 132/382 (34%), Positives = 205/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R I +IF 
Sbjct: 15  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLVQGRQIHTIFI 74

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S N+EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 75  GGGTPSLFDALQIKRILDGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 134

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 135 VQSFSKDKLNLLGRIHDQNEAQVAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 195 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQKLAALGYEQYEISA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 251 YAKPGYQCKHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLSAS----N 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E   ++ E +A E+LM  LRL   I  +++E+  G  R+   E     +++G +   
Sbjct: 307 YTFESIEVAEEDRALEYLMNRLRLMTPIPKQEFELRTGQHRDTLTEGMEKAKQRGLLTE- 365

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 366 SAEHWQLTSKGHMFVNDLLTQF 387


>gi|167837504|ref|ZP_02464387.1| coproporphyrinogen III oxidase [Burkholderia thailandensis MSMB43]
          Length = 405

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 126/383 (32%), Positives = 208/383 (54%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV--GQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH+P+CV+KCPYCDFNSH  +      + +++ +   +++    L   R + ++
Sbjct: 27  PPLALYVHFPWCVRKCPYCDFNSHEWKDGGALPERDYLGALRADLEHALPLVWGRQVHTV 86

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+    +  +L  +     + ++ EIT+EANP + E   F  +R +GVNR+S
Sbjct: 87  FIGGGTPSLLSAAGLDRLLSDVRALLPLDADAEITLEANPGTFEAAKFAQFRASGVNRLS 146

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +G+QS  E  L+ LGR H+A++A AA  +A   F   + DL++ALP QT+ +   +L+ A
Sbjct: 147 IGIQSFSEAHLKALGRIHDATQARAAAEIAARTFDNFNLDLMFALPNQTLDECRADLETA 206

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           LS+A  HLSLY LT+E  T F K        +P ++ + D+ +     T+  G   YE+S
Sbjct: 207 LSFAPPHLSLYHLTLEPNTYFAKFPP----TVPDDDTSADMQDWLHERTAQAGYARYEVS 262

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++    +  HNLNYWR+GDY+GIG GAH+++   +  +  +  KHP ++++  +     
Sbjct: 263 AYAKPHRQCRHNLNYWRFGDYLGIGAGAHTKLSFPNRILRQARYKHPATFIEQAKAGAAV 322

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQ 372
             E+E +       EF++  LRL EG+    +    G +L          +R+G I    
Sbjct: 323 QEERE-VGPHDLPFEFMLNALRLVEGVPTHSFAERTGMSLASIGPALAQAERRGLIVH-D 380

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +R+  T  G   L+  +  L +
Sbjct: 381 HTRIAPTPLGQRFLND-LQALFL 402


>gi|157372269|ref|YP_001480258.1| coproporphyrinogen III oxidase [Serratia proteamaculans 568]
 gi|157324033|gb|ABV43130.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Serratia proteamaculans 568]
          Length = 379

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 204/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   L ++     L   R +S+IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLLADLDADLPLVAGREVSTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     V    EIT+EANP +VE + F GY++AGVNRIS+G
Sbjct: 65  GGGTPSLLSAEAMQSLLDGVRARIHVVDGAEITMEANPGTVEADRFSGYQRAGVNRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSAEKLTRLGRIHGPEEAKRAAHLATGLGLRSFNLDLMHGLPDQSLEEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF         VLP ++   D++     + SA G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFERGHELLSAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  +     ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRILRTA----KTKHPRGFMQGKYM 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
            ++  +++  +  EF M   RL E     ++    G +             +G++E    
Sbjct: 297 DKQHEVTTADRPFEFFMNRFRLLEAAPRAEFVNYTGLDESTIRAPLDEALAKGYLEET-P 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T++G   L+S++  L +
Sbjct: 356 EYWQITEKGKLFLNSLL-ELFL 376


>gi|332970354|gb|EGK09346.1| oxygen-independent coproporphyrinogen III oxidase [Kingella kingae
           ATCC 23330]
          Length = 386

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 133/382 (34%), Positives = 217/382 (56%), Gaps = 8/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C++KCPYCDFNSH  +  + +  +IQ+ LT++Q        R I +IF 
Sbjct: 10  PPLSLYIHIPWCIQKCPYCDFNSHKIKTTLDENAYIQALLTDLQSELPYFWGRPIDTIFI 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPS+   + I  +L GI     ++   EIT+EANPS+ E++ FQG++ AG+NR+S+G
Sbjct: 70  GGGTPSVFSAKAIDQLLSGIRALVKLNPETEITLEANPSTFEIDKFQGFKDAGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           VQS ++  L+ LGR HNA EA  AI +A  IF R++ DL+YALP QT+     +++ A++
Sbjct: 130 VQSFDDAKLKTLGRIHNAHEAKNAIEVATQIFERVNIDLMYALPHQTVQAACDDIRTAIA 189

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   H+S YQLT+E  T F      G   LP ++ A D+ +   +  +  G   YE S  
Sbjct: 190 FGTTHISAYQLTLEPNTPFGHTPPQG---LPEDDNAQDIEDAIHAELAQAGFVQYETSAF 246

Query: 257 SFLGAES-LHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           +    +   HN+NYW++GDYIGIG GAH ++         + ++HP  +L  ++ N H  
Sbjct: 247 AKSPNQQARHNVNYWQFGDYIGIGAGAHGKLSHHDRIERTTRKRHPSDYLLAMQTNPHDA 306

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
           +E++ ++ +    EF+M  LRL +G+    +    G ++    +  +  Q++G ++    
Sbjct: 307 IERKMVAPQDLPFEFMMNALRLVDGVPSAYFGERTGVSVAKISQQIKIAQQRGLLD-SNP 365

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              R T  G   L+ +I  + +
Sbjct: 366 MFFRPTDLGRRFLNDLI-EIFL 386


>gi|117919637|ref|YP_868829.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. ANA-3]
 gi|117611969|gb|ABK47423.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. ANA-3]
          Length = 385

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 205/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L +++    L   R + +IF 
Sbjct: 12  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQKAYVDTLLADLRQDLHLVQGRKLHTIFI 71

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S ++EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 72  GGGTPSLFDANQIKRILDGANALIPFSDDIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 131

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 132 VQSFSKDKLNLLGRIHDQNEAQTAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 191

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 192 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEDLWQIYEQGQQKLAALGYEQYEISA 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 248 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLAA----DN 303

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E+  ++ E +A E+LM  LRL   I  +++E   G  R+   E     +++G +   
Sbjct: 304 YHFEQTEVAEEDRALEYLMNRLRLMTPIPKQEFEDRTGLHRDSLKEGMEKAKQRGLLTE- 362

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 363 SAEHWQLTSKGHMFVNDLLTQF 384


>gi|254482747|ref|ZP_05095985.1| putative oxygen-independent coproporphyrinogen III oxidase [marine
           gamma proteobacterium HTCC2148]
 gi|214037106|gb|EEB77775.1| putative oxygen-independent coproporphyrinogen III oxidase [marine
           gamma proteobacterium HTCC2148]
          Length = 378

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 128/381 (33%), Positives = 197/381 (51%), Gaps = 12/381 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C +KCPYCDFNSH     V ++ +I + L ++     +   R I ++F 
Sbjct: 4   PPLSLYIHLPWCERKCPYCDFNSHES-SHVPEQAYITALLQDLDADLAMAAGREIQTLFI 62

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + I+ +L GI     ++ + E T+EANP S E + F G+R+AG+NR+SLG
Sbjct: 63  GGGTPSLFSAEAISRLLAGIGDRLELAPDAEATMEANPGSAEADKFLGFRQAGINRLSLG 122

Query: 137 VQSLEEQSLRFLGRNHNASEAIAA-IHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS ++  L  LGR H++ +A AA  + +   F   + DL++ LP QT      +L+ A+
Sbjct: 123 VQSFQDDKLGALGRVHDSKQARAAIEYASAAGFDSFNIDLMHGLPGQTEADAIYDLETAI 182

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+   HLS YQLTIE  T+F K        LP E+   D+ +  + +    G   YE+S 
Sbjct: 183 SFHPPHLSWYQLTIEPNTVFNKRPP----TLPVEDALADIQDRGELLLENQGYAQYEVSA 238

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           +S    +  HNLNYW +GDY+ +G GAH ++      +    +       +   +     
Sbjct: 239 YSRPELQCQHNLNYWSFGDYLALGAGAHGKITTADGSIRRYAKT---RAPQDYLQGERYT 295

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
             K  L+  +   EF+M  LRL  G S + +E + G + D      ++L  +  +     
Sbjct: 296 ASKRVLNQGELIGEFMMFALRLNNGFSTQRFEQVTGLSADQLRPKVQSLADRELLS-TDG 354

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             +R T  G   LDSVIA   
Sbjct: 355 DNIRATPLGRRFLDSVIAEFL 375


>gi|51891621|ref|YP_074312.1| coproporphyrinogen III oxidase [Symbiobacterium thermophilum IAM
           14863]
 gi|51855310|dbj|BAD39468.1| coproporphyrinogen III oxidase [Symbiobacterium thermophilum IAM
           14863]
          Length = 416

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 126/416 (30%), Positives = 201/416 (48%), Gaps = 40/416 (9%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMR--QLTGPRSISSIF 75
            +G+YVH PFC+ KC YCDFNSH    +  Q +++ + L EM+            +S+++
Sbjct: 2   PIGLYVHIPFCLHKCGYCDFNSHAGSDRAEQAHYVDALLREMELWATRPEVAGEQVSTVY 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN--NFQGYRKAGVNRI 133
            GGGTP+L+E   +A +L G+ +++ ++ + E+T+E NP +V+V         +AG  R+
Sbjct: 62  VGGGTPTLLEGAELARVLRGVREHFRLAPDAEVTVEGNPGTVDVEGEKLHLAVQAGATRL 121

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQ 192
           SLGVQ+ +   L  LGR H+A +  AA+  AR      ++ DL+Y LP QT   +   + 
Sbjct: 122 SLGVQARQRHLLERLGRIHDALQVEAAVKAARRAGFANLNLDLMYGLPGQTPADFRETVS 181

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            AL     H+S Y L IE+GT FY  +  G L LP E     ++   +++  A G   YE
Sbjct: 182 WALGLGPTHISAYSLIIEEGTPFYHAYLAGRLHLPPEEAEEQMFLEGKALLEAAGFEHYE 241

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV-------------------------- 286
           +SN +  G    HNL YWR   Y+G+G GAHS +                          
Sbjct: 242 VSNWARPGFRCRHNLIYWRNEHYLGLGCGAHSFLRLAAPLSNLGPPRPGLTASRVQGGSP 301

Query: 287 -----KVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGI 341
                 +   +      KHP ++   + +    V   E +    +  E + MGLRL EG+
Sbjct: 302 VETAPGLPGQQYRFWNLKHPGAYRAALERGVLPVEAGEVVDRRAEMAETMFMGLRLLEGV 361

Query: 342 SVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           S + +E   G ++          L+R+G +E  + + LR T RG+ + + V     
Sbjct: 362 SGERFEARFGVSIADVYGPDVDRLRREGLLEWAEGA-LRLTPRGLRLGNRVWEAFV 416


>gi|120598141|ref|YP_962715.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. W3-18-1]
 gi|120558234|gb|ABM24161.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella sp. W3-18-1]
          Length = 387

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 129/380 (33%), Positives = 200/380 (52%), Gaps = 10/380 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R + +IF 
Sbjct: 14  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLVQGRQVHTIFI 73

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + + I  IL+G       S N+EIT+EANP ++E ++F  YR AG+ R+S+G
Sbjct: 74  GGGTPSLFDAKQIKRILEGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGITRLSIG 133

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 134 VQSFAKDKLNLLGRIHDQNEAKIAAQKASQAKYLSFNLDLMHGLPNQSFDEAMADIDTAA 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 194 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQRLAALGYEQYEISA 249

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYW++GDY+GIG GAH +V +      I   K      K    +    
Sbjct: 250 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEQNRIIRTVKI--KHPKGYLSSNQYT 307

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERVQF 373
           VE   ++ E +A E+LM  LRL   I  +++E   G  R    E     +++G +     
Sbjct: 308 VELTEVAEEDRALEYLMNRLRLMTPIPKQEFEQRTGLHRETLSEGMEKAKQRGLLTE-SA 366

Query: 374 SRLRCTQRGMTMLDSVIANL 393
              + T +G   ++ ++   
Sbjct: 367 EYWQLTHKGHMFVNDLLTQF 386


>gi|56476730|ref|YP_158319.1| coproporphyrinogen III oxidase [Aromatoleum aromaticum EbN1]
 gi|56312773|emb|CAI07418.1| Oxygen-independent coprophorphyrinogen III oxidase [Aromatoleum
           aromaticum EbN1]
          Length = 407

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 140/387 (36%), Positives = 204/387 (52%), Gaps = 12/387 (3%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQLTGPRS 70
             S  L +YVH+P+CVKKCPYCDFNSH  R    ++ ++ +I + L +++        R 
Sbjct: 26  TASPPLALYVHYPWCVKKCPYCDFNSHASRGGPGEIPEQAYIDALLADIETALPQVWGRR 85

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+F GGGTPSL+    +  +L G+     +    EIT+EANP +VE   F+ Y  AGV
Sbjct: 86  VLSVFIGGGTPSLMSAAALDRLLTGVRMLLQLDPLAEITLEANPGTVEAGRFRDYCAAGV 145

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLG+QS ++  L  LGR H+  EA  AI  A   F R++ DL+YALP+QT  Q   +
Sbjct: 146 NRLSLGIQSFDDAQLVRLGRIHDGREARVAIDTALANFDRVNLDLMYALPEQTPEQALAD 205

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L  AL+    HLS YQLT+E  T F+         LP  + A D+ +  ++     G   
Sbjct: 206 LDTALATGATHLSCYQLTLEPNTPFHHAPP----PLPDTDTAADMQDAIEARLGGAGFRH 261

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE S  +  G E  HNLNYW +GDY+GIG GAH ++      V     KHP  +L    K
Sbjct: 262 YETSAFARPGEECRHNLNYWTFGDYLGIGAGAHGKLSSFEGIVREMRHKHPGRYLDA-AK 320

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFI 368
           +   V E+  +   +   EF+M  LRL  G+  + +    G  L    +  +  + QG +
Sbjct: 321 SREFVQERRTIGVTELPFEFMMNALRLSGGVPRRLFAERTGLPLAVIEDELKAAREQGLV 380

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLAV 395
           E      +R T+RG   L+ ++  L +
Sbjct: 381 EVT-PELIRPTERGRHFLNDLLT-LFL 405


>gi|66043738|ref|YP_233579.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254445|gb|AAY35541.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas syringae pv. syringae B728a]
          Length = 404

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 203/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI  A    R  F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARRAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIVR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|220936123|ref|YP_002515022.1| oxygen-independent coproporphyrinogen III oxidase [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219997433|gb|ACL74035.1| oxygen-independent coproporphyrinogen III oxidase [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 387

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 126/384 (32%), Positives = 198/384 (51%), Gaps = 12/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  R  V +  ++ + L +++        R + S+F 
Sbjct: 4   PPLSLYIHLPWCVRKCPYCDFNSHEAREAVPEAAYVDALLADLESELPRVWGRRLESVFL 63

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P+ +  +   +        ++E+T+EANP + +   F+GYR+AGVNR+S+G
Sbjct: 64  GGGTPSLFSPEALDHLFSELRARLPWRPDMEVTLEANPGTTDAGRFRGYREAGVNRLSIG 123

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS ++  LR LGR H A EA  A   AR+  F  ++ DL++ LP QT+     +L   L
Sbjct: 124 VQSFDDDQLRQLGRIHGAREARVAFEAARSAGFENINIDLMFGLPGQTVAGALKDLAEGL 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +   +HLS YQLT+E  T F         VLP E+   D++   Q   +  G   YE+S 
Sbjct: 184 ALGPEHLSWYQLTLEPNTRFAAQPP----VLPEEDTLWDMHTAGQEHLAEAGYTQYEVSA 239

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G    HNLNYW +GDY+GIG GAH ++ +      +     + P  +++  R    
Sbjct: 240 YARAGRPCRHNLNYWEFGDYLGIGAGAHGKISLPAEGRILRRWKHRQPRQYMEAARSGEA 299

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
           A  E   L+ E+   EF++  +RL +G+ +  +    G   +           +G +   
Sbjct: 300 ASGE-HTLTREETVFEFMLNAMRLNQGVPLALFTERTGLAPEALEPMRGEAVARGLLT-D 357

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              RL  T+ G   L+  +  L +
Sbjct: 358 DPERLEPTELGRRFLND-LQALFL 380


>gi|311106530|ref|YP_003979383.1| oxygen-independent coproporphyrinogen III oxidase 2 [Achromobacter
           xylosoxidans A8]
 gi|310761219|gb|ADP16668.1| oxygen-independent coproporphyrinogen III oxidase 2 [Achromobacter
           xylosoxidans A8]
          Length = 406

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 122/382 (31%), Positives = 217/382 (56%), Gaps = 8/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L VYVH P+CV+KCPYCDFNSH    ++ +  ++ +  ++++        R + S+F 
Sbjct: 30  PPLSVYVHVPWCVRKCPYCDFNSHAAPGEIPERAYLDALRSDLEQALPSIWGRQVVSVFI 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +L  +     +  + EIT+EANP + E   F+ Y  +GV R SLG
Sbjct: 90  GGGTPSLLSSEGLDELLAMLRACLNLWPDAEITMEANPGTAEAGRFRDYAASGVTRFSLG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS ++  L+ LGR H++++A AAI +A+    R++ D+++ALP QT+     +L++A++
Sbjct: 150 IQSFDDAQLKKLGRIHDSAQARAAIEMAQRAVSRVNLDMMFALPGQTLEACVADLRQAVA 209

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++  +A GL  YE+S +
Sbjct: 210 FGTEHLSLYHLTMEPNTVFAKFPPED---LPDDDTSAAMQDAVEAELAAAGLARYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAV 315
           +  GA   HNLNYW +GDY+G+GPGAH ++      +  +  + P+SW++     +G  +
Sbjct: 267 AKPGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRILREARLRSPDSWMQAAMARDGSHI 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E   +  ++   EF++  LRL++G++   +    G +L           ++G ++    
Sbjct: 327 AESRQVGPDELPFEFMLNALRLKDGVAATAFNERTGLSLAAIAHQLEAASKRGLLD-ADP 385

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RLR T  G   L+  +  + +
Sbjct: 386 TRLRATPLGWRFLND-LQEMFL 406


>gi|298485015|ref|ZP_07003112.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160425|gb|EFI01449.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 404

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 204/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +       
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSNPDGRIMR--TWKTRLPKDYLNPVKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|330972625|gb|EGH72691.1| HemN family oxidoreductase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 404

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 203/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI  A    R  F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARRAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQEAGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIVR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|330951370|gb|EGH51630.1| HemN family oxidoreductase [Pseudomonas syringae Cit 7]
 gi|330984663|gb|EGH82766.1| HemN family oxidoreductase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 404

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 205/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|153001559|ref|YP_001367240.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella baltica OS185]
 gi|151366177|gb|ABS09177.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella baltica OS185]
          Length = 388

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 205/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R I +IF 
Sbjct: 15  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLVQGRQIHTIFI 74

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S N+EIT+EANP ++E ++F  YR AG+ R+S+G
Sbjct: 75  GGGTPSLFDALQIKRILDGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGITRLSIG 134

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 135 VQSFSKDKLNLLGRIHDQNEAQVAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 195 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQKLAALGYEQYEISA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 251 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLSAS----N 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E   ++ E +A E+LM  LRL   I  +++E+  G  R+   E     +++G +   
Sbjct: 307 YTFESIEVAEEDRALEYLMNRLRLMTPIPKQEFELRTGQHRDTLTEGMEKAKQRGLLTE- 365

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 366 SAEHWQLTSKGHMFVNDLLTQF 387


>gi|262273746|ref|ZP_06051559.1| coproporphyrinogen III oxidase, oxygen-independent [Grimontia
           hollisae CIP 101886]
 gi|262222161|gb|EEY73473.1| coproporphyrinogen III oxidase, oxygen-independent [Grimontia
           hollisae CIP 101886]
          Length = 384

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 139/383 (36%), Positives = 205/383 (53%), Gaps = 13/383 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT---GPRSISSI 74
            L +YVH P+CV+KCPYCDFNSH  +  V + ++I + L +++           R +SSI
Sbjct: 6   PLSLYVHIPWCVQKCPYCDFNSHTLKGDVPERDYIDALLDDLRKDLNRFHGVSGRELSSI 65

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL+ P+ IA +L GI      + ++EIT+EANP +VE + F  YRKAGVNRIS
Sbjct: 66  FIGGGTPSLVSPEEIARLLQGIEAQIPFADDIEITMEANPGTVEADKFVAYRKAGVNRIS 125

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQR 193
           +GVQS + Q L  LGR H A EAI A  LA        + DL++ LP QT+     +L++
Sbjct: 126 IGVQSFDNQKLARLGRIHGADEAIRAARLAHEADLNSFNLDLMHGLPDQTLEGALDDLRQ 185

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A++    HLS YQLTIE  T +Y         LP ++   D++    ++ +  G   YE 
Sbjct: 186 AIALNPPHLSWYQLTIEPNTQYYSKPP----TLPDDDDLWDIFEQGHALLTEAGYVQYET 241

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S +S  G +  HNLNYWR+GDY+GIG GAH +V +      +      +     +  +  
Sbjct: 242 SGYSKPGFQCRHNLNYWRFGDYLGIGCGAHGKVTLED--NTVKRTVKVKHPRGYLDPDNA 299

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
            + E   + + +   EF M   RL E     D+    G +LD      R+   +G +   
Sbjct: 300 YLSEIITVEASELPFEFFMNRFRLVEPCPKADYPARTGLSLDTVEAPLRHAIIEGLLTET 359

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
           Q +  + T++G   L+ ++AN  
Sbjct: 360 Q-THWQVTEKGRLFLNDLLANFI 381


>gi|260576114|ref|ZP_05844107.1| oxygen-independent coproporphyrinogen III oxidase [Rhodobacter sp.
           SW2]
 gi|259021594|gb|EEW24897.1| oxygen-independent coproporphyrinogen III oxidase [Rhodobacter sp.
           SW2]
          Length = 385

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 170/377 (45%), Positives = 236/377 (62%), Gaps = 3/377 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    + Q+ + +++L+E+  +   T  R ++S++FG
Sbjct: 8   GFGLYLHWPFCQSKCPYCDFNSHVSTR-IDQDRWQRAYLSEISRVGAETQGRLLNSVYFG 66

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ ++ IL  +   WT++++ EIT+EANP SVE   F+GYR AGVNR+S+G+
Sbjct: 67  GGTPSLMRPELVSAILARVRATWTLANDCEITLEANPGSVEAGRFRGYRDAGVNRVSMGI 126

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H+ +EA AA  +AR  F R+SFDLIYA   QT+  W+ EL  AL+ 
Sbjct: 127 QALADGDLRALGRAHSVAEARAAFDVARTTFDRVSFDLIYARQNQTLKNWQKELSDALTM 186

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           A DH+SLYQLT+E GT F      G L        + D Y  TQ I  A G+ AYE+SNH
Sbjct: 187 AADHISLYQLTVEDGTAFGDRLAHGKLRGLPGEELSADFYAATQEICGAAGMDAYEVSNH 246

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G+ES HNL YWR GDY+GIGPGAH R+     R A    + P +WL  V   G+   
Sbjct: 247 AKTGSESRHNLIYWRAGDYVGIGPGAHGRLSQNDDRWATEGLRAPGAWLSKVESEGNGEA 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +E L    +A E+LMM LRLREG+S+  +   AG  +  +   +L   G I  V  +++
Sbjct: 307 LREILRPADRAAEYLMMSLRLREGMSLPRYSSFAGDRISPQKLADLVEIGMIS-VATNQI 365

Query: 377 RCTQRGMTMLDSVIANL 393
           R T  G  +L+++IA L
Sbjct: 366 RATDAGRMVLNTLIAEL 382


>gi|110677822|ref|YP_680829.1| coproporphyrinogen III oxidase [Roseobacter denitrificans OCh 114]
 gi|109453938|gb|ABG30143.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Roseobacter denitrificans OCh 114]
          Length = 385

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 177/378 (46%), Positives = 241/378 (63%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWP+C  KCPYCDFNSHV R  + Q  +  ++LTE++   + T  R + S+FFG
Sbjct: 9   GFGLYIHWPYCEAKCPYCDFNSHVVRR-IDQTAWRDAYLTELRRTARETQGRVLRSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +A+++  + K W V++++EIT+EANPSSVE   F  +R+ GV RIS+G+
Sbjct: 68  GGTPSLMDPDTVAVVISEVRKLWPVANDLEITLEANPSSVEAGRFAAFRQGGVTRISMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  LR LGR H  +EA  A  +AR+ F R+SFDLIYA   Q++  WE EL++AL  
Sbjct: 128 QALNDDDLRRLGRIHTVTEAQTAFDIARSEFDRVSFDLIYARQGQSLHAWEQELKQALEM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE+GT F   +  G L   P E+++ DLY LTQ +  A G+  YE+SNH
Sbjct: 188 AVDHLSLYQLTIEQGTAFGDRYNAGKLRGLPDEDLSADLYTLTQDLCGAAGMPGYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GA S HNL YWRYGDY+GIGPGAH R+ V   R A     +P  WL  V        
Sbjct: 248 ARDGAHSRHNLIYWRYGDYLGIGPGAHGRLTVNGQRYATECYSNPAKWLAAVGDEHTEKP 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
               L+ + QA EFL+MGLRL+EGI    +E LAG+ LD      L   G +   +  R+
Sbjct: 308 RG-PLTYQDQASEFLLMGLRLKEGIDTHRYETLAGKALDSHAVSELADLGMVSTTE-DRI 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             + +G  +L++VIA L 
Sbjct: 366 TVSDQGFIILNAVIARLL 383


>gi|257483582|ref|ZP_05637623.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331009659|gb|EGH89715.1| HemN family oxidoreductase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 404

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 205/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLQGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGGEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPIHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|289625042|ref|ZP_06457996.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289647869|ref|ZP_06479212.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330865789|gb|EGH00498.1| HemN family oxidoreductase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 404

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 205/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQHLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|330812372|ref|YP_004356834.1| coproporphyrinogen dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380480|gb|AEA71830.1| putative coproporphyrinogen dehydrogenase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 399

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 129/376 (34%), Positives = 203/376 (53%), Gaps = 10/376 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           YVH P+CV+KCPYCDFNSH    ++ +E ++ + L ++         R +SSIFFGGGTP
Sbjct: 30  YVHIPWCVRKCPYCDFNSHTASPQLPEEEYVDALLADLDQDLHAVHGRPLSSIFFGGGTP 89

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           SL   Q +  +L G+      + ++EIT+EANP + E   F  YR  G+NR+S+G+QS +
Sbjct: 90  SLFSAQALGRLLKGVEARIPFAQDIEITLEANPGTFEQEKFVAYRALGINRLSIGIQSFQ 149

Query: 142 EQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           +  L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A++    
Sbjct: 150 QAKLEALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPDQSLEDALSDLRQAIALKPT 209

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           HLS YQLT+E  T+F+         LP ++   D+    Q++ + HG   YE+S ++  G
Sbjct: 210 HLSWYQLTLEPNTVFWNQPP----TLPEDDTLWDIQEAGQALLAEHGYAQYEVSAYAQPG 265

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
             + HNLNYW +GD+IGIG GAH ++     R+              +         ++ 
Sbjct: 266 RAARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVR--TWKTRLPKDYLNPAKSFQAGEKT 323

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQFSRLRC 378
           L++E+   EFLM  LRL  G+  + +    G  L    E  R  ++ G + +V+ +RL  
Sbjct: 324 LANEELPFEFLMNALRLTAGVEARLYPERTGLPLQSLAEGRREAEQSGLL-QVEPTRLAA 382

Query: 379 TQRGMTMLDSVIANLA 394
           T+RG   L+ ++    
Sbjct: 383 TERGQLFLNDLLQTFL 398


>gi|294679005|ref|YP_003579620.1| oxygen-independent coproporphyrinogen-III oxidase [Rhodobacter
           capsulatus SB 1003]
 gi|294477825|gb|ADE87213.1| oxygen-independent coproporphyrinogen-III oxidase-3 [Rhodobacter
           capsulatus SB 1003]
          Length = 385

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 174/378 (46%), Positives = 243/378 (64%), Gaps = 3/378 (0%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV    +  + +++++L E+  +   T  R ++++FFG
Sbjct: 9   GFGLYLHWPFCAAKCPYCDFNSHVAA-AIDHDRWLRAYLAEIDRIGAETQGRVLNTVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +A ++D I   W  ++++EIT+EANP+S++   F+ + + GV R+S+G+
Sbjct: 68  GGTPSLMAPETVAAVIDRIRATWPTANDLEITLEANPTSIDAGKFRAFAQGGVTRLSMGM 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q++++ SLR LGR H+A+E  AA  +AR  FPR+SFDLIYA   Q +  W  EL+ ALS 
Sbjct: 128 QAMDDDSLRRLGRMHSAAEGRAAFDIARAHFPRVSFDLIYARQGQGLDDWARELRGALSM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV-AVDLYNLTQSITSAHGLHAYEISNH 256
           AVDH SLYQLTIE GT F ++   G L    E+  A D+Y  TQ I  A GL AYE+SNH
Sbjct: 188 AVDHFSLYQLTIEDGTAFGRLFAAGKLRDLPEDDLAADMYLKTQEICDAAGLPAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  GAE  HNL YWRYGDY GIGPGAH R+ +G  R A    K P  WL  V + G+  +
Sbjct: 248 ARPGAECRHNLVYWRYGDYAGIGPGAHGRLTLGGVRHATEAPKAPADWLDRVERLGNGEM 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
            +E L  ++QA EFL+ GLRL EGI    +E L+G+ L      +L+  G I R    R+
Sbjct: 308 PREPLERQEQATEFLLFGLRLAEGIDPTRYERLSGQALPALALADLEAMGMIAR-DAGRI 366

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L++VI  L 
Sbjct: 367 RATAQGRAVLNAVIRALM 384


>gi|289662150|ref|ZP_06483731.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 385

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 139/389 (35%), Positives = 214/389 (55%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E+++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEDYVDALIRDLDADLPLAWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  P+ I   L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G+    +   KH      +  
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQTYLAS 297

Query: 310 KNGHAVVEK-EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQG 366
               A +   E +  E+   E+++  LRL EG  + D+E   G    +          QG
Sbjct: 298 AGTAASIGGDEIVPRERLPFEYMLNLLRLHEGFRLSDFEASTGLAASVIAVPLARALAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ R Q  R+  T+ G    + V+  L +
Sbjct: 358 WMTR-QGERVVPTELGRRFTNDVV-ELFL 384


>gi|319786146|ref|YP_004145621.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317464658|gb|ADV26390.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 384

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 136/389 (34%), Positives = 219/389 (56%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  R ++  ++++ + + +++    L   R+
Sbjct: 1   MPDLIPPPLSLYVHLPWCVRKCPYCDFNSHGARGELPFDDYVAALVRDLEHDLPLVWGRT 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL     I  IL   +     + + EIT+EANP + E + F+GYR AGV
Sbjct: 61  VHSVFFGGGTPSLFPAAAIEAILSAASARLRFAPDAEITLEANPGTAEHDRFEGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NRIS G+QS ++  L+ LGR H++ EA AA+ LA++  F  ++ DL+YALP Q +   E 
Sbjct: 121 NRISFGIQSFDDGCLQRLGRIHDSREAEAAVKLAQDAGFDNLNLDLMYALPGQDLAMAER 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    H+S YQLT+E  T+FY     G   +P +++A D+    Q++ +  G  
Sbjct: 181 DLERAFALQPAHISHYQLTLEPNTVFYARPPQG---IPDDDLAWDIQEHCQALLAGAGYG 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHR-VAISIEKHPESWLKMV 308
            YE S ++  G +  HNLNYWRYGDY+GIG GAH ++ +G+ + +    +    +     
Sbjct: 238 HYETSAYARPGRQCAHNLNYWRYGDYLGIGAGAHGKITLGAEQAILRRWKHKHPATWMAA 297

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQG 366
                A+   + ++  Q+  E+++  LRL EG ++ D+E+  G             +  G
Sbjct: 298 AGTDQAIGGNDRIAPAQRPFEYMLNALRLHEGFALADFEVRTGLPRARIAAALEQARANG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ +V   R+  T  G    + VI+ L +
Sbjct: 358 WL-QVDDVRVAPTALGRRFANDVIS-LFL 384


>gi|82523718|emb|CAI78499.1| coproporphyrinoben III oxidase and related Fe-S oxidoreductase
           [uncultured beta proteobacterium]
          Length = 391

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 136/382 (35%), Positives = 204/382 (53%), Gaps = 9/382 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           S  L +Y+H P+CVKKCPYCDFNSH  +  + +  +I + L +++        R I ++F
Sbjct: 16  SPPLSLYIHLPWCVKKCPYCDFNSHASQ-VIPEAAYIDALLLDLERALPDIWGRRIHTVF 74

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL     I  IL G+     +  N EIT+EANP +VE   F G+R+AGV R+SL
Sbjct: 75  FGGGTPSLFSAAGIDRILTGVRTLTQLLPNAEITLEANPGTVEAEKFAGFREAGVTRVSL 134

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS   Q L+ LGR H+ SEA  A  LA   F   + DL++ALP QT+ +   ++  AL
Sbjct: 135 GIQSFNSQHLKALGRIHDDSEARRAAELAATHFDTFNLDLMFALPGQTLDEALTDIDTAL 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++   HLS Y LT+E  T F          LP ++VA D++   ++  +  G+  YE S 
Sbjct: 195 AFRPPHLSAYHLTLEPNTPFGHTAPPN---LPDDDVAADMHQAIEARLTEAGMQHYETSA 251

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++     S HNLNYW++GDY+GIG GAHS++      +     KHP+ ++      G  +
Sbjct: 252 YARPQHASRHNLNYWQFGDYLGIGAGAHSKLSFHDRILRQMRTKHPQQYMDA-VAQGTHI 310

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
            +   L+      EF+M  LRL EG+    +E   G  L +        + +G +     
Sbjct: 311 ADARTLTRSDLPFEFMMNALRLNEGVPSALFEERTGLPLIVCTAGLEQARAKGLLAH-DA 369

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            +L+ T  G   L+ ++  L +
Sbjct: 370 MQLKPTLLGQRYLNDLL-ELFL 390


>gi|298207568|ref|YP_003715747.1| coproporphyrinogen III oxidase [Croceibacter atlanticus HTCC2559]
 gi|83850204|gb|EAP88072.1| coproporphyrinogen III oxidase [Croceibacter atlanticus HTCC2559]
          Length = 376

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 109/378 (28%), Positives = 178/378 (47%), Gaps = 12/378 (3%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +Y+H PFC + C YCDF  H       ++  + +  TE+   +      ++  I+FGGG
Sbjct: 3   SIYIHIPFCKQACHYCDF--HFSTSLKKKDELVNTLKTELSLRKVELTN-TVECIYFGGG 59

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+  + +  +++ +  N+ VS   EIT+EANP  +  +      K+ +NR+S+G+QS
Sbjct: 60  TPSLLSAEELNSLIETVYTNYNVSETPEITLEANPDDLTKDKITELGKSKINRLSIGIQS 119

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
             E  L+ + R HNA EA+  I  ++  F  +S DLIY +P  T  +W+  L  AL   +
Sbjct: 120 FFEDDLKLMNRAHNAKEALQCIEFSKTEFDNISIDLIYGVPGMTTQKWKENLNIALQLDI 179

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H+S Y LT+E  T   +  + G +    +++A   +++        G   YE SN    
Sbjct: 180 PHISSYALTVEPNTALKRFIEKGVVPPVDDDLAKQHFDILVETLQQAGYSNYEFSNFGKQ 239

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G  S +N  YW    Y+GIGP AHS           +  K+ +S  +     G    E E
Sbjct: 240 GYHSNNNTAYWTGKSYLGIGPSAHSYNGKQRSWNINNNPKYIKSIQQ-----GIIPNEVE 294

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERN---LQRQGFIERVQFSRL 376
            LS   + +E++M GLR   GIS+   E   G N      +          +  +    +
Sbjct: 295 TLSVTDRYNEYVMTGLRTIWGISLSKIEKEFGLNFKTYVLQQAKYFIEDHLL-FLDGDTI 353

Query: 377 RCTQRGMTMLDSVIANLA 394
             T++G  + D + + L 
Sbjct: 354 IVTKKGKFLSDGIASELF 371


>gi|325981769|ref|YP_004294171.1| oxygen-independent coproporphyrinogen III oxidase [Nitrosomonas sp.
           AL212]
 gi|325531288|gb|ADZ26009.1| oxygen-independent coproporphyrinogen III oxidase [Nitrosomonas sp.
           AL212]
          Length = 404

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 127/384 (33%), Positives = 206/384 (53%), Gaps = 11/384 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSH---VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISS 73
             L +YVH+P+C+KKCPYCDFNSH       +V +E ++ + + +++   Q    R ++S
Sbjct: 13  PPLSLYVHFPWCLKKCPYCDFNSHELRTDESRVPEEEYVATLIRDLESALQDVWGRRLNS 72

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL     +  +L  +     +    E+T+EANP + E   F  +RKAG+NR+
Sbjct: 73  VFLGGGTPSLFSAGAMDAVLTAVRTLLPLEHFAEVTLEANPGTFEAQKFADFRKAGINRL 132

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS   Q L+ LGR H+  EA  A+ +A   F  ++ DL+YALP QT+   + +++ 
Sbjct: 133 SIGIQSFNPQHLKALGRVHDDQEAHRAVDIALKYFDNINLDLMYALPGQTLEHAQADIEA 192

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A +  V H+S Y LT+E  TLFY+        LP +  A  + ++ +  TS H    YE 
Sbjct: 193 ACACGVTHISAYHLTLEPNTLFYRFPPK----LPDDEAAAAMQDMIEQTTSDHQYRNYET 248

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S  +  G ES HN+NYW +GDY+GIG GAHS++      V     K P+ +L   R  G 
Sbjct: 249 SAFARAGKESRHNVNYWLFGDYVGIGAGAHSKISFADKIVRQMRYKQPKEYLAKARMGGS 308

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
            +  ++ L+   ++ EF+M  LRL  G     ++   G  +    +     +++G +   
Sbjct: 309 LIQVQQELTVADRSFEFMMNALRLTGGFDTPLFQERTGLPIAVVQQQLDEAEQRGLLVH- 367

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R++ T  G   L+ ++  + +
Sbjct: 368 DHLRIKPTVLGRRFLNDLL-QIFL 390


>gi|258543385|ref|YP_003188818.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634463|dbj|BAI00439.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637521|dbj|BAI03490.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640573|dbj|BAI06535.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643630|dbj|BAI09585.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646685|dbj|BAI12633.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649738|dbj|BAI15679.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652726|dbj|BAI18660.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655782|dbj|BAI21709.1| coproporphyrinogen III oxidase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 384

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 169/383 (44%), Positives = 251/383 (65%), Gaps = 6/383 (1%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           ++L +Y+HWPFC+ KCPYCDFNSHV R ++ Q  F Q+  TE+ +     G R ++SIFF
Sbjct: 4   DALALYIHWPFCLAKCPYCDFNSHV-RAEIPQARFAQALRTELAYEANRLGHRRLTSIFF 62

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ PQ +A ++D     +  + N+EIT+EANP+SVE    + +R+AG+NR+SLG
Sbjct: 63  GGGTPSLMAPQTVANLIDDATSLFDAAPNLEITLEANPTSVEAERLKDFRQAGINRVSLG 122

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+L +++L FLGR H+A++A+AA+ LAR++FPR++FDLIYA P Q++  W+ EL+ AL 
Sbjct: 123 IQALNDEALHFLGRQHSATQALAALELARSLFPRITFDLIYARPNQSVAAWKTELETALQ 182

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              DH+SLYQLTIE GT F  +++ G   LP E  A  LY  T +IT AHGL+AYE+SN+
Sbjct: 183 LVADHVSLYQLTIEPGTKFEALYRQGSFSLPDEETAAALYETTTAITHAHGLNAYEVSNY 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G+ S HNL YW YGDY+G+GPGAH R+ +     A    + PE W ++V + G    
Sbjct: 243 AKPGSASRHNLTYWHYGDYLGLGPGAHGRITLDDQLYATRRHRAPEPWAELVERTGSGQT 302

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR----NLDIECERNLQRQGFIERVQ 372
            +E L  +++A E L+MGLRL+EGI++  ++   G      LD         +G++    
Sbjct: 303 SQEQLVPQERAREMLLMGLRLQEGIALSHFQARTGLQLTETLDPVILAAAVEEGYLVHT- 361

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            + L  T+ G   L++++  L +
Sbjct: 362 PTHLYATEEGRLRLEALLHALVL 384


>gi|330899343|gb|EGH30762.1| HemN family oxidoreductase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 404

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 205/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS EE  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFEESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|146293787|ref|YP_001184211.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella putrefaciens CN-32]
 gi|145565477|gb|ABP76412.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella putrefaciens CN-32]
          Length = 387

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 206/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R I +IF 
Sbjct: 14  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLVQGRQIHTIFI 73

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + + I  IL+G       S N+EIT+EANP ++E ++F  YR AG+ R+S+G
Sbjct: 74  GGGTPSLFDAKQIKRILEGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGITRLSIG 133

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +  ++++ A 
Sbjct: 134 VQSFAKDKLNLLGRIHDQNEAKIAAQKASQAKYLSFNLDLMHGLPNQSFDEAMLDIETAA 193

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 194 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQRLAALGYEQYEISA 249

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV--KVGSHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V     +  +  +  KHP+ +L        
Sbjct: 250 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEQNRIIRTAKIKHPKGYLSSN----Q 305

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
             VE   ++ E +A E+LM  LRL   I  +++E   G  R    E     +++G +   
Sbjct: 306 YTVELTEVAEEDRALEYLMNRLRLMTPIPKQEFEQRTGLHRETLSEGMEKAKQRGLLTE- 364

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 365 SAEYWQLTHKGHMFVNDLLTQF 386


>gi|256752138|ref|ZP_05493004.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748952|gb|EEU61990.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 375

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 116/381 (30%), Positives = 203/381 (53%), Gaps = 11/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             +G+Y+H PFC +KC YCDFNS+   Y    +++I++ L E++     T   ++ S++ 
Sbjct: 2   REIGLYIHIPFCKRKCYYCDFNSYA-GYDYLFDDYIRALLMEIE--SNSTKDYNVVSVYI 58

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+L+ P  I  IL  + KN+ +    EITIE NP  +     + Y+ +G+NR+S+G
Sbjct: 59  GGGTPNLLPPSYIEKILKSVFKNYKILDGCEITIEMNPGLITEEKLKIYKGSGINRVSIG 118

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+ + + L+++GR H   E      L +  F  ++ DL+YALP QT  +W+  L+  + 
Sbjct: 119 LQAFQNRLLKYIGRIHTVEEFFGNYELVKKFFDNINIDLMYALPTQTFKEWQETLKEVVK 178

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y L +E  T FY++++ G L +  E   + +Y+         G H YEISN 
Sbjct: 179 LQPTHVSTYSLILEPNTSFYRLYEKGQLPIVDEEEELKMYHWGIEFLKEKGYHHYEISNF 238

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    E  HN+ YW   +Y+G G GAHS +    +    +I+ + +S L+        V 
Sbjct: 239 ALPTFECRHNILYWECKNYLGFGAGAHSYMADVRYSNIENIKDYIKSILERKSA----VK 294

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQF 373
           EK  L+ + +  EF+ +G+R+ +G+  KD++   G +L        +   ++G IE +  
Sbjct: 295 EKIKLTKQDRMAEFMFLGMRMTKGVCDKDFKKRFGISLFEIYKKVIQKYLKEGLIE-IDN 353

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             ++ T+RG+ + + +     
Sbjct: 354 ECVKLTERGIDVSNVIFEEFL 374


>gi|262191066|ref|ZP_06049273.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio cholerae
           CT 5369-93]
 gi|262033042|gb|EEY51573.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio cholerae
           CT 5369-93]
          Length = 391

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 140/387 (36%), Positives = 205/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S    +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPSYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWAISEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|330886249|gb|EGH20150.1| HemN family oxidoreductase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 404

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 204/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR       + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFNNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGAKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|163867355|ref|YP_001608549.1| coproporphyrinogen III oxidase [Bartonella tribocorum CIP 105476]
 gi|161016996|emb|CAK00554.1| oxygen-independent coproporphyrinogen III oxidase [Bartonella
           tribocorum CIP 105476]
          Length = 399

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 202/397 (50%), Positives = 264/397 (66%), Gaps = 18/397 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +   G+Y+HWPFC  KCPYCDFNSHVR + V Q  F+ +F  E++      GPR I+SIF
Sbjct: 2   NEPFGIYIHWPFCTAKCPYCDFNSHVRIHGVDQPRFVSAFEREIETQYHKIGPRHITSIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+EPQ +  +L  +A+ W +   VEIT+EANPSSVE   F+GYR AGVNR+SL
Sbjct: 62  IGGGTPSLMEPQTVDALLQALARKWILDDKVEITLEANPSSVEAERFRGYRAAGVNRLSL 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+Q+L +++LR LGR HN  +A+ AI LAR IFPR+SFDLIYA P+QT+ QW+ EL +A+
Sbjct: 122 GIQALNDKALRKLGRLHNVEQALYAIDLARQIFPRLSFDLIYARPEQTLEQWKSELIQAI 181

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A DHLSLYQLTIE+GT F ++H  G L+LP      DLY+LTQ IT+ +GL AYEISN
Sbjct: 182 DLAADHLSLYQLTIEEGTAFKRLHDAGRLILPPSEQTADLYHLTQEITALYGLPAYEISN 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRV------------------KVGSHRVAISI 297
           H+  GAES HNL YWRY  Y G GPGAH R                        R     
Sbjct: 242 HAMPGAESAHNLLYWRYHQYAGFGPGAHGRFIENIPNYSSAFSKTSLSHFENHERYVTIN 301

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
           E+HPE WL++V K GH  +E E L++EQQA+E L+MGLRL EG+ +  +E L+ + + +E
Sbjct: 302 ERHPEQWLELVEKTGHGCIETERLTTEQQANEMLLMGLRLCEGLELTRYETLSSKRIPME 361

Query: 358 CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
              +LQ+Q  +E V   RL+ T +G  +LD +I+ LA
Sbjct: 362 KLIDLQQQELVEMVNNQRLKATTKGRIVLDHIISQLA 398


>gi|297537274|ref|YP_003673043.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           sp. 301]
 gi|297256621|gb|ADI28466.1| oxygen-independent coproporphyrinogen III oxidase [Methylotenera
           sp. 301]
          Length = 382

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 127/373 (34%), Positives = 208/373 (55%), Gaps = 11/373 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYK---VGQENFIQSFLTEMQWMRQLTGPRSISS 73
             L +Y+H P+CVKKCPYCDFNSH  R+K   + +  ++ + + +++        R I S
Sbjct: 5   PPLSLYIHIPWCVKKCPYCDFNSHESRHKDGAIPESAYVDALIADLELATPKVWGRKIKS 64

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +FFGGGTPSL   + I  IL  +     +  + EIT+EANP +V+  NF GY++AGVNR+
Sbjct: 65  VFFGGGTPSLFSAEAIDRILSHVRMLTPLEFDAEITLEANPGTVDAANFVGYKQAGVNRL 124

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           SLG+QS +   L+ LGR H++ +A AA+ LA   F +++ D++Y LP Q++     + Q 
Sbjct: 125 SLGIQSFKSDYLKALGRIHDSEQAFAAVELAMKTFDQVNCDIMYGLPNQSLEDAMQDAQT 184

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           A+     HLS Y LT+E  T FY+        LP ++ + D+    +++ + +G   YE 
Sbjct: 185 AVRLNPTHLSFYHLTLEPNTPFYRTPP----SLPDDDTSSDMQIAIETLLAENGYEHYET 240

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S  +  G ++ HNLNYW++GDY+GIG GAHS++            KHP+++++   +   
Sbjct: 241 SAFAKKGKQAKHNLNYWQFGDYLGIGAGAHSKLSYHDKITREVRPKHPKAYMEQALQGK- 299

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERV 371
           AV  +  +   +   EF+M  LRL +G+ V  ++   G N+       +  Q +G +  +
Sbjct: 300 AVEREWLIPQNELGFEFMMNALRLIDGVPVDLFQQRTGLNIRTLQAAIKTAQSKGLL-II 358

Query: 372 QFSRLRCTQRGMT 384
           +   ++ T  G  
Sbjct: 359 EAGNIQPTLLGQR 371


>gi|319761727|ref|YP_004125664.1| oxygen-independent coproporphyrinogen iii oxidase [Alicycliphilus
           denitrificans BC]
 gi|317116288|gb|ADU98776.1| oxygen-independent coproporphyrinogen III oxidase [Alicycliphilus
           denitrificans BC]
          Length = 411

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 130/384 (33%), Positives = 208/384 (54%), Gaps = 12/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV---GQENFIQSFLTEMQWMRQLTGPRSISS 73
             L +YVH P+C++KCPYCDFNSH          +  +  + + +++    L   R++ S
Sbjct: 33  PPLSLYVHLPWCLRKCPYCDFNSHQAPGGSEALPEARYTAALVADLEAALPLVWGRTVHS 92

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL  P+ +  +L  I     + +  E+T+EANP + E   F+ YR AGV R+
Sbjct: 93  IFIGGGTPSLFSPEAMDRLLGDIRARLPLDAGCEVTLEANPGTFEKERFRAYRGAGVTRL 152

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+GVQS  ++ L+ LGR H+ ++A+AA+  A   F   + D++YALP QT  + E ++++
Sbjct: 153 SIGVQSFNDRHLQALGRVHDRAQALAAVEEAAQAFETFNLDIMYALPGQTPAEQEQDMRQ 212

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL+ A  H+S+Y LTIE  T F K        LP ++ A  + +    +T+A GL  YE+
Sbjct: 213 ALALAPPHISIYHLTIEPNTYFAKYPPR----LPEDDQAYAMLDRITELTAAAGLSRYEV 268

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S ++  G +  HN NYW++GDY+GIG GAHS++      V     + P+ ++        
Sbjct: 269 SAYAREGHQCQHNRNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRLRDPQLYMTGALAGRA 328

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERV 371
              + E +       EF++  LRLREG +++D+    G+ L       +  + +G I R 
Sbjct: 329 IAQD-EDVRRADLPFEFMLNALRLREGFALQDFTERTGQPLTAIAQGLQQAEARGLIAR- 386

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG   L   +  L +
Sbjct: 387 DMGHVRPTERGFDFLSD-LQALFL 409


>gi|71735003|ref|YP_272765.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555556|gb|AAZ34767.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 404

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 206/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAHS++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHSKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGAKLLPLDELPFEFLMNALRLTNGVDAALFRKRTGLSLDSLTEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|188990326|ref|YP_001902336.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732086|emb|CAP50278.1| putative coproporphyrinogen dehydrogenase [Xanthomonas campestris
           pv. campestris]
          Length = 385

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 138/389 (35%), Positives = 212/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  ++++ + + ++     L   R 
Sbjct: 1   MPDLIPPPLALYVHLPWCVRKCPYCDFNSHAAKGALPFDDYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  P+ I   L   A     + N+EIT+E NP + E   F GYR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFDGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQS ++ +L+ LGR H+++EA  AI LA++      + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQSFDDAALQRLGRIHDSAEAERAIKLAQDAGCDNFNIDLMYALPEQTLAQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +A G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPQG---IPDDDDAWDMQEHCQRLLAAAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-SHRVAISIEKHPESWLKMV 308
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G   +V    +          
Sbjct: 238 QYEVSAYARPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEQQVLRRWKHKHPQSYLAS 297

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQG 366
             +  A+   E + + +   E+++  LRL EG  + D+E   G    +          QG
Sbjct: 298 AGSTAAIGGDEHVPAARLPFEYMLNLLRLHEGFRLSDFEACTGLPAQVLQAPLARAMAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++   Q  R+  T+ G    + V+  L +
Sbjct: 358 WLVE-QHGRIVPTELGRRFTNDVV-ELFL 384


>gi|83746456|ref|ZP_00943507.1| Coproporphyrinogen oxidase, anaerobic [Ralstonia solanacearum
           UW551]
 gi|83726787|gb|EAP73914.1| Coproporphyrinogen oxidase, anaerobic [Ralstonia solanacearum
           UW551]
          Length = 425

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 135/386 (34%), Positives = 212/386 (54%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + +E F+ +   +++    +   R + +
Sbjct: 41  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPDQGIPEERFLAAVRQDLEAALPMVWGRRVHT 100

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 101 IFIGGGTPSLLSAQGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 160

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  LR LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 161 SIGIQSFNDAHLRALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 220

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 221 ALSFETSHVSLYHLTLEPNTYFAKYPPA----LPDDDTAFGMQDWIHARLAAAGYEHYEV 276

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK--N 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     +HPE++L+       
Sbjct: 277 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVLREMRHRHPETYLRQAETAGG 336

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              + E+  + +     EF++  LRL  G  V  ++   G  L          +++G + 
Sbjct: 337 AAVLQEQREVDAADLPFEFMLNALRLTGGFPVTLFQERTGLPLRAIERELDAAEQRGLLA 396

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R     +R T+ G   L+  +  L +
Sbjct: 397 R-DHVAIRPTELGQRFLND-LQALFL 420


>gi|167037805|ref|YP_001665383.1| coproporphyrinogen III oxidase [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167040705|ref|YP_001663690.1| coproporphyrinogen III oxidase [Thermoanaerobacter sp. X514]
 gi|300914746|ref|ZP_07132062.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter sp. X561]
 gi|307724020|ref|YP_003903771.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter sp. X513]
 gi|320116224|ref|YP_004186383.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166854945|gb|ABY93354.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter sp. X514]
 gi|166856639|gb|ABY95047.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300889681|gb|EFK84827.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter sp. X561]
 gi|307581081|gb|ADN54480.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter sp. X513]
 gi|319929315|gb|ADV80000.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 375

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 115/381 (30%), Positives = 202/381 (53%), Gaps = 11/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             +G+Y+H PFC +KC YCDFNS+     +  +++I++ L E++     T   ++ S++ 
Sbjct: 2   REIGLYIHIPFCKRKCYYCDFNSYAGYDYLF-DDYIRALLMEIE--SNSTKDYNVVSVYI 58

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+L+ P  I  IL  + KN+ +    EITIE NP  +     + Y+  G+NR+S+G
Sbjct: 59  GGGTPNLLPPSYIEKILKSVFKNYKILDGCEITIEMNPGLITEEKLKIYKDNGINRVSIG 118

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+ + + L+++GR H   E      L +  F  ++ DL+YALP QT  +W+  L+  + 
Sbjct: 119 LQAFQNRLLKYIGRIHTVEEFFGNYELVKKFFDNINIDLMYALPTQTFKEWQETLKEVVK 178

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y L +E  T FY++++ G L +  E   + +Y+         G H YEISN 
Sbjct: 179 LQPTHVSTYSLILEPNTSFYRLYEKGQLPIVDEEEELKMYHWGIEFLKEKGYHHYEISNF 238

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    E  HN+ YW   +Y+G G GAHS +    +    +I+ + +S L+        V 
Sbjct: 239 ALPTFECRHNILYWECKNYLGFGAGAHSYMADVRYSNIENIKDYIKSILERKSA----VK 294

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQF 373
           EK  L+ + +  EF+ +G+R+ +G+  KD++   G +L        +   ++G IE +  
Sbjct: 295 EKIKLTKQDRMAEFMFLGMRMTKGVCDKDFKKRFGISLFEIYKKVIQKYLKEGLIE-IDN 353

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             ++ T+RG+ + + +     
Sbjct: 354 ECVKLTERGIDVSNVIFEEFL 374


>gi|331266093|ref|YP_004325723.1| coproporphyrinogen III oxidase,oxygen-independent
           coproporphyrinogen III oxidase,putative [Streptococcus
           oralis Uo5]
 gi|326682765|emb|CBZ00382.1| coproporphyrinogen III oxidase,oxygen-independent
           coproporphyrinogen III oxidase,putative [Streptococcus
           oralis Uo5]
          Length = 376

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 122/384 (31%), Positives = 206/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L+G+ KN  +S   E+TIEANP  ++V+     +++ VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLNGLTKNLDLSVLEELTIEANPGDLDVDKIAVLKQSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMAQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIITELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +        G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLNAVEA-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E LS  +Q +E + +GLR + G+S+  +E   GR+ D    +  R+L +QG + ++
Sbjct: 293 RITEEHLSQREQMEEEMFLGLRKKSGVSMARFEEKFGRSFDELYGKIIRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|217972512|ref|YP_002357263.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica OS223]
 gi|217497647|gb|ACK45840.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica OS223]
          Length = 388

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 132/382 (34%), Positives = 205/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R I +IF 
Sbjct: 15  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLVQGRQIHTIFI 74

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S N+EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 75  GGGTPSLFDALQIKRILDGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 134

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 135 VQSFSKDKLNLLGRIHDQNEAQVAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 195 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQKLAALGYEQYEISA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 251 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLSAS----N 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E   ++ E +A E+LM  LRL   I  +++E+  G  R+   E     +++G +   
Sbjct: 307 YTFESIDVAEEDRALEYLMNRLRLMTPIPKQEFELRTGQHRDTLTEGMEKAKQRGLLTES 366

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 367 T-EHWQLTSKGHMFVNDLLTQF 387


>gi|289668017|ref|ZP_06489092.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 385

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 138/389 (35%), Positives = 211/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E+++ +   ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEDYVDALTRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  P+ I   L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+TQ E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLTQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-SHRVAISIEKHPESWLKMV 308
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G    V    +          
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQTYLAS 297

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQG 366
                ++   E +  E+   E+++  LRL EG  + D+E   G    +          QG
Sbjct: 298 AGTAASIGGDEIVPRERLPFEYMLNLLRLHEGFRLSDFEASTGLAASVIAVPLARALAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ R Q  R+  T+ G    + V+  L +
Sbjct: 358 WMTR-QGERVVPTELGRRFTNDVV-ELFL 384


>gi|297580594|ref|ZP_06942520.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535010|gb|EFH73845.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 391

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 140/387 (36%), Positives = 205/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S    +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPSYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSELLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWAISEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|306829774|ref|ZP_07462963.1| coproporphyrinogen dehydrogenase [Streptococcus mitis ATCC 6249]
 gi|304428125|gb|EFM31216.1| coproporphyrinogen dehydrogenase [Streptococcus mitis ATCC 6249]
          Length = 376

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 123/384 (32%), Positives = 203/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++LDG+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLDGLTKNLDLSVLEELTIEANPGDLDADKIAVLKNSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMAQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIITELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +        G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLNAVEA-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS  +Q +E + +GLR + G+S+  +E   GR+ D    E  R L +QG + ++
Sbjct: 293 RITEEHLSQTEQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIIRELVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|153826545|ref|ZP_01979212.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae MZO-2]
 gi|149739637|gb|EDM53851.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae MZO-2]
          Length = 391

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKSGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWAISEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|229512517|ref|ZP_04401988.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae TMA 21]
 gi|229350410|gb|EEO15359.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae TMA 21]
          Length = 391

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 208/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+      ++EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIVFKPDIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|154254013|ref|YP_001414837.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157963|gb|ABS65180.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Parvibaculum lavamentivorans DS-1]
          Length = 385

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 192/372 (51%), Positives = 248/372 (66%), Gaps = 2/372 (0%)

Query: 12  TGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSI 71
           +G      GVYVHWPFC  KCPYCDFNSHV    V Q  + ++   E+Q+MR LTGPRS+
Sbjct: 4   SGADEPGFGVYVHWPFCQSKCPYCDFNSHVVAN-VDQARWAKALTRELQYMRGLTGPRSV 62

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            SIFFGGGTPSL EP  +  +L  IA  WTV    EIT+EANP+SVE   F+GYRKAGVN
Sbjct: 63  RSIFFGGGTPSLTEPATVEAVLTQIAALWTVEQGAEITLEANPTSVEAARFRGYRKAGVN 122

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           R+SLGVQSL+++ L+FLGR H A EA+ AI LAR  FPR+SFDLIYA P QT  +W  EL
Sbjct: 123 RLSLGVQSLDDRELKFLGRLHTADEALRAIALARETFPRLSFDLIYARPGQTKEKWTAEL 182

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           + AL++AVDHLSLYQLTIE+ T F ++++ G   LP E+ A +LY LT  I +  GL AY
Sbjct: 183 RAALAHAVDHLSLYQLTIEEETAFARLYEKGAFKLPGEDEAAELYALTGEIAAEAGLSAY 242

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           E+SN++  GAE+ HNL YWRYGDY G+GPGAH R+     R+A    + P +W++ V ++
Sbjct: 243 EVSNYARPGAEARHNLVYWRYGDYAGVGPGAHGRISTEGKRLATRTLRMPGAWIENVERD 302

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERV 371
           GH +   E +    Q DE ++MGLRL EG+S+  +  LAG+ +      NL   G + R 
Sbjct: 303 GHGLEASEEIPGAAQGDEMMLMGLRLEEGVSLARYAALAGKEIAAPRIGNLIADGLLMR- 361

Query: 372 QFSRLRCTQRGM 383
               +R T +G 
Sbjct: 362 NGDIIRTTPQGR 373


>gi|296269131|ref|YP_003651763.1| oxygen-independent coproporphyrinogen III oxidase [Thermobispora
           bispora DSM 43833]
 gi|296091918|gb|ADG87870.1| oxygen-independent coproporphyrinogen III oxidase [Thermobispora
           bispora DSM 43833]
          Length = 403

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 128/395 (32%), Positives = 186/395 (47%), Gaps = 18/395 (4%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQL 65
           + + G GS   G YVH PFC  +C YCDFN++             +  + + E++  R++
Sbjct: 17  SALDGLGSRPFGFYVHVPFCATRCGYCDFNTYTAAELGPGASPAGYADTVIQEVRLARRV 76

Query: 66  TGP--RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQ 123
            G     + ++FFGGGTP+L+   ++  IL  IA  + ++   E+T EANP SV     +
Sbjct: 77  LGDAAPRVETVFFGGGTPTLLPAADLVRILRAIAGEFGLAPGAEVTTEANPESVSPAYLE 136

Query: 124 GYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAA-IHLARNIFPRMSFDLIYALPKQ 182
             R  G  R+S G+QS  E  LR L R H    A+ A        F  ++ DLIY  P +
Sbjct: 137 ELRAGGFTRVSFGMQSAREHVLRVLDRRHTPGRAVQAVREAHAAGFAHVNLDLIYNTPGE 196

Query: 183 TMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI 242
           +   W   L+ AL+   DH+S Y L +E GT      + G+L +P E+VA D Y + + +
Sbjct: 197 SDDDWRATLETALAAGPDHVSAYSLIVEDGTRLAARVRRGELPMPDEDVAADRYLIAEEL 256

Query: 243 TSAHGLHAYEISNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHP 301
            SA G   YEISN +        HNL YW  GD+ G GPGAH  V            KHP
Sbjct: 257 LSAAGFRWYEISNWARTEAGRCRHNLLYWTSGDWWGAGPGAHGHVGGTR----WWNVKHP 312

Query: 302 ESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERN 361
             +   +         +E L+ E++A E +M+ LRL  G+ +              C R 
Sbjct: 313 ARYAARLAAGKSPAQAREVLTPEERATERIMLELRLATGLPLDAI----PPGARPACARA 368

Query: 362 LQRQGFIER--VQFSRLRCTQRGMTMLDSVIANLA 394
           L   G +E    +  R   T RG  + DSV  +L 
Sbjct: 369 L-ADGLLEVEPFKAGRAVLTLRGRLLADSVARDLV 402


>gi|295112842|emb|CBL31479.1| coproporphyrinogen III oxidase, anaerobic [Enterococcus sp. 7L76]
          Length = 394

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 117/380 (30%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E++  + L   + + +I+ GGG
Sbjct: 17  SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIRLTQALYPEQEMKTIYIGGG 75

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 76  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 135

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 136 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 196 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 256 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 311

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 312 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 370

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 371 LRLTKKGLFVGNNVFEAFLL 390


>gi|311741355|ref|ZP_07715179.1| coproporphyrinogen dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311303525|gb|EFQ79604.1| coproporphyrinogen dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 379

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 123/385 (31%), Positives = 180/385 (46%), Gaps = 16/385 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQE---NFIQSFLTEMQWMRQLTGPRSI 71
           +   G+Y+H PFC  +C YCDFN++        ++    ++ +   E++        R  
Sbjct: 2   TEPFGLYIHVPFCATRCGYCDFNTYTPGELGSPRDLTGPYLDALDRELELAAARV-GRPA 60

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            ++F GGGTPSL+  Q ++ IL+ +   + +    E+T E+NP S     F     AG  
Sbjct: 61  ETVFIGGGTPSLLGGQGLSRILNTVRSTFGLKPGAEVTTESNPESTSPEYFSQLADAGYT 120

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEME 190
           RISLG+QS     L+ L R H    A AA   AR   F  ++ D+IY  P +T       
Sbjct: 121 RISLGMQSASPGVLQVLERAHTPGRAFAAAREARAAGFEHVNLDMIYGTPTETDDNVRET 180

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L R L   VDH+S Y L +E GT   +    G L  P E+V    Y +  S   A G   
Sbjct: 181 LDRVLETGVDHVSAYSLIVEDGTRMARKVNKGILPAPDEDVLARRYEMISSTLEAEGFEW 240

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN S  G E  HN  YW  G++ G GPGAHS +            KHP  ++  + +
Sbjct: 241 YEVSNWSKPGGECEHNRIYWVDGNWWGAGPGAHSHLGNER----FFNVKHPSRYIDALGR 296

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +   + E E L+   +  E +M+GLRLREGI     +                 +G +ER
Sbjct: 297 DELPIKETETLTDADRHMEKIMLGLRLREGIPEAWLDAH-----AAPALERFIGRGLLER 351

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
               R+R T+ G  + D +I +L V
Sbjct: 352 AD-DRVRITKPGRLLADGIITDLLV 375


>gi|126175233|ref|YP_001051382.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella baltica OS155]
 gi|125998438|gb|ABN62513.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella baltica OS155]
          Length = 388

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 132/382 (34%), Positives = 205/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ QE ++ + L +++    L   R I +IF 
Sbjct: 15  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQEAYVDALLEDLRQDLHLVQGRQIHTIFI 74

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S N+EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 75  GGGTPSLFDALQIKRILDGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 134

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 135 VQSFSKDKLNLLGRIHDQNEAQVAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 195 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQKLAALGYEQYEISA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 251 YAKPGYQCKHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTIKIKHPKGYLSAS----N 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E   ++ E +A E+LM  LRL   I  +++E+  G  R+   E     +++G +   
Sbjct: 307 YTFESIDVAEEDRALEYLMNRLRLMTAIPKQEFELRTGQHRDTLTEGMEKAKQRGLLTE- 365

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 366 SAEHWQLTSKGHMFVNDLLTQF 387


>gi|254226316|ref|ZP_04919907.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V51]
 gi|125621178|gb|EAZ49521.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V51]
          Length = 391

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 206/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAECIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWAISEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|323480535|gb|ADX79974.1| oxygen-independent coproporphyrinogen III oxidase 1 [Enterococcus
           faecalis 62]
          Length = 394

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 17  SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 75

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 76  TPTSLSAKQLDVLLKGVREQLTFDDQNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 135

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 136 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 196 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 256 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 311

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 312 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 370

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 371 LRLTKKGLFVGNNVFEAFLL 390


>gi|315613436|ref|ZP_07888344.1| coproporphyrinogen dehydrogenase [Streptococcus sanguinis ATCC
           49296]
 gi|315314432|gb|EFU62476.1| coproporphyrinogen dehydrogenase [Streptococcus sanguinis ATCC
           49296]
          Length = 376

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 124/384 (32%), Positives = 205/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + +S+++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLSTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++LDG+ KN  +S   E+TIEANP  ++ +     +++ VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLDGLTKNLDLSVLEELTIEANPGDLDTDKIAVLKRSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ + + L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDNKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMAQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +        G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLNAVEA-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS  +Q +E + +GLR + G+S+  +E   GR+ D    E  R+L +QG + ++
Sbjct: 293 RITEEHLSQREQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIIRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|237798168|ref|ZP_04586629.1| HemN family oxidoreductase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021020|gb|EGI01077.1| HemN family oxidoreductase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 404

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 204/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYDRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + + HG   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIIR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G +     
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHE-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           SRL  T +G   L+ ++    +
Sbjct: 383 SRLIATPQGQLFLNDLLQYFLI 404


>gi|229530297|ref|ZP_04419685.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae 12129(1)]
 gi|229332070|gb|EEN97558.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae 12129(1)]
 gi|327483309|gb|AEA77716.1| Radical SAM family enzyme, oxygen-independent [Vibrio cholerae
           LMA3894-4]
          Length = 391

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIVFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|153216271|ref|ZP_01950364.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 1587]
 gi|124114360|gb|EAY33180.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 1587]
          Length = 391

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 140/387 (36%), Positives = 206/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGEPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GY  AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYSTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|160876295|ref|YP_001555611.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella baltica OS195]
 gi|160861817|gb|ABX50351.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica OS195]
 gi|315268484|gb|ADT95337.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           baltica OS678]
          Length = 388

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 204/382 (53%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q  ++ + L +++    L   R I +IF 
Sbjct: 15  PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQAAYVDALLEDLRQDLHLVQGRQIHTIFI 74

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  ILDG       S N+EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 75  GGGTPSLFDALQIKRILDGANALIPFSDNIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 134

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA   A   ++  +   + DL++ LP Q+  +   ++  A 
Sbjct: 135 VQSFSKDKLNLLGRIHDQNEAQVAAQKASQAGYLSFNLDLMHGLPNQSFAEAMADIDTAA 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 195 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWHIYEQGQQKLAALGYEQYEISA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V +   +  +     KHP+ +L       +
Sbjct: 251 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLSAS----N 306

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              E   ++ E +A E+LM  LRL   I  +++E+  G  R+   E     +++G +   
Sbjct: 307 YTFESIDVAEEDRALEYLMNRLRLMTPIPKQEFELRTGQHRDTLTEGMEKAKQRGLLTE- 365

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                + T +G   ++ ++   
Sbjct: 366 SAEHWQLTSKGHMFVNDLLTQF 387


>gi|327534928|gb|AEA93762.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis OG1RF]
          Length = 394

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 119/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 17  SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 75

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ K  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 76  TPTSLSAKQLDVLLKGVRKQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 135

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 136 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 196 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 256 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 311

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 312 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 370

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 371 LRLTKKGLFVGNNVFEAFLL 390


>gi|320321989|gb|EFW78085.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320330906|gb|EFW86880.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330872130|gb|EGH06279.1| HemN family oxidoreductase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 404

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 205/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +  G   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATQGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAHS++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHSKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGAKLLPLDELPFEFLMNALRLTNGVDAALFRKRTGLSLDSLTEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|293394479|ref|ZP_06638775.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291422944|gb|EFE96177.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 383

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 133/382 (34%), Positives = 208/382 (54%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V  + ++   L ++     +T  RSI +IF 
Sbjct: 9   PPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHQEYVDHLLADLDADLPMTSGRSIGTIFI 68

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     V+ + EIT+EANP +VE + F GY++AGVNRIS+G
Sbjct: 69  GGGTPSLLSAEAMQSLLDGVRARIRVNDDAEITMEANPGTVEADRFSGYQRAGVNRISIG 128

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A HLA  +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 129 VQSFSAEKLTRLGRIHGPDEAKRAAHLATGLGLRSFNLDLMHGLPDQSLAEALDDLRQAI 188

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF         VLP ++   D++    ++ SA G   YE S 
Sbjct: 189 ALNPPHLSWYQLTIEPNTLFSSRPP----VLPDDDALWDIFQQGHALLSAAGYQQYETSA 244

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  +     ++        G  +
Sbjct: 245 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGRIVRTA----KTKHPRGFMQGKYL 300

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            ++  +++E +  EF M   RL E     ++    G +             +G++     
Sbjct: 301 DKQHEVATEDRPFEFFMNRFRLLEAAPRAEFSAYTGLDESTIRPQLDAALAKGYLVET-A 359

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T+RG   L+S++  L +
Sbjct: 360 QHWQITERGKLFLNSLL-ELFL 380


>gi|126724521|ref|ZP_01740364.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
 gi|126705685|gb|EBA04775.1| coproporphyrinogen III oxidase [Rhodobacterales bacterium HTCC2150]
          Length = 384

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 173/378 (45%), Positives = 234/378 (61%), Gaps = 5/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             GVYVHWPFC  KCPYCDFNSHV    V Q+ +  +FL+E++        R +SSI+FG
Sbjct: 9   GFGVYVHWPFCQSKCPYCDFNSHVSAN-VDQKRWFSAFLSEIERTVVGLEGRQLSSIYFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+EP  +  ILD +   + +++++EIT+EANP+SVE   FQ Y  AGVNR+S+G+
Sbjct: 68  GGTPSLMEPWLVEGILDALKSKFLIANDIEITLEANPTSVEAGRFQAYHDAGVNRVSMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L    L+ LGR H+ +E   A   AR+IF R+SFDLIYA   QT+ QW  EL++AL+ 
Sbjct: 128 QALNVPDLKRLGRLHSVNEGQDAFDTARHIFDRVSFDLIYARQDQTLDQWRSELKQALAM 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +VDHLSLYQLTIE GT F      G L   PSE++  D+Y LTQ +  A G+ AYE SNH
Sbjct: 188 SVDHLSLYQLTIEPGTAFGDRFSKGGLAGLPSEDLGADMYELTQELCEAAGMPAYETSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           + +G+ES HNL YW  GDY+G+GPGAH R+    HR+A      P  WL  V  +G    
Sbjct: 248 AAVGSESRHNLVYWNSGDYLGLGPGAHGRITQYGHRIATETHLAPGKWLDAVENSGSGES 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
                   +  +E LMMGLRLR GI    +E +   N  +E  + L+  G +E      L
Sbjct: 308 LSRKQDGFEAQEEALMMGLRLRSGIDEVRFEQV--LNTKVEKIQGLKEIGMLE-TANGFL 364

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T++G  +L++++  L 
Sbjct: 365 RTTEQGRPVLNAILRELL 382


>gi|29375873|ref|NP_815027.1| coproporphyrinogen III oxidase [Enterococcus faecalis V583]
 gi|229546018|ref|ZP_04434743.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis TX1322]
 gi|256852946|ref|ZP_05558316.1| coproporphyrinogen III oxidase [Enterococcus faecalis T8]
 gi|294781172|ref|ZP_06746521.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis PC1.1]
 gi|29343335|gb|AAO81097.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Enterococcus faecalis V583]
 gi|229308861|gb|EEN74848.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis TX1322]
 gi|256711405|gb|EEU26443.1| coproporphyrinogen III oxidase [Enterococcus faecalis T8]
 gi|294451739|gb|EFG20192.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis PC1.1]
          Length = 394

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 17  SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 75

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 76  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 135

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 136 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 196 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 256 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 311

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 312 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 370

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 371 LRLTKKGLFVGNNVFEAFLL 390


>gi|121728584|ref|ZP_01681605.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V52]
 gi|153819142|ref|ZP_01971809.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae NCTC 8457]
 gi|227080665|ref|YP_002809216.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae M66-2]
 gi|229507093|ref|ZP_04396599.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae BX 330286]
 gi|298501014|ref|ZP_07010815.1| oxygen-independent coproporphyrinogen III oxidase [Vibrio cholerae
           MAK 757]
 gi|121629140|gb|EAX61583.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae V52]
 gi|126510287|gb|EAZ72881.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae NCTC 8457]
 gi|227008553|gb|ACP04765.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae M66-2]
 gi|229355838|gb|EEO20758.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae BX 330286]
 gi|297540262|gb|EFH76322.1| oxygen-independent coproporphyrinogen III oxidase [Vibrio cholerae
           MAK 757]
          Length = 391

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAKLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|258625603|ref|ZP_05720485.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM603]
 gi|258582105|gb|EEW06972.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM603]
          Length = 394

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 208/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +++          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|74316497|ref|YP_314237.1| coproporphyrinogen III oxidase [Thiobacillus denitrificans ATCC
           25259]
 gi|74055992|gb|AAZ96432.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Thiobacillus denitrificans ATCC 25259]
          Length = 392

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 132/381 (34%), Positives = 204/381 (53%), Gaps = 9/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CVKKCPYCDFNSH     + +  ++ +   +++        R I ++FF
Sbjct: 17  PPLSLYIHLPWCVKKCPYCDFNSHAA-EGIPEAAYVDALRADLEHALPDIWGRKIHTVFF 75

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + I  IL  +     +    EIT+EANP ++E   F G+R+AG+ R+SLG
Sbjct: 76  GGGTPSLFSAEGIDRILATVRTLTPLVPGAEITLEANPGTIEAAKFAGFREAGITRVSLG 135

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS + + L+ LGR H+ +EA  A  LA   F   + DL+YALP QT+ +   ++  AL+
Sbjct: 136 IQSFDPRHLKALGRIHDGTEARRAAELAATHFDTFNLDLMYALPGQTLAEALADVDAALA 195

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLS Y LT+E  T F          LP +++A D+     +     G+  YE S +
Sbjct: 196 FQPPHLSAYHLTLEPNTPFGHAAPPN---LPDDDLAADMQLAIGARLIDAGMQHYETSAY 252

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G    HNLNYW++GDY+GIG GAHS++      V     KHP+ ++  V   G  V 
Sbjct: 253 AKPGHAGRHNLNYWQFGDYLGIGAGAHSKLSFHDRIVRQMRTKHPQQYMTAVH-GGAHVA 311

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQFS 374
           +   L+      EF+M  LRL EG+  + +E+  G  L++        + +G +  V+  
Sbjct: 312 DTRALTRNDLPFEFMMNALRLTEGVPAELFELRTGLPLNVCAAALAQARAKGLLG-VELG 370

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           RL  T +G   L+ ++  L +
Sbjct: 371 RLEPTLQGQRFLNDLL-ELFL 390


>gi|85374027|ref|YP_458089.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
 gi|84787110|gb|ABC63292.1| coproporphyrinogen III oxidase [Erythrobacter litoralis HTCC2594]
          Length = 383

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 178/379 (46%), Positives = 235/379 (62%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +Y+HWPFC KKCPYCDFNSHVR   V    + ++ L +M++     G  +++SIFFGGG
Sbjct: 4   ALYIHWPFCAKKCPYCDFNSHVRAS-VDHALWERAMLADMRYEAGKAGGEALTSIFFGGG 62

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ P  +A +L    + W  + ++EIT+EANPSSVE  NF     AGVNR+SLGVQS
Sbjct: 63  TPSLMPPALVASLLQQAERLWGFAPDIEITLEANPSSVETANFHALAAAGVNRVSLGVQS 122

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           L++ +LRFLGR H   EA+ A+  A+  F R+SFDLIYALP QT + W   L+RALS+  
Sbjct: 123 LDDAALRFLGRLHGVEEALTALETAQKAFQRVSFDLIYALPDQTESDWRAGLERALSFGT 182

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            HLSLYQLTIE GT F    + G     +++ A DLY +TQ++T++ GL AYEISNH+  
Sbjct: 183 SHLSLYQLTIEPGTRFATDVRRGVFDPLADDPAADLYTVTQAVTASAGLPAYEISNHARP 242

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G ES HNL YWRY DY GIGPGAH          A    K PE+WL  V + G    E+ 
Sbjct: 243 GEESRHNLTYWRYHDYCGIGPGAH----GRRGGFATLRHKKPENWLAAVDECGSGAQEER 298

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQFSR 375
            LS  +QA E L+MGLRL  G+ ++      G      +D +  +   + G IE V   R
Sbjct: 299 RLSPAEQASEALVMGLRLAAGVDLETLSARFGIGEVSLIDPDKRQLYSQLGLIEHV-NER 357

Query: 376 LRCTQRGMTMLDSVIANLA 394
           LR T +GM +LD+++  L 
Sbjct: 358 LRVTAKGMPLLDALLGELV 376


>gi|254291166|ref|ZP_04961962.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae AM-19226]
 gi|150422860|gb|EDN14811.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae AM-19226]
          Length = 391

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLTRLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|34496382|ref|NP_900597.1| coproporphyrinogen III oxidase [Chromobacterium violaceum ATCC
           12472]
 gi|34102235|gb|AAQ58601.1| probable porphyrin oxidoreductase [Chromobacterium violaceum ATCC
           12472]
          Length = 396

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 139/391 (35%), Positives = 214/391 (54%), Gaps = 10/391 (2%)

Query: 9   NNMTG--QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT 66
           + +TG  +    L +YVH+P+C++KCPYCDFNSH  +    +  ++ + L ++++     
Sbjct: 7   SALTGGLRELPPLALYVHFPWCIRKCPYCDFNSHEPKNGFDEMAYVDALLRDLEYSLPEV 66

Query: 67  GPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYR 126
             R ++SIF GGGTPSL  PQ +  +L G+     +  + EIT+EANP + E+  F+GYR
Sbjct: 67  WGRPLTSIFMGGGTPSLFSPQAMDALLAGVRARMKLHPDAEITMEANPGTFEIERFRGYR 126

Query: 127 KAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQ 186
           +AG+NR+S+G+QS   + L+ LGR H+  EA  A+ +A   F  ++ DL+YALP QT+ +
Sbjct: 127 EAGINRLSIGIQSFNPKHLKALGRIHDGDEAKRAVEIALTHFDNVNLDLMYALPGQTLDE 186

Query: 187 WEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAH 246
              +L  ALSY + HLS Y LTIE  TLF          LP + V+ D+    +S   A 
Sbjct: 187 ALSDLNTALSYGITHLSAYHLTIEPNTLFAAQTPQN---LPDDEVSADMQEAIESCLEAA 243

Query: 247 GLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLK 306
           G   YE S  +  G  S HNLNYW++GDY+GIG GAH ++   +  V     K P ++LK
Sbjct: 244 GFDHYETSAFAKPGRHSRHNLNYWQFGDYVGIGAGAHGKISSHAGIVRQMRHKQPAAYLK 303

Query: 307 MVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQR 364
            V      +   + ++      EF+M  LRL  G   + ++   G  L +        Q 
Sbjct: 304 AVAAG-APLQSSQKVARADLPFEFMMNLLRLTSGFESRLFQERTGLPLALIRRQLDAAQA 362

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           QG ++    + LR T +G   L+ ++  L +
Sbjct: 363 QGLLD-TDGAILRPTLKGQRFLNDLLT-LFL 391


>gi|325918112|ref|ZP_08180267.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325535658|gb|EGD07499.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 385

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 135/389 (34%), Positives = 215/389 (55%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPDLIPPPLSLYVHLPWCVRKCPYCDFNSHAVKGVLPFEEYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL   + I  +L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPAEAIDRLLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H++++A  AI LA++  +  ++ DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSADAERAIKLAQDAGYDNVNIDLMYALPEQTLLQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    H+S YQLT+E  T+F+     G   +P ++ A D+    Q++ +  G  
Sbjct: 181 DLERAFALQPTHMSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQALLAEAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G+ +  +   KH      +  
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAQQHVLRRWKHKHPQTYLAS 297

Query: 310 KNGHAVVEK-EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQG 366
               A +   E +  E+   E+++  LRL EG  + D+E   G   +           QG
Sbjct: 298 AGSAASIGGDEIVPLERLPFEYMLNLLRLHEGFRLSDFEASTGLAASAIAAPVARAVAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++   Q  R+  T+ G    + V+  L +
Sbjct: 358 WLIE-QHGRVVPTELGRRFTNDVV-ELFL 384


>gi|21232683|ref|NP_638600.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767295|ref|YP_242057.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21114492|gb|AAM42524.1| oxidoreductase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572627|gb|AAY48037.1| oxidoreductase [Xanthomonas campestris pv. campestris str. 8004]
          Length = 385

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 138/389 (35%), Positives = 212/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +     ++++ + + ++     L   R 
Sbjct: 1   MPDLIPPPLALYVHLPWCVRKCPYCDFNSHAAKGAPPFDDYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  P+ I   L   A     + N+EIT+E NP + E   F GYR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPEAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFDGYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQS ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQSFDDAALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLAQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +A G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPQG---IPDDDDAWDMQEHCQRLLAAAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-SHRVAISIEKHPESWLKMV 308
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G   +V    +          
Sbjct: 238 QYEVSAYARPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEQQVLRRWKHKHPQSYLAS 297

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQG 366
             +  A+   E + + +   E+++  LRL EG  + D+E   G    +          QG
Sbjct: 298 AGSAAAIGGDEHVPAARLPFEYMLNLLRLHEGFRLSDFEACTGLPAQVLQAPLARAMAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++   Q  R+  T+ G    + V+  L +
Sbjct: 358 WLVE-QHGRIVPTELGRRFTNDVV-ELFL 384


>gi|294627119|ref|ZP_06705707.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598552|gb|EFF42701.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 385

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 141/394 (35%), Positives = 210/394 (53%), Gaps = 19/394 (4%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEEYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPAHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQGLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG------SHRVAISIEKHPES 303
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G              + +  S
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLAS 297

Query: 304 WLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERN 361
                   G  +V  E LS      E+++  LRL EG  + D+E   G            
Sbjct: 298 AGTAASIGGDEIVPGERLS-----FEYMLNLLRLHEGFRLSDFEASTGLAACAIKAPLAR 352

Query: 362 LQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
              QG++ R Q  R+  T+ G    + V+  L +
Sbjct: 353 AVAQGWM-RQQDGRVVPTELGRRFTNDVV-ELFL 384


>gi|302186237|ref|ZP_07262910.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. syringae
           642]
          Length = 404

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 205/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGRLLKGVEQRIRFASDIEITLEANPGTFEQVKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS EE  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L +A+
Sbjct: 150 IQSFEESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLHQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +AHG   YE+S 
Sbjct: 210 TLAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQEAGQQLLAAHGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|306824955|ref|ZP_07458298.1| coproporphyrinogen dehydrogenase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432782|gb|EFM35755.1| coproporphyrinogen dehydrogenase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 376

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 122/384 (31%), Positives = 205/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++LDG+ KN  +S   E+TIEANP  ++ +     +++ VNR+SL
Sbjct: 58  IGGGTPTALSASQLEVLLDGLTKNLDLSVLEELTIEANPGDLDADKIAVLKQSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMAQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +        G A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVDGVRYKNHGPIRHYLSAVEA-----GDA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR+ +    E  R+L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGRSFEGLYGEIIRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|192362341|ref|YP_001980647.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Cellvibrio japonicus Ueda107]
 gi|190688506|gb|ACE86184.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Cellvibrio japonicus Ueda107]
          Length = 393

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 137/393 (34%), Positives = 205/393 (52%), Gaps = 20/393 (5%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C++KCPYCDFNSH     + + ++I +   ++   + L   R I+SIFF
Sbjct: 6   PPLALYIHVPWCIRKCPYCDFNSHQANNDIPEADYIAALRQDLACDQSLAQGRKITSIFF 65

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  Q I  IL    +      ++EIT+EANP + E   F G+R AGVNR+S+G
Sbjct: 66  GGGTPSLLSAQAIGQILVDAEQLIGFEPHIEITLEANPGTFEQEKFSGFRAAGVNRLSIG 125

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS  +Q L  LGR H   EA+ A+++AR   F  ++ DL++ LP Q++   + +LQ+A+
Sbjct: 126 IQSFNDQQLHLLGRVHGRDEALRAVNVARKAGFDNINLDLMHGLPGQSVGDAQADLQQAI 185

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
               +HLS YQLTIE+ T FY        VLP E +  D+ +  Q + +A G   YEIS 
Sbjct: 186 ELEPEHLSWYQLTIEQNTAFYSAPP----VLPEEEILADIQDAGQLLLAAAGYEHYEISA 241

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV--AISIEKHPESWLKM------ 307
           ++     S HNLNYW +GDY+GIG GAH +V +   +    +   + P+ +L        
Sbjct: 242 YARAKQFSRHNLNYWEFGDYLGIGAGAHGKVTLPEQQNILRLWKTRLPKHYLDAATSARI 301

Query: 308 ----VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERN 361
                          + L  E    EF+M  LRL  G+  + +    G +      C   
Sbjct: 302 STNLQGHQNPFGGGSDLLGEESLPLEFMMNALRLHRGVPEQYFAQRTGLDFSAIASCWDE 361

Query: 362 LQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           L R+  +E    + LR T  G   L+ V+    
Sbjct: 362 LARKKLVELADGA-LRPTPLGRRFLNRVLQAFM 393


>gi|166713275|ref|ZP_02244482.1| coproporphyrinogen III oxidase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 385

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 134/389 (34%), Positives = 212/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  P+ I   L   +     + N+E+T+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPEAIDRFLQAASARLRFAPNLEMTLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H++++A  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSADAERAIKLAQDAGYDNFNIDLMYALPEQTLLQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLANAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-SHRVAISIEKHPESWLKMV 308
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G    V    +          
Sbjct: 238 QYEVSAYARPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLAS 297

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQG 366
                ++   E +  E+   E+++  LRL EG  + D+E   G   ++          QG
Sbjct: 298 AGTAASIGGDEIVPRERLPFEYMLNLLRLHEGFRLNDFEASTGLAASVIEVPLARALAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ R Q +R+  T+ G    + V+  L +
Sbjct: 358 WMSR-QDARVVPTELGRRFTNDVV-ELFL 384


>gi|121611071|ref|YP_998878.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Verminephrobacter eiseniae EF01-2]
 gi|121555711|gb|ABM59860.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Verminephrobacter eiseniae EF01-2]
          Length = 416

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 134/389 (34%), Positives = 209/389 (53%), Gaps = 17/389 (4%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRR--------YKVGQENFIQSFLTEMQWMRQLTGP 68
             L +YVH P+C++KCPYCDFNSH  R          + ++ ++ + + +++    L   
Sbjct: 30  PPLSLYVHLPWCLRKCPYCDFNSHALRAGNAGSAAEPLPEQRYLAALMADLEAALPLVWG 89

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKA 128
           R + S+F GGGTPSL  P  I  ++  I     +    EIT+EANP S E   F+ +R A
Sbjct: 90  RMVRSVFIGGGTPSLFSPAAIDQLIGAIRARLPLVPACEITLEANPGSFEKERFRAFRAA 149

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWE 188
           GV R+S+GVQS  ++ L  LGR H+ ++A+AA+  A   F   + D++YALP QT+ + E
Sbjct: 150 GVTRLSVGVQSFADRHLAALGRVHDRAQALAAVQEAAQAFETFNLDIMYALPGQTLQELE 209

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
            +L++AL+    H+S+YQLTIE  T F K        LP +++A  + +    +T   GL
Sbjct: 210 QDLRQALALEPPHISVYQLTIEPNTRFAKFPPA----LPEDDLAYAMLDRITQLTGQAGL 265

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
             YEIS ++  G +  HN NYW++GDY+GIG GAHS++      V     + P  +++  
Sbjct: 266 ARYEISAYARPGQQCAHNTNYWQFGDYLGIGAGAHSKLSFAHRVVRQVRLREPGRYMEQA 325

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQG 366
                   + E +       EF++  LRL +G + +D+    G  L        + +RQG
Sbjct: 326 LAGRALAQD-EEVRRADLPFEFMLNALRLCDGFAPQDFMARTGLPLSAIAEGLASAERQG 384

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
            IER    R+R T RG+  L+  +  L +
Sbjct: 385 LIER-SMERIRATPRGLDFLND-LQVLFL 411


>gi|289167566|ref|YP_003445835.1| Coproporphyrinogen III oxidase, oxygen-independent
           coproporphyrinogen III oxidase [Streptococcus mitis B6]
 gi|288907133|emb|CBJ21967.1| Coproporphyrinogen III oxidase, oxygen-independent
           coproporphyrinogen III oxidase [Streptococcus mitis B6]
          Length = 376

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 120/384 (31%), Positives = 203/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L G+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSASQLEVLLKGLTKNLDLSVLEELTIEANPGDLDADKIAVLKNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMEQVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 IGLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +  +     G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLSAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR  D    E  ++L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGRPFDGLYGEIVKDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|332701625|ref|ZP_08421713.1| oxygen-independent coproporphyrinogen III oxidase [Desulfovibrio
           africanus str. Walvis Bay]
 gi|332551774|gb|EGJ48818.1| oxygen-independent coproporphyrinogen III oxidase [Desulfovibrio
           africanus str. Walvis Bay]
          Length = 464

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 126/398 (31%), Positives = 185/398 (46%), Gaps = 10/398 (2%)

Query: 2   KYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRR--YKVGQENFIQSFLTEM 59
           + L     + T     +L +YVH PFC  KC YC F+S           E + ++   EM
Sbjct: 41  QVLEPQPVDTTNPKQPALLLYVHVPFCRSKCRYCAFHSVPLTMDSMEDMERYAEAVAREM 100

Query: 60  QWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEV 119
           +   Q  G     +++FGGGTPS++    +  I+  +  ++ +S   E T EANP SV +
Sbjct: 101 KLWGQRLGKPPAHTVYFGGGTPSVLPEYALERIMRALRDSFDLSGCQEFTFEANPDSVHL 160

Query: 120 NNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYA 178
           N  +  R  GVNR+SLGVQSL    L FLGR HNA +A+ A H AR      +S D I+ 
Sbjct: 161 NYLRELRDFGVNRLSLGVQSLNNDELTFLGRPHNALQAVQAFHTARAAGFGNVSLDFIWG 220

Query: 179 LPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNL 238
           LP+Q    W   L++A     +HLS Y LTIE  T      + G L+LP E++    Y  
Sbjct: 221 LPRQNAASWIKTLKKAEELRPEHLSCYGLTIEPNTPLEAEEQAGTLILPGEDMLAKCYIY 280

Query: 239 TQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE 298
                  HG   YEIS+ + +G  S HN+ YW   DY+G GP A S            + 
Sbjct: 281 GAQFLEEHGYLQYEISSFARMGYASKHNMGYWAGSDYLGFGPAAVSTFGGRRWTNPTDMH 340

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC 358
            +           G      E L    +  E +M+ LR  +G+ +++ +   G +     
Sbjct: 341 DYVFQVDA-----GGTGKRAEELDEATRLRERIMLALRTTQGLDLREHDKRTGGSFLERH 395

Query: 359 ER--NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
            +   L R   + R+    L  T+ GM + D++I  LA
Sbjct: 396 RKLVTLLRNNGLIRLSKGSLSLTRTGMLVSDTIIEKLA 433


>gi|322372731|ref|ZP_08047267.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus sp. C150]
 gi|321277773|gb|EFX54842.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus sp. C150]
          Length = 378

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 119/384 (30%), Positives = 207/384 (53%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++++ + E +    L   + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLRALIREWE----LLDIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSNLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I   +      +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESIDSLKAAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 IELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +    LQ  G + + 
Sbjct: 294 RLHEEHLTKAEMMEEEFFLGLRKKSGVSIKRFEEKFGLSFADTYGDIVEKLQADGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + D+V     +
Sbjct: 353 DPDVIRMTKRGLFLGDNVAEQFIL 376


>gi|157960949|ref|YP_001500983.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella pealeana ATCC 700345]
 gi|157845949|gb|ABV86448.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella pealeana ATCC 700345]
          Length = 378

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 129/383 (33%), Positives = 199/383 (51%), Gaps = 14/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q  +I + + +++        R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQHGELPQTEYIDALIKDLKQDLHYVQGRRLDTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  +L  + K    S N+EIT+EANP ++E ++F+ Y KAGV R+S+G
Sbjct: 65  GGGTPSLFDAAQIGRLLAEVDKLVPFSDNIEITMEANPGTLEHDDFEAYCKAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR HN  EA  A   A+ + +   + DL++ LP Q+  +   +++ A 
Sbjct: 125 VQSFSSDKLNLLGRIHNKDEAHIAAQKAKVSGYQSFNLDLMHGLPNQSFDEALSDIETAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 185 ELAPPHLSWYQLTIEPNTLFHSKPPQ----LPDDENLWQIYEQGQKRLAALGYQQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVK--VGSHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH ++     +  V     KHP+ +L       +
Sbjct: 241 YAKEGFQCRHNLNYWQFGDYLGIGCGAHGKITLLDDNKIVRTVKIKHPKGYLAA----DN 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERV 371
              E   +  E +A E+LM  LRL   I   ++E   G   D   +  +    +G +   
Sbjct: 297 YTDETTEVVEEDRALEYLMNRLRLMSPIPKVEFEQRTGLTRDTISDGVKQGCAKGLMTES 356

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
                + T +G   ++ +++   
Sbjct: 357 D-EHWQLTSKGHMFVNELLSQFL 378


>gi|262403919|ref|ZP_06080476.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC586]
 gi|262349881|gb|EEY99017.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC586]
          Length = 391

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 209/387 (54%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKDDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +++          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|21244125|ref|NP_643707.1| coproporphyrinogen III oxidase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21109754|gb|AAM38243.1| oxidoreductase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 385

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 139/389 (35%), Positives = 212/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEAYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPAHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQGLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G+    +   KH      +  
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEAHVLRRWKHKHPQSYLAS 297

Query: 310 KNGHAVVEK-EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQG 366
               A +   E +  E+   E+++  LRL EG  + D+E   G               +G
Sbjct: 298 AGTAASIGGDEIVPGERLPFEYMLNLLRLHEGFRLSDFEASTGLAACAIEAPLARAVAKG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ R Q  R+  T+ G    + V+  L +
Sbjct: 358 WM-RQQDGRVVPTELGRRFTNDVV-ELFL 384


>gi|294667392|ref|ZP_06732610.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292602833|gb|EFF46266.1| coproporphyrinogen III oxidase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 385

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 143/390 (36%), Positives = 215/390 (55%), Gaps = 11/390 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGALPFEEYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPAHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQGLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKM 307
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G   H +     KHP+S+L  
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKHKHPQSYLAS 297

Query: 308 VRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQ 365
                    + E +  E+   E+++  LRL EG  + D+E   G               Q
Sbjct: 298 AGTAASIGGD-EIVPGERLPFEYMLNLLRLHEGFRLSDFEASTGLAACAIEAPLARAVAQ 356

Query: 366 GFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           G++ R Q  R+  T+ G    + V+  L +
Sbjct: 357 GWM-RQQDGRVVPTELGRRFTNDVV-ELFL 384


>gi|323490049|ref|ZP_08095270.1| coproporphyrinogen III oxidase [Planococcus donghaensis MPA1U2]
 gi|323396345|gb|EGA89170.1| coproporphyrinogen III oxidase [Planococcus donghaensis MPA1U2]
          Length = 379

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 120/381 (31%), Positives = 196/381 (51%), Gaps = 11/381 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG-PRSISSIFFGG 78
           G+Y+H PFC + C YCDFN    + +   + +I S   E+   +Q     + + +IF GG
Sbjct: 4   GLYIHIPFCHQICFYCDFNKVYFKDQ-PVDAYIDSLGKELALWKQQGALDKPLETIFLGG 62

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTP+ + P  +  +L  I +   ++ N+E T EANP  +  +  Q     GVNR+S+GVQ
Sbjct: 63  GTPTSLTPAQLEKLLAYIHRYVPMAENLEWTSEANPDELTKDKMQVLFDGGVNRLSMGVQ 122

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S +E  L+ LGR H+ S+   A+  AR + F  +SFDL+Y LP Q+M QW+  L+RA ++
Sbjct: 123 SFDEDLLKRLGRTHSNSDVKRAVDSARQVGFENLSFDLMYGLPGQSMQQWDDTLERAFAF 182

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            + H S Y L IE  T+FY +   G L   +E++  D+Y    +     GL  YEISN +
Sbjct: 183 DMPHFSAYSLIIEPKTVFYNLMTKGKLNTVTEDLEADMYEKLMNEMDKRGLKQYEISNFA 242

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YW   +YIG+G GAH  V    +  A       + ++  + +    ++ 
Sbjct: 243 RPGHESHHNLLYWDNVEYIGVGAGAHGYVDGVRYSNAG----PLKKYMSPLDEGERPILS 298

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFS 374
              +   ++ +E + +GLR   G+S+  ++    + +       L     QG +E +   
Sbjct: 299 THIVPPHEKMEEEMFLGLRKTAGVSLHHFQTKFQKPMQDVYGTILDKEIAQGNLE-IANG 357

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
            L+ T++G  + + V     +
Sbjct: 358 FLKLTRKGRFVGNEVFQQFLL 378


>gi|229550209|ref|ZP_04438934.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis ATCC 29200]
 gi|300859895|ref|ZP_07105983.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TUSoD Ef11]
 gi|307277568|ref|ZP_07558660.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX2134]
 gi|312952302|ref|ZP_07771177.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0102]
 gi|229304647|gb|EEN70643.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis ATCC 29200]
 gi|300850713|gb|EFK78462.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TUSoD Ef11]
 gi|306505833|gb|EFM75011.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX2134]
 gi|310629686|gb|EFQ12969.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0102]
 gi|315147785|gb|EFT91801.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX4244]
          Length = 394

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 17  SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 75

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 76  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 135

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 136 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 195

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 196 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 255

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 256 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 311

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 312 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQRLIKEELLIE-EADI 370

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 371 LRLTKKGLFVGNNVFEAFLL 390


>gi|262164092|ref|ZP_06031831.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio mimicus
           VM223]
 gi|262027620|gb|EEY46286.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio mimicus
           VM223]
          Length = 394

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 140/387 (36%), Positives = 206/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G A+      ++EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGFAERIAFKPDIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +++          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEVIRPTLDWALNEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|228476821|ref|ZP_04061466.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus salivarius SK126]
 gi|228251395|gb|EEK10540.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus salivarius SK126]
          Length = 378

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 208/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++++ + E +    L   + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLRALIREWE----LLDIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSHLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I   +      +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESIDSLKAAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +  + LQ  G + + 
Sbjct: 294 RLHEEHLTKSEMMEEEFFLGLRKKSGVSIKRFEEKFGLSFADTYGDIVKKLQEDGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|293365721|ref|ZP_06612430.1| coproporphyrinogen dehydrogenase [Streptococcus oralis ATCC 35037]
 gi|307703664|ref|ZP_07640606.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus oralis ATCC 35037]
 gi|291316089|gb|EFE56533.1| coproporphyrinogen dehydrogenase [Streptococcus oralis ATCC 35037]
 gi|307623071|gb|EFO02066.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus oralis ATCC 35037]
          Length = 376

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 124/384 (32%), Positives = 202/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E          + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFHSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + L+LDG+ KN   S   E+TIEANP  ++ +     +++ VNR+SL
Sbjct: 58  IGGGTPTALSAPQLELLLDGLTKNLDSSVLEELTIEANPGDLDADKIAVLKQSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ + + L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDNKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMAQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    S     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIISELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +        G A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLNAVEA-----GDA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E L+ ++Q +E + +GLR + G+S+  +E   GR+ D    E  R+L +QG + ++
Sbjct: 293 RITEENLTQKEQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIIRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|261210032|ref|ZP_05924330.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC341]
 gi|260840797|gb|EEX67339.1| coproporphyrinogen III oxidase, oxygen-independent [Vibrio sp.
           RC341]
          Length = 391

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 140/387 (36%), Positives = 208/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLEDLDRDIERYQLKDDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+  T    +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERITFKPGIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     +  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLNDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFTDGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +++          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|37525144|ref|NP_928488.1| coproporphyrinogen III oxidase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784570|emb|CAE13470.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 376

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 208/382 (54%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L +++    +   R +++IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLKTDLPMVNGREVTTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  Q +  +LDG+     VS   EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSSQAMQQLLDGVRALLPVSPQAEITMEANPGTVEADRFSGYQQAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H   EA  A HLA ++  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSPDKLVRLGRIHGPDEAKRAAHLAASLGLRSFNLDLMHGLPNQSLDEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             +  HLS YQLTIE  T F         VLP ++   D+++    + +A G   YE S 
Sbjct: 185 ELSPPHLSWYQLTIEPNTSFGSRPP----VLPDDDALWDIFSQGHQLLTAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  ++    ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFEDGRILRTV----KTKHPRGYMQGRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
            ++  + +E +  EF M   RL E +  +D+    G +        +     G++     
Sbjct: 297 DKQHQVENEDRPFEFFMNRFRLLEAMPKQDFSDFTGLSETSIRTQIKQALAAGYLSET-A 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +  + TQ+G   L+S++  L +
Sbjct: 356 THWQITQKGKLFLNSLL-ELFL 376


>gi|296119872|ref|ZP_06838426.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Corynebacterium ammoniagenes DSM 20306]
 gi|295967026|gb|EFG80297.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Corynebacterium ammoniagenes DSM 20306]
          Length = 395

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 119/385 (30%), Positives = 187/385 (48%), Gaps = 17/385 (4%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQE---NFIQSFLTEMQWMRQLTGPRSI 71
           ++S G+Y+H PFC  +C YCDFN++         +    ++ +   E++   +    R  
Sbjct: 19  TDSFGLYIHVPFCATRCGYCDFNTYTPGELGSPHDLTGPYLNALERELEKAAEKV-NRPA 77

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            +IF GGGTPSL+  + +  +L+    ++ +S + EIT E+NP S     F+  ++AG  
Sbjct: 78  DTIFVGGGTPSLLGGEGLTRVLNAARNSFGISPDAEITTESNPESTSPEFFEQIKEAGFT 137

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEME 190
           R+SLG+QS     L+ L R H      AA   A+   F  ++ D+IYA P +T       
Sbjct: 138 RVSLGMQSAASHVLQILERAHTPGRPFAAAREAKAAGFEHVNLDMIYATPTETDDDVRRT 197

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L  AL   VDH+S Y L +E GT   +  K G+L  P ++     Y +  S     G   
Sbjct: 198 LDLALETGVDHISAYSLIVEDGTRMARKVKKGELPAPDQDTMAKRYEIIASRLDDAGFGW 257

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SN +  G E  HN+ YWR  ++ G GPGAHS +            K P  ++KM+  
Sbjct: 258 YEVSNWAKEGGECRHNMIYWRDQEWWGAGPGAHSHIGNER----FYNVKLPGRYIKMLGD 313

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIER 370
           +   + + E L+  +   E +M+GLRLREGI           +       +   +G +  
Sbjct: 314 DELPIADSETLTESENHMEKIMLGLRLREGIDRSLL-----LDAAQPMVDSFIDRGLL-- 366

Query: 371 VQFSRLRCTQRGMTMLDSVIANLAV 395
           V   RLR T+ G  + D +I +L +
Sbjct: 367 VDDGRLRVTKAGRLLADGIITDLLL 391


>gi|319651617|ref|ZP_08005744.1| coproporphyrinogen III oxidase [Bacillus sp. 2_A_57_CT2]
 gi|317396684|gb|EFV77395.1| coproporphyrinogen III oxidase [Bacillus sp. 2_A_57_CT2]
          Length = 377

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/378 (29%), Positives = 187/378 (49%), Gaps = 12/378 (3%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN    + +     ++ S   EM    +      + SIF GGGTP
Sbjct: 6   YIHIPFCEHICHYCDFNKVFLKNQ-PVGEYLDSLDKEMNLALKEVPASRLDSIFVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           + +  + +  +   I       S  E T EANP  +     Q    AGVNR+S GVQ+  
Sbjct: 65  TALNGKQLEKLCGTIKGQLPYDSFTEYTFEANPGDLSEEKLQILHDAGVNRLSFGVQTFN 124

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           ++ L+ +GR+H A +   +I  A+ + F  +S DLIY+LP QT+  ++  L+ + +  + 
Sbjct: 125 DELLKRIGRSHRARDVFQSIEAAKKVGFDNISIDLIYSLPGQTLQDFKDTLETSFTLDIA 184

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           H S Y L IE  T+FY + + G L  P E+V  ++Y L       HG   YEISN +  G
Sbjct: 185 HYSGYSLIIEPKTVFYNLMRKGKLPTPGEDVEAEMYELLMEQMGKHGFAQYEISNFAKPG 244

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
            ES HN+ YW    Y G G GAH  VK              + +++ +      ++E+  
Sbjct: 245 YESRHNITYWDNEWYFGFGAGAHGYVKGLRRSN----HGPLKKYMEPIENGRLPILEEHK 300

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIERVQFSRL 376
           +  E+Q +E + +GLR  EG+S+  ++   G++      ++ +++ +++  +   +   +
Sbjct: 301 VPLEEQMEEEMFLGLRKTEGVSISRFKEKFGKDPLELFKVQIKQHAEKE--LIIAEEDHI 358

Query: 377 RCTQRGMTMLDSVIANLA 394
           + T+RG  + + V  +  
Sbjct: 359 KLTRRGRFLGNEVFQSFI 376


>gi|260429507|ref|ZP_05783484.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Citreicella sp. SE45]
 gi|260420130|gb|EEX13383.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Citreicella sp. SE45]
          Length = 383

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 162/378 (42%), Positives = 225/378 (59%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV    V Q  + ++ + E+     LT  R + SI+FG
Sbjct: 9   GFGLYVHWPFCEAKCPYCDFNSHVTA-HVDQTRWAEALVRELARYGALTEGRMLRSIYFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P+ +  +L     +W  ++++EIT+EANP SVE+  F+G+   GVNR+SLGV
Sbjct: 68  GGTPSLMQPETVGAVLRASRDHWAWANDIEITLEANPRSVEIRKFEGFAGVGVNRVSLGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L    LR LGR H   EA++A+ +AR+ F R+SFDLIY    Q++  WE EL+ AL  
Sbjct: 128 QALRPDDLRRLGRLHGVDEALSALDIARSTFSRVSFDLIYGRQGQSLAAWETELREALDL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLSLYQLTIE+GT F++  + G L   P+E++  D+Y  TQ I  A G  AYE+SNH
Sbjct: 188 AGDHLSLYQLTIEEGTAFWERAQAGGLKGLPNEDLGADMYLATQDICGAAGFEAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +   A S HNL YWR GDY+GIGPGAH RV +   R A    + P  W+           
Sbjct: 248 AQRDAMSRHNLVYWRGGDYVGIGPGAHGRVTLNGVRHASVARRLPGPWIAAAEAG-SGDE 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
               L+ E    E++MMG+RL EG+ ++    + G   +       Q  G I R   +R 
Sbjct: 307 SLLPLTGEDVWAEYIMMGMRLSEGLDLERAREIGGTRFEEMPLEKFQDLGLIWR-DATRF 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             T +G  +L+++ + L 
Sbjct: 366 GATLQGRMVLNTLTSELL 383


>gi|322516608|ref|ZP_08069522.1| coproporphyrinogen dehydrogenase [Streptococcus vestibularis ATCC
           49124]
 gi|322124878|gb|EFX96302.1| coproporphyrinogen dehydrogenase [Streptococcus vestibularis ATCC
           49124]
          Length = 378

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 208/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++ + + E +    L   + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLSALIREWE----LLNIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSNLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I   ++     +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESIDSLKSAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +  + LQ  G + + 
Sbjct: 294 RLHEEHLTKAEMMEEEFFLGLRKKSGVSIKRFEEKFGLSFADTYGDIVKKLQEDGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|258620718|ref|ZP_05715753.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM573]
 gi|258586916|gb|EEW11630.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           mimicus VM573]
          Length = 394

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 208/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+  T   ++EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERITFKPDIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLTSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHKKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +++          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLAIEVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|194017672|ref|ZP_03056282.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Bacillus pumilus ATCC 7061]
 gi|194010572|gb|EDW20144.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Bacillus pumilus ATCC 7061]
          Length = 379

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 114/378 (30%), Positives = 187/378 (49%), Gaps = 11/378 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN    + +   + ++ +   EMQ   +  G + + +IF GGGTP
Sbjct: 5   YIHIPFCEHICHYCDFNKFFIKTQ-PVDEYLAALEKEMQHTIEQKGEQELKTIFIGGGTP 63

Query: 82  SLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +    +  ++  I +      + VE  +EANP  + +      ++AGVNR+S GVQ+ 
Sbjct: 64  TSLTVSQLDQLMTSIHRVLKPSKNLVEFAVEANPDELSLEKLHVLKEAGVNRLSFGVQTF 123

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           E+  L+ +GR H   + + +   AR + F  +S DL++ LP Q        L+ A S   
Sbjct: 124 EDDLLKKIGRVHQKKDVLTSFERARAVGFDNISLDLMFGLPHQEKHHVMNSLETAFSLGA 183

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           +H S+Y L +E  T+FY + + G L LP +    ++Y L       HGLH YEISN++  
Sbjct: 184 EHYSVYSLIVEPKTVFYNLMQKGKLHLPPQEREAEMYELVMDEMERHGLHQYEISNYAKP 243

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G ES HNL YW   DY G G GAH  V    +  A  ++ + E    ++ + G    E  
Sbjct: 244 GFESQHNLTYWSNEDYFGFGAGAHGYVDGIRNVNAGPVKHYLE----LIEQTGFPYKETH 299

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFSRL 376
            ++  +Q +E + +GLR  EG+   D++   G + +         L+ +G I +     +
Sbjct: 300 QVTKAEQIEEEMFLGLRKIEGVKSADFQAKYGASPEALFPSVLEELEEKGLIVKDDIG-I 358

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T++G  + + V     
Sbjct: 359 RLTRKGKLLGNEVFQAFL 376


>gi|315145614|gb|EFT89630.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX2141]
 gi|315160301|gb|EFU04318.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0645]
 gi|315166723|gb|EFU10740.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX1341]
          Length = 382

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 117/380 (30%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E++  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIRLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|322375510|ref|ZP_08050023.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus sp. C300]
 gi|321279773|gb|EFX56813.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus sp. C300]
          Length = 376

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 125/384 (32%), Positives = 204/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E          + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFHSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + L+LDG++KN  +S   E+TIEANP  ++ +     +++ VNR+SL
Sbjct: 58  IGGGTPTALSAPQLELLLDGLSKNLDLSVLEELTIEANPGDLDADKIAVLKQSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ + + L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDNKMLKKIGRSHLEKDIYDNIDRLKLAGFDNISIDLIYALPGQTMAQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    +R    I  +  +        G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYRNHGPIRHYLNAVEA-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS  +Q +E + +GLR + G+S+  +E   GR+ D    E  R+L +QG + ++
Sbjct: 293 RITEEHLSQREQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIIRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|229525146|ref|ZP_04414551.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae bv. albensis VL426]
 gi|229338727|gb|EEO03744.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae bv. albensis VL426]
          Length = 391

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 143/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+AK       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAKRIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S LG +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKLGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLATLNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALNEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|330961992|gb|EGH62252.1| HemN family oxidoreductase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 404

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/382 (33%), Positives = 204/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     + L+L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALGLLLRGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +E  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +  G   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATQGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIIR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G +     
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHE-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 ARLVATPQGQLFLNDLLQYFLI 404


>gi|78049073|ref|YP_365248.1| coproporphyrinogen III oxidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927892|ref|ZP_08189116.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas perforans
           91-118]
 gi|78037503|emb|CAJ25248.1| putative oxygen-independent coproporhyriogen III oxigenase
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325541732|gb|EGD13250.1| coproporphyrinogen III oxidase, anaerobic [Xanthomonas perforans
           91-118]
          Length = 385

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 140/389 (35%), Positives = 213/389 (54%), Gaps = 9/389 (2%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           M       L +YVH P+CV+KCPYCDFNSH  +  +  E ++ + + ++     L   R 
Sbjct: 1   MPQLIPPPLSLYVHLPWCVRKCPYCDFNSHAAKGVLPFEEYVDALIRDLDADLPLVWGRV 60

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL  PQ I   L   A     + N+EIT+E NP + E   F+ YR AGV
Sbjct: 61  VHSVFFGGGTPSLFPPQAIDRFLQAAAARLRFAPNLEITLETNPGTAEHGRFEHYRAAGV 120

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEM 189
           NR+S GVQ+ ++ +L+ LGR H+++EA  AI LA++  +   + DL+YALP+QT+ Q E 
Sbjct: 121 NRLSFGVQTFDDLALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYALPEQTLMQAEH 180

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L+RA +    HLS YQLT+E  T+F+     G   +P ++ A D+    Q + +  G  
Sbjct: 181 DLERAFALQPTHLSHYQLTLEPNTVFFARPPKG---IPDDDAAWDIQEHCQRLLADAGYA 237

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+S ++  G +  HNLNYWR+GDY+GIG GAH ++  G+    +   KH      +  
Sbjct: 238 QYEVSAYAKPGRQCAHNLNYWRFGDYLGIGAGAHGKISSGAQEHVLRRWKHKHPQSYLAS 297

Query: 310 KNGHAVVEK-EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQG 366
               A +   E +  E+   E+++  LRL EG  + D+E   G    +          QG
Sbjct: 298 AGTAASIGGDEIVPGERLPFEYMLNLLRLHEGFRLSDFEASTGLAACVIDAPLARAVAQG 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           ++ R Q  R+  T+ G    + V+  L +
Sbjct: 358 WM-RRQDGRVVPTELGRRFTNDVV-ELFL 384


>gi|313902209|ref|ZP_07835617.1| oxygen-independent coproporphyrinogen III oxidase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467544|gb|EFR63050.1| oxygen-independent coproporphyrinogen III oxidase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 482

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 115/380 (30%), Positives = 200/380 (52%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG-PRSISSIFFGG 78
            +Y+H P+C ++C YCDFN+++     G+  ++ +   E+  +    G  R + S+F GG
Sbjct: 103 ALYIHVPYCRQRCYYCDFNTYLL-DPEGKRRYLAALERELDLLAADPGLTRPLVSVFVGG 161

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL+EP  +  +L+ + + + ++   EIT+E NP +++    +  R  GV R+SLG+Q
Sbjct: 162 GTPSLLEPAELERLLEAVHRRFALAPGAEITVECNPGTLDEGRLRALRGGGVTRLSLGLQ 221

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           +++++ L+ +GR+H  ++  A     R   F  ++ DLI+ LP QT+ QWE  L+  ++ 
Sbjct: 222 AVQDELLQAIGRDHTWADFQATYERVRRAGFDNVNVDLIFGLPGQTLAQWEESLRAVVAL 281

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H+S Y L +  GT F++  + G L LP E+    +++    +  A G   YEISN +
Sbjct: 282 EPEHVSCYGLELHPGTPFHRRWEAGLLDLPGEDAERAMFDRAYEVLGAAGFVRYEISNFA 341

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES+HN  YW  G Y+G GPGA S  +    R       HP ++   + +   AV  
Sbjct: 342 RPGRESVHNRVYWLNGSYLGAGPGAWSCWQGERRRN----RLHPLAYAASLEQGEPAVDL 397

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
           +E +   Q  +E +++GLRL EG+    +    G             L   G++ R +  
Sbjct: 398 REPVGRRQAMEETMILGLRLAEGVEEARFARRFGLTPAEAFPEAVARLLAGGWLLR-EAG 456

Query: 375 RLRCTQRGMTMLDSVIANLA 394
            LR + + + + +SV+A   
Sbjct: 457 YLRLSLQAVPVANSVLAEFV 476


>gi|270292462|ref|ZP_06198673.1| coproporphyrinogen dehydrogenase [Streptococcus sp. M143]
 gi|270278441|gb|EFA24287.1| coproporphyrinogen dehydrogenase [Streptococcus sp. M143]
          Length = 376

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 122/384 (31%), Positives = 204/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++LDG+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLDGLTKNLDLSVLEELTIEANPGDLDADKIAVLKHSPVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMDQVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +S  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 ISLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +        G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLNAVEA-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR+ D    E  R+L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIIRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + D+V     +
Sbjct: 352 DGDHVRMTKRGLFLGDTVAERFIL 375


>gi|153828432|ref|ZP_01981099.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae 623-39]
 gi|148876141|gb|EDL74276.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae 623-39]
          Length = 391

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALNEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSEDDL-HWQITEKGKLFLNDLLEAFM 386


>gi|307701946|ref|ZP_07638955.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus mitis NCTC 12261]
 gi|307616761|gb|EFN95949.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus mitis NCTC 12261]
          Length = 376

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 122/384 (31%), Positives = 203/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E Q        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFQSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L G+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSASQLEVLLKGLTKNLDLSFLEELTIEANPGDLDADKIAVLKNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMEQVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 IGLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +  +     G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLNAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR+ D    E  R L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIVRELVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
              R+R T+RG+ + D+V     +
Sbjct: 352 DGDRVRMTKRGLFLGDTVAERFIL 375


>gi|147675539|ref|YP_001215981.1| coproporphyrinogen III oxidase [Vibrio cholerae O395]
 gi|146317422|gb|ABQ21961.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae O395]
 gi|227012308|gb|ACP08518.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           cholerae O395]
          Length = 391

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 141/387 (36%), Positives = 206/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALNEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSEDDL-HWQITEKGKLFLNDLLEAFM 386


>gi|259046703|ref|ZP_05737104.1| coproporphyrinogen dehydrogenase [Granulicatella adiacens ATCC
           49175]
 gi|259036599|gb|EEW37854.1| coproporphyrinogen dehydrogenase [Granulicatella adiacens ATCC
           49175]
          Length = 385

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 120/378 (31%), Positives = 191/378 (50%), Gaps = 10/378 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN          + +I+  + EM+   +      + +++ GGGTP
Sbjct: 7   YIHIPFCSHICYYCDFNKVFI-EGQPVDEYIELLIREMELTGKKYKIEPLETLYVGGGTP 65

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           S + PQ +  +LDGI +   +    E ++E NP           +K GVNR+S+GVQ+  
Sbjct: 66  SSLNPQQMERLLDGIHQYLPLQKGAEFSMELNPDDGTHELLTVMKKGGVNRLSMGVQTFN 125

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
              L+ +GR H    AI  I  AR + F  MS DLI+ LPKQT+  +E  L+ A+   + 
Sbjct: 126 NDLLKAIGRKHTKETAIRTIENARQVGFENMSIDLIFRLPKQTIADFEESLKMAMDLDLP 185

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           H S+Y L +E+ T+FY + + G L LP+++   D++ L        G H YEISN+S  G
Sbjct: 186 HYSIYSLILEQKTVFYNLMRQGKLPLPTQDEEADMFELAMKTMKDFGRHHYEISNYSIPG 245

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
            ES HNL+YW+  +Y   G GAH  V    ++    I+ + E   +        +  +  
Sbjct: 246 YESRHNLHYWKADEYFAFGAGAHGYVNGVRYQNNGPIQHYLEPLRE----GKLPIFSETQ 301

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSRLR 377
           LS +Q  +EF+ +GLR   G+S K++    G ++D    E  + L  +G +       + 
Sbjct: 302 LSKKQLIEEFMFLGLRKFSGVSKKEFMERFGNSMDEIYREVIQELIEEGLLTTTSDGYV- 360

Query: 378 CTQRGMTMLDSVIANLAV 395
            T RG  + ++V  +  +
Sbjct: 361 LTHRGKFLGNNVFQSFLI 378


>gi|116054116|ref|YP_788559.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115589337|gb|ABJ15352.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 384

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 124/381 (32%), Positives = 204/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGTELPEEAYVDALLADLEQDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++  AHG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDAHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++     + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDDLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RLR ++RG   L+ ++ +  
Sbjct: 363 QRLRPSERGQLFLNDLLQHFL 383


>gi|300703569|ref|YP_003745171.1| coproporphyrinogen dehydrogenase [Ralstonia solanacearum CFBP2957]
 gi|299071232|emb|CBJ42550.1| Coproporphyrinogen dehydrogenase [Ralstonia solanacearum CFBP2957]
          Length = 425

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 135/386 (34%), Positives = 211/386 (54%), Gaps = 11/386 (2%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRY-KVGQENFIQSFLTEMQWMRQLTGPRSISS 73
            S  L +YVH P+CV+KCPYCDFNSH      + +  F+ +   +++    +   R + +
Sbjct: 41  ASPPLSLYVHVPWCVRKCPYCDFNSHAEPDQGIPEARFLAAVRQDLEAALPMVWGRRVHT 100

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           IF GGGTPSL+  Q +  +L  I     V ++ EIT+EANP + E   F+ YR +GVNR+
Sbjct: 101 IFIGGGTPSLLSAQGLDTLLSDIRMLLPVDADAEITMEANPGTFEAERFRSYRASGVNRL 160

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+G+QS  +  LR LGR H+A+EA AAI +AR  F  ++ DL++ALP QT+ + E +++ 
Sbjct: 161 SIGIQSFNDAHLRALGRIHSAAEARAAIDIARAHFDNINLDLMFALPGQTLAECEADVEA 220

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS+   H+SLY LT+E  T F K        LP ++ A  + +   +  +A G   YE+
Sbjct: 221 ALSFETSHVSLYHLTLEPNTYFAKYPPA----LPDDDTAFGMQDWIHARLAAAGYEHYEV 276

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKM--VRKN 311
           S ++  G    HNLNYW++GDY+GIGPGAH ++      +     +HPE++L+       
Sbjct: 277 SAYARPGKRCKHNLNYWQFGDYLGIGPGAHGKLSFPHRVLREMRHRHPETYLRQAETASG 336

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              V E+  + +     EF++  LRL  G  V  ++   G  L          +++G + 
Sbjct: 337 AAVVQEQREVDAADLPFEFMLNALRLTGGFPVTLFQERTGLPLRAIERELDAAEQRGLLA 396

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLAV 395
           R     +R T+ G   L+  +  L +
Sbjct: 397 R-DHVAIRPTELGQRFLND-LQALFL 420


>gi|290476324|ref|YP_003469228.1| putative oxidase [Xenorhabdus bovienii SS-2004]
 gi|289175661|emb|CBJ82464.1| putative oxidase [Xenorhabdus bovienii SS-2004]
          Length = 376

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 133/382 (34%), Positives = 206/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L +++    +   R +S+IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLRADLPMIEDREVSTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+  +  +SS  EIT+EANP +VE   F  Y+KAGVNRIS+G
Sbjct: 65  GGGTPSLLSAEGMQRLLDGVRASLPLSSQAEITMEANPGTVEAGRFSAYQKAGVNRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H   EA  A HLA ++  R  + DL++ LP QT+ +   +L++A+
Sbjct: 125 VQSFGSDKLIRLGRIHGPDEAKRAAHLAADLGLRSFNLDLMHGLPNQTLNEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             +  HLS YQLTIE  T F         VLP ++   D+++    + +A G   YE S 
Sbjct: 185 ELSPPHLSWYQLTIEPNTSFGSRPP----VLPDDDALWDIFSQGHQLLTAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  ++    ++        G  +
Sbjct: 241 YAKAGYQCQHNLNYWRFGDYLGIGCGAHGKISFEDGRILRTV----KTKHPRGYMQGRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
            ++  L +E +  EF M   RL E +   D+    G               +G+I     
Sbjct: 297 DQQNQLDNEDRPFEFFMNRFRLLEAMPRHDFSDFTGLPESAIRPQLDEALAKGYITE-NA 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +  + T+ G   L+S++  L +
Sbjct: 356 THWQITKHGKLFLNSLL-ELFL 376


>gi|254237379|ref|ZP_04930702.1| hypothetical protein PACG_03453 [Pseudomonas aeruginosa C3719]
 gi|126169310|gb|EAZ54821.1| hypothetical protein PACG_03453 [Pseudomonas aeruginosa C3719]
          Length = 384

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 125/381 (32%), Positives = 205/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGTELPEEAYVDALLADLEQDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++  AHG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDAHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RLR ++RG   L+ ++ +  
Sbjct: 363 QRLRPSERGQLFLNDLLQHFL 383


>gi|212636428|ref|YP_002312953.1| Oxygen-independent coproporphyrinogen III oxidase [Shewanella
           piezotolerans WP3]
 gi|212557912|gb|ACJ30366.1| Oxygen-independent coproporphyrinogen III oxidase [Shewanella
           piezotolerans WP3]
          Length = 378

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 199/383 (51%), Gaps = 14/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q  ++ + + +++        R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQHGELPQTEYVDALIADLKQDLHYVQGRQLHTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  +L  + K      N+EIT+EANP ++E ++F+ Y++AGV R+S+G
Sbjct: 65  GGGTPSLFDAAQIKRLLTEVDKLIKFKDNIEITMEANPGTLEHDDFEAYQRAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H+ +EA  A   A+       + DL++ LP Q+  +   +++ A 
Sbjct: 125 VQSFSSDKLNLLGRIHDKTEAQVAAKKAKTSGYNSFNLDLMHGLPNQSFDEALADIETAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLTIE  TLF+         LP +     +Y   Q   +  G   YEIS 
Sbjct: 185 ELAPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEKLWRIYEQGQKRLAELGYVQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV--GSHRVAISIEKHPESWLKMVRKNGH 313
           +S  G +  HNLNYW++GDY+GIG GAH ++     +  +     KHP+ +L        
Sbjct: 241 YSKEGFQCQHNLNYWQFGDYLGIGCGAHGKITQLKHNKILRTVKIKHPKGYLAAS----D 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              +   +  E +  E+LM  LRL   I  +++E   G  R++  +       +G + + 
Sbjct: 297 YTSDTTIVEEEDRPLEYLMNRLRLMTPIPKEEFEQRTGLERSVISQGIEQACAKGLMTQS 356

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
           Q    + T RG   ++ +++   
Sbjct: 357 Q-EHWQLTPRGHMFVNDLLSQFL 378


>gi|120612224|ref|YP_971902.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Acidovorax citrulli AAC00-1]
 gi|120590688|gb|ABM34128.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Acidovorax citrulli AAC00-1]
          Length = 390

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 136/384 (35%), Positives = 216/384 (56%), Gaps = 12/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG---QENFIQSFLTEMQWMRQLTGPRSISS 73
             L +YVH P+C+KKCPYCDFNSH  R   G   ++ ++ + + +++    L   R++ S
Sbjct: 12  PPLSLYVHLPWCLKKCPYCDFNSHEARGGAGALQEQRYLDALMADLEAALPLVWGRTVHS 71

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL  PQ I  ++ G+     + ++ EIT+EANP + E + F+ YR AGV R+
Sbjct: 72  VFIGGGTPSLFSPQAIDQLIGGVRARLRLEADAEITLEANPGTFEKDRFRAYRAAGVTRL 131

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQR 193
           S+GVQS +++ L+ LGR H+ ++A+AA+  A   F   + D++YALP Q++   E ++  
Sbjct: 132 SVGVQSFDDRFLQALGRVHDRAQALAAVQEAAQAFDTFNLDIMYALPGQSLEDLERDVAL 191

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           ALS    HLS+Y LTIE  T F +       V+P +++A  + +   ++T A GL  YEI
Sbjct: 192 ALSLQPPHLSIYHLTIEPNTYFARFPP----VVPEDDLAYAMLDRITAMTEAAGLRRYEI 247

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           S +S  G + +HN NYW++GDY+GIG GAH ++      V     + P+ +++       
Sbjct: 248 SAYSRPGHQCVHNTNYWQFGDYLGIGAGAHGKLSFAHRVVRQVRFRDPQRYMEQALAGNA 307

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERNLQRQGFIERV 371
              + E +       EF++  LRLREG +++D+    G  L           R+G I R 
Sbjct: 308 VAQDHE-VRRADLPFEFMLNALRLREGFALQDFMDRTGLPLSAIAGALDEAGRKGLIVR- 365

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
             +R+R T+RG   L   +  L +
Sbjct: 366 DAARVRPTERGFDFLSD-LQELFL 388


>gi|327440964|dbj|BAK17329.1| coproporphyrinogen III oxidase [Solibacillus silvestris StLB046]
          Length = 381

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 123/382 (32%), Positives = 203/382 (53%), Gaps = 12/382 (3%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR--SISSIFFG 77
           GVY+H PFC + C YCDFN    + +   + +I++   EM+           +I +IF G
Sbjct: 4   GVYIHIPFCHQICNYCDFNKVFFKNQ-PVDEYIEALGREMEMTVAQMPEAFTNIETIFLG 62

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTP+ +  Q I  +L  I K+  +SS  E + EANP  + ++  Q     GVNR+S+GV
Sbjct: 63  GGTPTALSAQQIEKLLGLITKHIPMSSVKEFSSEANPDELTIDKLQALYNGGVNRLSMGV 122

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++  L  +GR H+       I  A+N+ F  +S DL+Y LP QTM QW+  L++AL+
Sbjct: 123 QSFDQSLLEKIGRTHSNEHVYETIQNAKNVGFENISIDLMYGLPGQTMEQWQETLEKALA 182

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             + H S Y L +E  T+FY  +  G L LP+E++  D+Y++      AHGL  YEISN 
Sbjct: 183 LKLPHYSAYSLIVEPKTIFYIQYAKGKLHLPTEDLETDMYSVLMDTMEAHGLKQYEISNF 242

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G ES HN  YW   +Y G G GAH  ++   +          + +++ V      ++
Sbjct: 243 ANEGYESTHNKIYWDNDEYAGFGAGAHGYLEGIRYSN----VAPIKKYIETVMAGERPLL 298

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERVQF 373
            +  ++++++ +E + +GLR   G++ +++E   G    ++  E    LQ++  IE +  
Sbjct: 299 HEHEVTADEKLEEQMFLGLRKSAGVTHEEFETKFGQPMLSIYKEIIDQLQQEQLIE-LDS 357

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
             +R T++G  + + V     V
Sbjct: 358 EGIRLTRKGRFIGNEVFQRFLV 379


>gi|296133947|ref|YP_003641194.1| oxygen-independent coproporphyrinogen III oxidase [Thermincola sp.
           JR]
 gi|296032525|gb|ADG83293.1| oxygen-independent coproporphyrinogen III oxidase [Thermincola
           potens JR]
          Length = 378

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 121/383 (31%), Positives = 197/383 (51%), Gaps = 12/383 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR--SISSIF 75
           ++G+Y+H PFCVKKC YCDF S+     +    ++ + L E++   Q    +   ++S++
Sbjct: 2   AIGLYIHVPFCVKKCNYCDFISYPYDAGLTAS-YVSALLKEIELYGQQLSGKDKELASVY 60

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +   +   +      E+T+EANP +++      ++  G NR+S+
Sbjct: 61  IGGGTPSLLSVPQLEAVFGNLGSFFDYVPGAEVTVEANPGTLDREKLNNWKAFGCNRLSI 120

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRA 194
           G+QS+ +  LRFLGR H A EA  A +LAR   F  ++ DLI+ +P Q M  W   L+R 
Sbjct: 121 GIQSMNDSLLRFLGRIHRADEAAHAFYLAREAGFDNINIDLIFGIPGQGMHDWSDTLRRV 180

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L    +H+S Y L IE+GT   ++  +G L    E++ V++Y  T     A G   YEIS
Sbjct: 181 LELGPEHISAYGLKIEEGTPLARLQAEGQLPPGDEDLEVEMYFHTIDTLRAAGYEHYEIS 240

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N    G  S HNL YW   +Y+G+GP AHS +         S       +   +      
Sbjct: 241 NFCRPGKASAHNLRYWANKEYLGLGPAAHSYLHGER----FSNRPGLNEYCTALNDGLLP 296

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERV 371
           V E+  +    +  E + +GLRL  G+++KD+    G++++         L+R G +E+ 
Sbjct: 297 VAERNPVDRHGEISETIFLGLRLINGLNLKDFRQRFGQSIEELFPAALDKLERLGLVEKR 356

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
               LR T++G+ + + V A   
Sbjct: 357 DV-FLRLTRKGLPLANEVFAEFV 378


>gi|237654672|ref|YP_002890986.1| coproporphyrinogen III oxidase [Thauera sp. MZ1T]
 gi|237625919|gb|ACR02609.1| oxygen-independent coproporphyrinogen III oxidase [Thauera sp.
           MZ1T]
          Length = 407

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 131/384 (34%), Positives = 201/384 (52%), Gaps = 9/384 (2%)

Query: 14  QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK-VGQENFIQSFLTEMQWMRQLTGPRSIS 72
           +    L +YVH+P+CVKKCPYCDFNSH  R   + ++ ++ + L ++Q        R + 
Sbjct: 28  EAPPPLSLYVHFPWCVKKCPYCDFNSHAPREGGIPEQAWLGAVLADLQHALPQVWGRRVH 87

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           S+F GGGTPSL+    +  +L GI     +    EIT+EANP +VE   F+ YR AGVNR
Sbjct: 88  SVFIGGGTPSLMSATTLDGLLTGIRMLLPLDPLAEITLEANPGTVEAGRFRDYRAAGVNR 147

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           +SLG+QS ++  L  +GR H   EA  AI  AR  F R++ DL+YALP QT+     +L+
Sbjct: 148 LSLGIQSFDDAMLAKIGRIHGGEEARRAIEAARTHFERVNLDLMYALPGQTLDMALADLE 207

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            A+ + V HLS Y LT+E  T F            + ++        ++  +A G   YE
Sbjct: 208 TAIGFGVQHLSCYHLTLEPNTPFAHDPPPLPDDDTAADM----QEAIEARLAAAGFTHYE 263

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG 312
            S  +    +S HNLNYW +GDY+G+GPGAH ++            KHP  +L+   ++ 
Sbjct: 264 TSAFARPHEQSRHNLNYWTFGDYLGLGPGAHGKLSSHEGIRREMRHKHPGRYLEGAARSD 323

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIER 370
                +E +S  +   EF+M  LRL EG+  K +    G  ++   +     + +G ++ 
Sbjct: 324 FIQEARE-VSVAELPFEFMMNALRLTEGVPAKLFAARTGVPIEAITDELARARERGLLDT 382

Query: 371 VQFSRLRCTQRGMTMLDSVIANLA 394
               +LR T +G   L+ ++    
Sbjct: 383 AD-GKLRPTLQGRRFLNELLQGFL 405


>gi|218889127|ref|YP_002437991.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa LESB58]
 gi|218769350|emb|CAW25110.1| probable oxidase [Pseudomonas aeruginosa LESB58]
          Length = 384

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 124/381 (32%), Positives = 204/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYVDALLADLEQDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++   HG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDEHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RLR ++RG   L+ ++ +  
Sbjct: 363 QRLRPSERGQLFLNDLLQHFL 383


>gi|288555675|ref|YP_003427610.1| coproporphyrinogen III oxidase [Bacillus pseudofirmus OF4]
 gi|288546835|gb|ADC50718.1| coproporphyrinogen III oxidase [Bacillus pseudofirmus OF4]
          Length = 381

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 113/377 (29%), Positives = 185/377 (49%), Gaps = 10/377 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN    + +   + +IQ+ L EM        P  + +I+ GGGTP
Sbjct: 6   YIHIPFCEHICHYCDFNKVFLKNQ-PVDEYIQALLHEMHMTINEAKPDQLKTIYVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           + +    +  +   +     +    E T+E NP S E       ++ GVNR+S+GVQS +
Sbjct: 65  TALTAAQLRTLFAEMHSILPMEQIEEFTVEVNPDSSEEEKLAVMKEFGVNRLSIGVQSFD 124

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           +  L  +GR H++     A+  +R   F  +S DL++ LP Q++ Q+   +++A    V+
Sbjct: 125 QSLLDAIGRTHSSDSVHDAVKRSREAGFDNLSLDLMFGLPHQSVEQFIDTIEKAAELGVE 184

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           HLS Y L IE+ T+F+   + G L LP E   V +Y   +  T AHG   YEISN +  G
Sbjct: 185 HLSAYSLKIEEKTVFFNRQRKGKLSLPPEEDEVTMYEELRKRTKAHGFVQYEISNFAKPG 244

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
            ES HNL YW   +Y G G GAH  V    H+    + K+ E+  +         + +  
Sbjct: 245 RESKHNLVYWNNDEYYGFGAGAHGYVNGVRHQNIGPVPKYIEAVNQK----KLPYLNEHK 300

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSRLR 377
           +S  +Q +E + MGLR   G+ + +      ++L+    +  ++L  +G +   +   L+
Sbjct: 301 VSRVEQIEEAMFMGLRKLNGVDLDELSKRYDKDLNKLYHDQIKDLSERGLLV-SEQGMLK 359

Query: 378 CTQRGMTMLDSVIANLA 394
            T  G+ + + V     
Sbjct: 360 LTNEGLLLANEVFEQFL 376


>gi|227518567|ref|ZP_03948616.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis TX0104]
 gi|227553094|ref|ZP_03983143.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis HH22]
 gi|255976024|ref|ZP_05426610.1| coproporphyrinogen III oxidase [Enterococcus faecalis T2]
 gi|256958791|ref|ZP_05562962.1| coproporphyrinogen III oxidase [Enterococcus faecalis DS5]
 gi|257078822|ref|ZP_05573183.1| coproporphyrinogen III oxidase [Enterococcus faecalis JH1]
 gi|257419124|ref|ZP_05596118.1| coproporphyrinogen III oxidase [Enterococcus faecalis T11]
 gi|307271214|ref|ZP_07552497.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX4248]
 gi|307279122|ref|ZP_07560180.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0860]
 gi|307291287|ref|ZP_07571171.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0411]
 gi|312899410|ref|ZP_07758741.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0470]
 gi|227073986|gb|EEI11949.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis TX0104]
 gi|227177780|gb|EEI58752.1| coproporphyrinogen dehydrogenase [Enterococcus faecalis HH22]
 gi|255968896|gb|EET99518.1| coproporphyrinogen III oxidase [Enterococcus faecalis T2]
 gi|256949287|gb|EEU65919.1| coproporphyrinogen III oxidase [Enterococcus faecalis DS5]
 gi|256986852|gb|EEU74154.1| coproporphyrinogen III oxidase [Enterococcus faecalis JH1]
 gi|257160952|gb|EEU90912.1| coproporphyrinogen III oxidase [Enterococcus faecalis T11]
 gi|306497518|gb|EFM67051.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0411]
 gi|306504247|gb|EFM73459.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0860]
 gi|306512712|gb|EFM81361.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX4248]
 gi|311293454|gb|EFQ72010.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0470]
 gi|315030964|gb|EFT42896.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX4000]
 gi|315033700|gb|EFT45632.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0017]
 gi|315036785|gb|EFT48717.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0027]
 gi|315575638|gb|EFU87829.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0309B]
 gi|315579919|gb|EFU92110.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0309A]
          Length = 382

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|268593076|ref|ZP_06127297.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Providencia rettgeri DSM 1131]
 gi|291311345|gb|EFE51798.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Providencia rettgeri DSM 1131]
          Length = 379

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 204/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + ++ Q+ ++   L ++    +L   RS+ +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHTLKGEIPQQEYVAHLLADLDIDAKLVAGRSVKTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  +++  ++DG+ +   +  + E+T+EANP +VE   F GY+ AG+NRIS+G
Sbjct: 65  GGGTPSLLSAESMQALMDGVRQRVDLDPHAEVTMEANPGTVEAGRFAGYQAAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H A EA  A  LA N+  R  + DL++ LP QT  +   +L++A+
Sbjct: 125 VQSFGNDKLITLGRIHGADEAKRAAQLATNLNLRSFNLDLMHGLPAQTQVEGLSDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLTIE  T F         VLP ++   D+Y     + SA G   YE S 
Sbjct: 185 ELAPPHLSWYQLTIEPNTQFGSRPP----VLPDDDTLWDIYTEGHKLLSAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     ++  ++    ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKISFEDGQILRTV----KTKHPRGYMEGRYM 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            +   + +  +  E+ M   RL E +   ++    G               +G+I     
Sbjct: 297 HQSYDVDASDRPFEYFMNRFRLLEAMPRAEFTQYTGLPESTVRAAIDEALAKGYITET-V 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           ++ + T+ G   L+S++  L +
Sbjct: 356 NKWQITEHGKLFLNSLL-ELFL 376


>gi|194367045|ref|YP_002029655.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia
           R551-3]
 gi|194349849|gb|ACF52972.1| oxygen-independent coproporphyrinogen III oxidase [Stenotrophomonas
           maltophilia R551-3]
          Length = 408

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 218/384 (56%), Gaps = 11/384 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH  + ++  + +I + L ++     L   R + S+FF
Sbjct: 29  PPLSLYVHLPWCVRKCPYCDFNSHQAKGELPFDAYIDALLRDLDQDLPLVWGRVVHSVFF 88

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P+ I   L   +     + N EIT+E NP + E   F  YR AGVNR+S G
Sbjct: 89  GGGTPSLFPPEAIDRFLQQASARLRFAPNAEITLETNPGTAEHGRFDRYRAAGVNRLSFG 148

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS ++  L+ LGR H++ EA  A+ +A++  +   + DL+YALP+QT+   E +L+RA 
Sbjct: 149 IQSFDDAMLKRLGRIHDSGEAERAVKMAQDAGYDNFNIDLMYALPEQTLAGAEADLERAF 208

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    H+S YQLT+E  T+F+     G   +P E+ A D+    Q++ +  G   YE+S 
Sbjct: 209 ALQPAHISHYQLTLEPNTVFFARPPQG---IPDEDNAWDMQEHCQALLAQAGFGQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG--SHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +S HNLNYWR+GDY+GIG GAH ++  G   H +     KHP+++L        
Sbjct: 266 YARPGRQSAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKLKHPQAYLDSAGTPAS 325

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERV 371
              + E ++ E+   E+++  LRL EG  ++D+E   G  R++         ++G+++  
Sbjct: 326 FGGD-EVIAPERLPFEYMLNLLRLHEGFGLRDFESRTGLPRSVLDAPLAEAVQRGWLDVT 384

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               ++ T+ G    + V++ L +
Sbjct: 385 D-GHVQPTELGRRFTNDVVS-LFL 406


>gi|33597533|ref|NP_885176.1| coproporphyrinogen III oxidase [Bordetella parapertussis 12822]
 gi|33601931|ref|NP_889491.1| coproporphyrinogen III oxidase [Bordetella bronchiseptica RB50]
 gi|33573961|emb|CAE38279.1| putative porphyrin oxidoreductase [Bordetella parapertussis]
 gi|33576369|emb|CAE33447.1| putative porphyrin oxidoreductase [Bordetella bronchiseptica RB50]
          Length = 406

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 214/382 (56%), Gaps = 9/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L VYVH P+CV+KCPYCDFNSH    ++ +  ++ +   +++        R + S+F 
Sbjct: 31  PPLSVYVHVPWCVRKCPYCDFNSHAAPGEIPERAYLDALRADLEQAVPEVWGRQVISVFI 90

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     +  + EIT+EANP + E   F+ Y  +GV R+SLG
Sbjct: 91  GGGTPSLLSAAGLDELLAMLRACLNLLPDAEITMEANPGTAEAGRFRDYAASGVTRLSLG 150

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS ++  L  LGR H+A++A AAI +A+    R++ DL++ALP Q + Q   +L++AL+
Sbjct: 151 IQSFDDAQLSRLGRIHDAAQARAAIAMAQQAVERVNLDLMFALPGQELEQCRADLRQALA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLY LT+E  T+F K   +    LP ++ +  + ++ +   +  GL  YE+S +
Sbjct: 211 FGTEHLSLYHLTLEPNTVFAKYPPE----LPDDDASAAMQDMVEETLAQAGLARYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAV 315
           +  GA   HNLNYW +GDY+G+GPGAH ++         +  ++P+SW++     +G  V
Sbjct: 267 ARRGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRIERQARLRNPDSWMQRAMARDGSHV 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E   + + +   EF++  LRL+EG++   +    G +L           R+G ++    
Sbjct: 327 AESRVVGAGELPFEFMLNALRLKEGVAASSFGERTGLSLAAIAHQLEAATRRGLLD-ADP 385

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RLR T  G   L+  +  + +
Sbjct: 386 TRLRATALGWRFLND-LQEMFL 406


>gi|28872166|ref|NP_794785.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|28855420|gb|AAO58480.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 404

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 202/382 (52%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSANALGRLLRGVEQRIRFASDIEITLEANPGTSEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +   L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQASKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +  G   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATQGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIIR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G +     
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHE-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 ARLIATPQGQLFLNDLLQYFLI 404


>gi|315169986|gb|EFU14003.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX1342]
          Length = 382

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 191/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A +       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAEDVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|229081579|ref|ZP_04214076.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus Rock4-2]
 gi|229180594|ref|ZP_04307936.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus 172560W]
 gi|229192528|ref|ZP_04319490.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus ATCC 10876]
 gi|228590952|gb|EEK48809.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus ATCC 10876]
 gi|228603018|gb|EEK60497.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus 172560W]
 gi|228701735|gb|EEL54224.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus Rock4-2]
          Length = 379

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 114/379 (30%), Positives = 181/379 (47%), Gaps = 11/379 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN      +   + ++     E+    Q     SI +IF GGGTP
Sbjct: 6   YIHIPFCQHICHYCDFNKVFIERQ-PVDQYLDYLEKEIINTVQKVPFDSIKTIFVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKN-WTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +  +    +L+ I ++    + N E+T EANP  +         + GVNRIS GVQ+ 
Sbjct: 65  TALNMEQTKKLLEIINRHLRPFAPNCELTFEANPGDLPKEKLNVLLEGGVNRISFGVQTF 124

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            ++ L  +GR H   +A  AI  A+ +    ++ D+IYALP QT+   +  L  A +  V
Sbjct: 125 RDELLEKIGRKHTREDAFLAIREAQEVGFKNINVDIIYALPGQTIEDVKETLDIAFTLGV 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H S Y L +E  T+FY +   G L LP E+    +Y +       HG + YEISN S  
Sbjct: 185 QHFSAYSLIVEPKTVFYNLMNKGKLRLPGEDHEAKMYEIVMDEMEKHGYNQYEISNFSKG 244

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             +S HNL YW   +Y G G GAHS V        I      + +   + + G   ++  
Sbjct: 245 DNKSRHNLTYWNNEEYYGFGAGAHSYVNGER----IQNVGPLKQYFNKIDETGFPYLDVH 300

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSRL 376
            ++ +++ +E L +GLR  +G+S   +       +D    + L   Q QG +E  +   +
Sbjct: 301 KVTEKERMEEELFLGLRKTKGVSKTAFRNKFNVEMDQVFAKQLQSNQEQGLLEE-EDGHV 359

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T++G  + + V  +  +
Sbjct: 360 RLTRKGKLLGNEVFQSFLI 378


>gi|50955096|ref|YP_062384.1| coproporphyrinogen III oxidase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951578|gb|AAT89279.1| oxygen-independent coproporphyrinogen III oxidase protein
           [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 413

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 125/397 (31%), Positives = 191/397 (48%), Gaps = 15/397 (3%)

Query: 8   ENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRR--YKVGQENFIQSFLTEMQWMRQL 65
           +N   G      GVY+H PFC  +C YCDFN++       V Q ++    + E+++  + 
Sbjct: 19  DNAGGGSADRDFGVYLHVPFCRVRCGYCDFNTYTATEVRGVSQTDYADHAVAEVRFAARA 78

Query: 66  TG-----PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
            G      R +S++FFGGGTP+L+ P+ +  +L  + + W      E+T EANP SV+  
Sbjct: 79  LGRSGLPARPVSTVFFGGGTPTLLPPEALGRMLGAVREQWGFVPQAEVTTEANPDSVDAA 138

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
           +      AG  R+S G+QS   + L  L R H+       +  AR+   ++S DLIY  P
Sbjct: 139 DLLRLAAAGFTRVSFGMQSAVPRVLATLERTHDPERIPLVVQWARDAGLQVSLDLIYGTP 198

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            +T+  WE  L  ALS   DHLS Y L +E GT   +    G L  P +++  D+Y    
Sbjct: 199 GETLGDWERSLDTALSCVPDHLSAYSLIVEPGTKLARQIAAGQLPEPDDDLQADMYERAD 258

Query: 241 SITSAHGLHAYEISNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEK 299
           +  +  G   YE+SN +      S HNL YW   D+ GIGPGAHS +      V     K
Sbjct: 259 TRLAGAGYDWYEVSNWAKDDGHRSRHNLAYWLGHDWWGIGPGAHSHIGGDGGGVRWWNVK 318

Query: 300 HPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE 359
           HP ++ + V         +E L +E Q  E +++ +R+REGI+  + E   GR       
Sbjct: 319 HPAAYAQRVLAGQSPAAGRETLGAETQRVERVLLRMRIREGIASAELEP-TGR----RAV 373

Query: 360 RNLQRQGFIERVQ--FSRLRCTQRGMTMLDSVIANLA 394
             L   G ++        +  + RG  + D+V+  L 
Sbjct: 374 AGLIADGLVDAKAALAGTVTLSLRGRLLADAVVRRLL 410


>gi|312862665|ref|ZP_07722905.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus vestibularis F0396]
 gi|311101525|gb|EFQ59728.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus vestibularis F0396]
          Length = 378

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 207/384 (53%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++ + + E +    L   + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLSALIREWE----LLNIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSNLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I   ++     +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESIDSLKSAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++         G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKKGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +  + LQ  G + + 
Sbjct: 294 RLHEEHLTKAEMMEEEFFLGLRKKSGVSIKRFEEKFGLSFADTYGDIVKKLQEDGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|289209632|ref|YP_003461698.1| oxygen-independent coproporphyrinogen III oxidase [Thioalkalivibrio
           sp. K90mix]
 gi|288945263|gb|ADC72962.1| oxygen-independent coproporphyrinogen III oxidase [Thioalkalivibrio
           sp. K90mix]
          Length = 400

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/380 (33%), Positives = 203/380 (53%), Gaps = 11/380 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +YVH P+CV+KCPYCDFNSH  R +V  + ++++ + +++        R + S+F G
Sbjct: 9   PLALYVHLPWCVRKCPYCDFNSHEPRGEVPFDAYVEALMRDLESQLPDVWGRRVDSVFIG 68

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL  P+ +A +L G+     +  + EIT+EANP + +   F GYR+AGVNR+SLG+
Sbjct: 69  GGTPSLFPPEALADLLSGLRARLPLRPDAEITLEANPGTADRAYFHGYREAGVNRLSLGI 128

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS ++  L  LGR H  +EA AA+  AR   F  ++ DL++ LP+Q++     +L+ A+ 
Sbjct: 129 QSFDDVMLERLGRIHGGAEAHAAVEHARAAGFDNINLDLMFGLPQQSVEAGLADLRAAIE 188

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              +H+S YQLT+E  T F         VLP ++   +L+   Q   +A G   YE+S +
Sbjct: 189 QEPEHISWYQLTLEPNTYFAARPP----VLPPDSTIEELFTQGQCALAAAGYTRYEVSAY 244

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G E  HN NYW +GDY+GIG GAH ++ + S    +      +              
Sbjct: 245 ATRGRECRHNRNYWTFGDYLGIGAGAHGKLTLPSQGRVLRRT---KPRQPAAYLETPDQH 301

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQFS 374
             + +   +   EF++  LRL EG+    +E   G +L         L+ +G +      
Sbjct: 302 RDQAVPEAELPFEFMLNALRLVEGVPAHCFEERCGLDLTTLEPALGELRAEGLLV-SDPQ 360

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RL+ T+RG+  L+ ++    
Sbjct: 361 RLQPTERGLAFLNDILERFL 380


>gi|228954603|ref|ZP_04116627.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228805049|gb|EEM51644.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 379

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 114/379 (30%), Positives = 181/379 (47%), Gaps = 11/379 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN      +   + ++     E+    Q     SI +IF GGGTP
Sbjct: 6   YIHIPFCQHICHYCDFNKVFIERQ-PVDQYLDYLEKEIINTVQKIPFDSIKTIFVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKN-WTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +  +    +L+ I ++    + N E+T EANP  +         + GVNRIS GVQ+ 
Sbjct: 65  TALNMEQTKKLLEIINRHLRPFAPNCELTFEANPGDLPKEKLNVLLEGGVNRISFGVQTF 124

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            ++ L  +GR H   +A  AI  A+ +    ++ D+IYALP QT+   +  L  A +  V
Sbjct: 125 RDELLEKIGRKHTREDAFLAIREAQEVGFKNINVDIIYALPGQTIEDVKETLDIAFTLGV 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H S Y L +E  T+FY +   G L LP E+    +Y +       HG + YEISN S  
Sbjct: 185 QHFSAYSLIVEPKTVFYNLMNKGKLRLPGEDHEAKMYEIVMDEMEKHGYNQYEISNFSKG 244

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             +S HNL YW   +Y G G GAHS V        I      + +   + + G   ++  
Sbjct: 245 DNKSRHNLTYWNNEEYYGFGAGAHSYVNGER----IQNVGPLKQYFNKIDETGFPYLDVH 300

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSRL 376
            ++ +++ +E L +GLR  +G+S   +       +D    + L   Q QG +E  +   +
Sbjct: 301 KVTEKERMEEELFLGLRKTKGVSKTAFRNKFNIEMDQVFAKQLQSNQEQGLLEE-EDGHV 359

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T++G  + + V  +  +
Sbjct: 360 RLTRKGKLLGNEVFQSFLI 378


>gi|257085436|ref|ZP_05579797.1| coproporphyrinogen III oxidase [Enterococcus faecalis Fly1]
 gi|256993466|gb|EEU80768.1| coproporphyrinogen III oxidase [Enterococcus faecalis Fly1]
          Length = 382

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 191/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQKMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q     GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMNNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|15640482|ref|NP_230109.1| coproporphyrinogen III oxidase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|153823174|ref|ZP_01975841.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae B33]
 gi|229509071|ref|ZP_04398559.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae B33]
 gi|229519739|ref|ZP_04409182.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae RC9]
 gi|229606251|ref|YP_002876899.1| coproporphyrinogen III oxidase [Vibrio cholerae MJ-1236]
 gi|254850686|ref|ZP_05240036.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
 gi|9654880|gb|AAF93628.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|126519300|gb|EAZ76523.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae B33]
 gi|229344428|gb|EEO09403.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae RC9]
 gi|229353996|gb|EEO18930.1| similar to coproporphyrinogen III oxidase oxygen-independent
           [Vibrio cholerae B33]
 gi|229368906|gb|ACQ59329.1| coproporphyrinogen III oxidase oxygen-independent-like radical SAM
           family enzyme [Vibrio cholerae MJ-1236]
 gi|254846391|gb|EET24805.1| coproporphyrinogen III oxidase [Vibrio cholerae MO10]
          Length = 391

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 142/387 (36%), Positives = 208/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
            SL +Y+H P+CV+KCPYCDFNSH ++ ++ ++ ++ + L     +++  +    PR + 
Sbjct: 5   PSLSLYIHIPWCVQKCPYCDFNSHAQKGEIPEQEYLDALLQDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSE-DDQHWQITEKGKLFLNDLLEAFM 386


>gi|229519841|ref|ZP_04409275.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae TM 11079-80]
 gi|229343129|gb|EEO08113.1| radical SAM family enzyme similar to coproporphyrinogen III oxidase
           oxygen-independent [Vibrio cholerae TM 11079-80]
          Length = 391

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 142/388 (36%), Positives = 208/388 (53%), Gaps = 14/388 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSI 71
           S  L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR +
Sbjct: 4   SPPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLL 63

Query: 72  SSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN 131
            SIF GGGTPSLI  + IA +L G+A+       +EIT+EANP ++E   F GYR AGV 
Sbjct: 64  HSIFIGGGTPSLISAEGIARLLQGVAERIAFKPEIEITMEANPGTIEAQRFAGYRTAGVT 123

Query: 132 RISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEME 190
           RIS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +
Sbjct: 124 RISIGVQSFEPEKLARLGRIHGQQEAVRAAQLAHKISLNSFNLDLMHGLPDQTPEQALAD 183

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   
Sbjct: 184 LDQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQ 239

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVR 309
           YEIS +S  G +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  + 
Sbjct: 240 YEISGYSKPGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALN 299

Query: 310 KNGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQG 366
               A ++ E L + + +  EF M   RL E     D+ +  G  +D+          +G
Sbjct: 300 NLAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTVTTGLTIDVIRPTLDWALNEG 359

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
           ++        + T++G   L+ ++    
Sbjct: 360 YLSEDDL-HWQITEKGKLFLNDLLEAFM 386


>gi|91774396|ref|YP_544152.1| coproporphyrinogen III oxidase, anaerobic [Methylobacillus
           flagellatus KT]
 gi|91708383|gb|ABE48311.1| coproporphyrinogen III oxidase, anaerobic [Methylobacillus
           flagellatus KT]
          Length = 384

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 133/381 (34%), Positives = 211/381 (55%), Gaps = 9/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  R ++ +  ++ + + +++        R + SIFF
Sbjct: 10  PPLSLYIHIPWCVRKCPYCDFNSHESRTEIPEAAYVDALIADLEQSVPRIWGRRVHSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P+ I  IL  +     +S + E+T+EANP +V+  +F+GYR AGVNR+SLG
Sbjct: 70  GGGTPSLFSPKAIDRILSNVRALVPLSVDCEVTLEANPGTVDAAHFRGYRAAGVNRLSLG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS +   L+ LGR H+ ++A+AA  LA   F  ++ D++YALP Q +     + QRA S
Sbjct: 130 IQSFDSTYLQKLGRIHDEAQAMAAADLALQTFDSVNLDVMYALPGQHLEHALADAQRACS 189

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS Y LT+E  T F++        LP ++ +  +    + +   HG   YE S  
Sbjct: 190 LQPAHLSFYHLTLEPNTPFHRTPPA----LPDDDTSAAMQEAIEDLLGRHGYEHYETSAF 245

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G +  HN NYW +GDY+GIG GAHS++         S  KHP+ +L+     G+AV 
Sbjct: 246 AQHGKQCRHNRNYWLFGDYLGIGAGAHSKLSFHDRITRESRHKHPKRYLE-HASRGNAVE 304

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQFS 374
            +  ++  +   EF+M  LRL  G +   +E+  G  L+      ++  ++G ++  Q  
Sbjct: 305 HQWQIARHELPFEFMMNALRLTGGFAPALFELRTGLPLESIAHTLQHAVQKGLLDVGQ-E 363

Query: 375 RLRCTQRGMTMLDSVIANLAV 395
           R+  T  G   L+ ++  L +
Sbjct: 364 RIAPTLLGQRFLNELL-QLFL 383


>gi|330941610|gb|EGH44393.1| HemN family oxidoreductase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 404

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 203/382 (53%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDMPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSADALRRLLKGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS EE  L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFEESKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALADLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+         LP +++  D+    Q + + H    YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPPA----LPEDDILWDIQETGQQLLATHSYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIMR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G + +   
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHQ-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 TRLIATPQGQLFLNDLLQYFLI 404


>gi|157374365|ref|YP_001472965.1| coproporphyrinogen dehydrogenase [Shewanella sediminis HAW-EB3]
 gi|157316739|gb|ABV35837.1| Coproporphyrinogen dehydrogenase [Shewanella sediminis HAW-EB3]
          Length = 378

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 121/382 (31%), Positives = 198/382 (51%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH +  ++ Q+ +I + + +++   Q    R + SIF 
Sbjct: 5   PPLSLYVHIPWCVQKCPYCDFNSHGQHGELPQQAYIDALIADLKNDIQYVQGRKLHSIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   IA +L  ++     S  +EI++EANP ++E ++F+ Y +AGV R+S+G
Sbjct: 65  GGGTPSLFDAAQIARLLTQVSLLIPFSEQIEISMEANPGTLEHDDFKAYYQAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H+  EA   A   +   +   + DL++ LP Q+  +   ++  A 
Sbjct: 125 VQSFSSDKLNLLGRIHDKDEAKVAARMASEAGYDSFNLDLMHGLPNQSFDEAMADIDTAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE+ TLF+         LP +     +Y   Q   ++ G   YEIS 
Sbjct: 185 ALNPPHLSWYQLTIEQNTLFHSKPPQ----LPDDEALWKIYEQGQKKLASLGYEQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVK--VGSHRVAISIEKHPESWLKMVRKNGH 313
           ++  G    HN+NYW++GDY+GIG GAH +V     +  +     KHP+ +L       H
Sbjct: 241 YAKPGYRCQHNINYWQFGDYLGIGCGAHGKVTLLESNKIIRTVKIKHPKGYLAA----EH 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERV 371
              +   +  +++A E+LM   RL   I   ++E   G +  +  E     + +  +   
Sbjct: 297 YTFDLTEVPEDERALEYLMNRFRLISPIPKSEFEQRTGLSRTVIEEGIAKAKAKSLLIEN 356

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
           +      T +G   ++ +++  
Sbjct: 357 E-EYWELTSKGQLFVNELLSQF 377


>gi|256618883|ref|ZP_05475729.1| coproporphyrinogen III oxidase [Enterococcus faecalis ATCC 4200]
 gi|256598410|gb|EEU17586.1| coproporphyrinogen III oxidase [Enterococcus faecalis ATCC 4200]
          Length = 382

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 193/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T  +    G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEVMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|33592684|ref|NP_880328.1| coproporphyrinogen III oxidase [Bordetella pertussis Tohama I]
 gi|33572330|emb|CAE41884.1| putative porphyrin oxidoreductase [Bordetella pertussis Tohama I]
 gi|332382099|gb|AEE66946.1| coproporphyrinogen III oxidase [Bordetella pertussis CS]
          Length = 406

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 214/382 (56%), Gaps = 9/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L VYVH P+CV+KCPYCDFNSH    ++ +  ++ +   +++        R + S+F 
Sbjct: 31  PPLSVYVHVPWCVRKCPYCDFNSHAAPGEIPERAYLDALRADLEQAVPEVWGRQVISVFI 90

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     +  + EIT+EANP + E   F+ Y  +GV R+SLG
Sbjct: 91  GGGTPSLLSAAGLDELLAMLRACLNLLPDAEITMEANPGTAEAGRFRDYAASGVTRLSLG 150

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS ++  L  LGR H+A++A AAI +A+    R++ DL++ALP Q + Q   +L++AL+
Sbjct: 151 IQSFDDAQLSRLGRIHDAAQARAAIAMAQQTVERVNLDLMFALPGQELEQCRADLRQALA 210

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +  +HLSLY LT+E  T+F K   +    LP ++ +  + ++ +   +  GL  YE+S +
Sbjct: 211 FGTEHLSLYHLTLEPNTVFAKYPPE----LPDDDASAAMQDMVEETLAQAGLARYEVSAY 266

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHAV 315
           +  GA   HNLNYW +GDY+G+GPGAH ++         +  ++P+SW++     +G  V
Sbjct: 267 ARRGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRIERQARLRNPDSWMQRAMARDGSHV 326

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E   + + +   EF++  LRL+EG++   +    G +L           R+G ++    
Sbjct: 327 AESRVVGAGELPFEFMLNALRLKEGVAAPSFGERTGLSLAAIAHQLEAATRRGLLD-ADP 385

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RLR T  G   L+  +  + +
Sbjct: 386 TRLRATALGWRFLND-LQEMFL 406


>gi|307706871|ref|ZP_07643673.1| oxygen-independent coproporphyrinogen III oxidase [Streptococcus
           mitis SK321]
 gi|307617744|gb|EFN96909.1| oxygen-independent coproporphyrinogen III oxidase [Streptococcus
           mitis SK321]
          Length = 376

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 122/384 (31%), Positives = 205/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E Q        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFQSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L+G+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLNGLTKNLDLSVLEELTIEANPGDLDADKIAVLKNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ + + L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDNKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMEQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 IGLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +  +     G+A
Sbjct: 238 NFSKSGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLSAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR+ D    E  R+L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGRSFDGLYGEIVRDLVQQGLV-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           +  R+R T+RG+ + D+V     +
Sbjct: 352 EGERVRMTKRGLFLGDTVAERFIL 375


>gi|269127462|ref|YP_003300832.1| oxygen-independent coproporphyrinogen III oxidase [Thermomonospora
           curvata DSM 43183]
 gi|268312420|gb|ACY98794.1| oxygen-independent coproporphyrinogen III oxidase [Thermomonospora
           curvata DSM 43183]
          Length = 403

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 126/396 (31%), Positives = 190/396 (47%), Gaps = 22/396 (5%)

Query: 8   ENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQ 64
           E+ + G G+     YVH PFCV +C YCDFN++          ++++  + + E++  R+
Sbjct: 19  ESALDGLGARPFACYVHVPFCVTRCGYCDFNTYTAAELGPGASRDSYADAAIAELRLARR 78

Query: 65  LTG--PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNF 122
           + G     + ++FFGGGTP+L+ P  +  IL  I   + ++   E+T EANP SV+    
Sbjct: 79  VLGQTDLPVRTVFFGGGTPTLLPPGELGRILAAIDAEFGLAPGAEVTTEANPESVDEGYL 138

Query: 123 QGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPK 181
           +  R AG  RIS G+QS     L  L R H        +  AR   F +++ DLIY  P 
Sbjct: 139 EQLRAAGFTRISYGMQSARPHVLAALDRVHTPGRIPQVVRWARKAGFEQVNLDLIYGTPG 198

Query: 182 QTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQS 241
           ++   W   L  AL    DH+S Y L +E+GT      + G+L  P ++   D Y + + 
Sbjct: 199 ESAADWRASLLAALETEPDHISAYALIVEEGTRLAARVRRGELAAPDDDAMADRYLMAEE 258

Query: 242 ITSAHGLHAYEISNHSFLGAESL-HNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
           + SAHGLH YEISN +     +  HNL YW   D+ GIGPGAHS V            KH
Sbjct: 259 LLSAHGLHWYEISNWARGPHAACRHNLLYWTGADWWGIGPGAHSHVGGTR----WWNVKH 314

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           P ++   +         +E L++ ++  E +M+ LRL EG   +  E            R
Sbjct: 315 PAAYAARLAGGRSPAHAREVLTAAERRLERIMLELRLAEGCPAELLE--------DAAVR 366

Query: 361 NLQRQGFIER---VQFSRLRCTQRGMTMLDSVIANL 393
                G +E        R   T RG  + D+V+ +L
Sbjct: 367 RAIADGLVEEEPYFGRGRAVLTLRGRLLADAVVRDL 402


>gi|317403014|gb|EFV83552.1| porphyrin oxidoreductase [Achromobacter xylosoxidans C54]
          Length = 407

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 127/383 (33%), Positives = 215/383 (56%), Gaps = 9/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVR-RYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L VYVH P+CV+KCPYCDFNSH     ++ +  ++ +  ++++        R + S+F
Sbjct: 30  PPLSVYVHVPWCVRKCPYCDFNSHAAPGGEIPERAYLDALRSDLEQALPSIWGRQVVSVF 89

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+    +  +L  +     V  + EIT+EANP + E   F+ Y  +GV R SL
Sbjct: 90  IGGGTPSLLSAAGLDELLAMLRACLNVWPDAEITMEANPGTAEAGRFRDYAASGVTRFSL 149

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           G+QS ++  L+ LGR H++++A AAI +A+   PR++ D+++ALP QT+     +L++A+
Sbjct: 150 GIQSFDDAQLKKLGRIHDSAQARAAIEMAQRAAPRVNLDMMFALPGQTLAACVDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
            +  +HLSLY LT+E  T+F K   +    LP ++ +  + +  ++  +A GL  YE+S 
Sbjct: 210 GFGTEHLSLYHLTMEPNTVFAKFPPED---LPDDDTSAAMQDAVEAELAAAGLARYEVSA 266

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK-NGHA 314
           ++  GA   HNLNYW +GDY+G+GPGAH ++      V  +  + PESWL+     +G  
Sbjct: 267 YARPGARCRHNLNYWEFGDYLGLGPGAHGKLSFHDRIVREARLRSPESWLRAAAARDGSH 326

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
           + E   +  ++   EF++  LRL++G++   +    G +L            +G ++   
Sbjct: 327 LAESRQVGPDELPFEFMLNALRLKDGVAATLFNERTGLSLAAIAHQLEAASAKGLLD-AD 385

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
            +RLR T  G   L+  +  + +
Sbjct: 386 PTRLRATPLGWRFLND-LQEMFL 407


>gi|221065459|ref|ZP_03541564.1| oxygen-independent coproporphyrinogen III oxidase [Comamonas
           testosteroni KF-1]
 gi|220710482|gb|EED65850.1| oxygen-independent coproporphyrinogen III oxidase [Comamonas
           testosteroni KF-1]
          Length = 409

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 127/383 (33%), Positives = 216/383 (56%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH P+C+KKCPYCDFNSH   +   + ++ +I + + +++    L   R++ S+
Sbjct: 34  PPLSLYVHLPWCLKKCPYCDFNSHAWAKGDALPEDRYIDALMADLESALPLIWGRTVHSV 93

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL  P++I  ++ G+     +  + EIT+EANP + E + F+ +R AGVNR+S
Sbjct: 94  FMGGGTPSLFSPESIDKLIAGLRARLRMEPDCEITMEANPGTFEKDRFKAFRAAGVNRLS 153

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQS +++ L+ +GR H+A++A AA+  A + F   + DL+YALP Q++   + ++  A
Sbjct: 154 IGVQSFDDRYLQAVGRVHDAAQAQAAVREAADNFETFNIDLMYALPGQSLADLQRDVDTA 213

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L++A  HLS+Y LTIE  T F K       ++P ++ A ++ +L  + T   G+  YE+S
Sbjct: 214 LAFAPPHLSIYHLTIEPNTYFAKYPP----LVPEDDTAYEMLDLITASTQGAGMQRYEVS 269

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++  G +  HN NYW++GDY+GIG GAHS++      V     + P  ++ M       
Sbjct: 270 AYAKEGHQCFHNSNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRFRDPARYMDMALAGTPL 329

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQ 372
             + E +   +   E+++  LRLR G +++++    G  +          Q +G I R  
Sbjct: 330 AQDNE-VKRAELPFEYMLNALRLRGGFALQEFMERTGLPMSAIAKGLDQAQAKGLITR-D 387

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
             R+  T+RG   L   +  + +
Sbjct: 388 LGRVVPTERGFDFLSD-LQEMFL 409


>gi|255972986|ref|ZP_05423572.1| coproporphyrinogen III oxidase [Enterococcus faecalis T1]
 gi|256762300|ref|ZP_05502880.1| coproporphyrinogen III oxidase [Enterococcus faecalis T3]
 gi|256965300|ref|ZP_05569471.1| coproporphyrinogen III oxidase [Enterococcus faecalis HIP11704]
 gi|257086650|ref|ZP_05581011.1| coproporphyrinogen III oxidase [Enterococcus faecalis D6]
 gi|257415922|ref|ZP_05592916.1| coproporphyrinogen III oxidase [Enterococcus faecalis AR01/DG]
 gi|257422809|ref|ZP_05599799.1| coproporphyrinogen III oxidase [Enterococcus faecalis X98]
 gi|307273405|ref|ZP_07554650.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0855]
 gi|255964004|gb|EET96480.1| coproporphyrinogen III oxidase [Enterococcus faecalis T1]
 gi|256683551|gb|EEU23246.1| coproporphyrinogen III oxidase [Enterococcus faecalis T3]
 gi|256955796|gb|EEU72428.1| coproporphyrinogen III oxidase [Enterococcus faecalis HIP11704]
 gi|256994680|gb|EEU81982.1| coproporphyrinogen III oxidase [Enterococcus faecalis D6]
 gi|257157750|gb|EEU87710.1| coproporphyrinogen III oxidase [Enterococcus faecalis ARO1/DG]
 gi|257164633|gb|EEU94593.1| coproporphyrinogen III oxidase [Enterococcus faecalis X98]
 gi|306509932|gb|EFM78957.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0855]
 gi|315027456|gb|EFT39388.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX2137]
 gi|315150712|gb|EFT94728.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0012]
 gi|315153265|gb|EFT97281.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0031]
 gi|315155957|gb|EFT99973.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0043]
 gi|315157875|gb|EFU01892.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0312]
          Length = 382

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|56963421|ref|YP_175152.1| coproporphyrinogen III oxidase [Bacillus clausii KSM-K16]
 gi|56909664|dbj|BAD64191.1| oxygen-independent coproporphyrinogen oxidase III [Bacillus clausii
           KSM-K16]
          Length = 388

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 120/380 (31%), Positives = 192/380 (50%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +YVH PFC   C YCDFN      +   + +I + + EM+  R       + +I+ GGG
Sbjct: 4   SLYVHIPFCEHICHYCDFNKVFIENQ-PVDAYIDALIEEMKQARARRRDGLVKTIYVGGG 62

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +    +  +   I   + +S+  E T+E NP S + +     ++ GVNR+S+G Q+
Sbjct: 63  TPTALTAIQLERLFSAIESLFDLSALEEWTVEVNPDSADEDKLGVMKRYGVNRLSIGAQT 122

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
             ++ L  +GR H+      A+  AR+  F  +S DL+  LP Q++  +E  + RALS  
Sbjct: 123 FNQKLLADIGRTHSPEGVEQAVRKARSLGFTNLSIDLMLGLPNQSVADFERSVDRALSLD 182

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           V+H+S Y L IEK T+FY  +K G L LP E+  V +Y L +  T+A GL  YEISN   
Sbjct: 183 VEHISAYALKIEKQTVFYNRYKKGQLHLPPEDDDVAMYELLKKKTAAAGLDQYEISNFGK 242

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YWR   Y G G GA        ++           +++ V   G   +  
Sbjct: 243 PGYESKHNLVYWRNEPYAGFGAGASGYENQVRYQN----INPVAKYIEAVWATGEPRLRT 298

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSR 375
             +S  +  +E + +GLR+R GI+  D+    G +++    + +   +R+G +E      
Sbjct: 299 HVVSRAECLEEAVFLGLRIRSGINKADFFARYGLDVESLFAKEIAEGKRKGLLEENDH-V 357

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           +R T+ G+ + +   A L V
Sbjct: 358 IRLTENGLLLGNEAFA-LFV 376


>gi|297571551|ref|YP_003697325.1| oxygen-independent coproporphyrinogen III oxidase [Arcanobacterium
           haemolyticum DSM 20595]
 gi|296931898|gb|ADH92706.1| oxygen-independent coproporphyrinogen III oxidase [Arcanobacterium
           haemolyticum DSM 20595]
          Length = 394

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 119/386 (30%), Positives = 184/386 (47%), Gaps = 20/386 (5%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQLT---GPR 69
           ++  G YVH PFC  +C YCDFN++            ++ +S   E++         G  
Sbjct: 20  TSGFGAYVHIPFCRVRCGYCDFNTYTNTDFGPGAKVSDYQESVAREIELSSHQLIAGGDP 79

Query: 70  SISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG 129
           S++SIFFGGGTP+++    +  IL  + + + V +  EIT EANP SV  +  +  +  G
Sbjct: 80  SLTSIFFGGGTPTMLNATQLVAILRKLRETFGVVNGAEITTEANPESVNRDALETLKNGG 139

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEM 189
             R+S G+QS     L  L R H   +       AR +    S DLIY  P +++  W+ 
Sbjct: 140 FTRVSFGMQSAVSHVLDTLERQHTPGQVREVTRWARQVGLDYSVDLIYGAPGESLDDWQR 199

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
            L  A++    H+S Y LTIE GT   +  + G+L     +     Y + +   +  G  
Sbjct: 200 SLDAAIALEPGHISAYGLTIEPGTAMGRKVRKGELPETDPDEMATKYEMAEVALNEAGYF 259

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+SN +  G ES HNL YWR  ++ G GPGAHS +            KHP ++ K + 
Sbjct: 260 WYEVSNWAKPGKESRHNLAYWRNTNWWGYGPGAHSHINGSR----FWNVKHPGAYAKHLA 315

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIE 369
                  E E L+  ++ +E +M+G+R+ EGI+V         +++      L   G IE
Sbjct: 316 AGMIPAAEIEHLTDAERREEAIMLGVRVAEGIAVP--------DVEPHVVAGLISDGLIE 367

Query: 370 RVQF--SRLRCTQRGMTMLDSVIANL 393
             +    R+  T RG  + D+VI  L
Sbjct: 368 PGEALRGRIVLTLRGRLLADTVIRAL 393


>gi|167623100|ref|YP_001673394.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella halifaxensis HAW-EB4]
 gi|167353122|gb|ABZ75735.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella halifaxensis HAW-EB4]
          Length = 378

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 199/383 (51%), Gaps = 14/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q  ++ + + +++        R++ +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQHGELPQTEYVDALIKDLKQDLHYVQGRALHTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +  +IA +L  +      S N+EIT+EANP ++E ++F+ Y KAG+ R+S+G
Sbjct: 65  GGGTPSLFDAAHIARLLTEVDTLIPFSDNIEITMEANPGTLEHDDFEAYCKAGITRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR HN  EA  A   A+ + +   + DL++ LP Q+  +   +++ A 
Sbjct: 125 VQSFSTDKLNLLGRIHNQDEAQVAAQKAKVSGYQSFNLDLMHGLPNQSFDEALADIETAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLTIE  TL++         LP +     +Y   Q   +  G   YEIS 
Sbjct: 185 ELAPPHLSWYQLTIEPNTLYHSKPPQ----LPDDENLWQIYEQGQKRLAELGYQQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVK--VGSHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HNLNYW++GDY+GIG GAH +V     +  +     KHP+ +L        
Sbjct: 241 YAKEGYQCRHNLNYWQFGDYLGIGCGAHGKVTLLNENKIIRTVKIKHPKGYLAA----DI 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERV 371
              E   ++ E +A E+LM  LRL   I   ++E       D   +  +    +G +   
Sbjct: 297 YTYETTEVAEEDRALEYLMNRLRLMSPIPKLEFEQRTSLPRDTISDGIKQACAKGLMTES 356

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
                + T +G   ++ +++   
Sbjct: 357 D-EHWQLTSKGHLFVNELLSQFL 378


>gi|257082735|ref|ZP_05577096.1| coproporphyrinogen III oxidase [Enterococcus faecalis E1Sol]
 gi|256990765|gb|EEU78067.1| coproporphyrinogen III oxidase [Enterococcus faecalis E1Sol]
          Length = 382

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGKTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|309798492|ref|ZP_07692776.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus infantis SK1302]
 gi|308117884|gb|EFO55276.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus infantis SK1302]
          Length = 376

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 118/384 (30%), Positives = 203/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   E++++  L E          + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVESYLEHLLQEFHSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L+G+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSASQLEVLLEGLTKNLDLSMLEELTIEANPGDLDADKIAVLQNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHTEKDIYENIDRLKLAGFDNISIDLIYALPGQTMDQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           ++  + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 VALDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  + ++  +     G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVDGIRYKNHGPIRHYLKAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E LS  +Q +E + +GLR + G+S+  +E   GR+      +  ++L +QG + ++
Sbjct: 293 RINEEHLSPREQMEEEMFLGLRKKSGVSMARFEEKFGRSFQELYGDIVKDLIQQGLM-QL 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + D+V     +
Sbjct: 352 DGDHVRMTKRGLFLGDTVAERFIL 375


>gi|326389867|ref|ZP_08211431.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325994135|gb|EGD52563.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 375

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 117/381 (30%), Positives = 206/381 (54%), Gaps = 11/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             +G+Y+H PFC +KC YCDFNS+   Y    +++I++ L E++     T   ++ S++ 
Sbjct: 2   REIGLYIHIPFCKRKCYYCDFNSYA-GYDYLFDDYIRALLMEIE--SNSTKDYNVVSVYI 58

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+L+ P  I  IL  + KN+ +    EITIE NP  +     + Y+  G+NR+S+G
Sbjct: 59  GGGTPNLLPPFYIEKILKSVFKNYKILDGCEITIEMNPGLITEEKLKIYKDNGINRVSIG 118

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+ + + L+++GR H   +      L +  F  ++ DL+YALP QT  +W+  L+  + 
Sbjct: 119 LQAFQNRLLKYIGRIHTIEDFFGNYELVKKFFDNINIDLMYALPTQTFKEWQETLKEVVK 178

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y L +E  T FY++++ G L +  E   + +Y+         G H YEISN 
Sbjct: 179 LQPTHVSTYSLILEPNTSFYRLYEKGQLPIVDEEEELKMYHWGIEFLKEKGYHHYEISNF 238

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    E  HN+ YW   +Y+G G GAHS ++   +    +I+ + +S L+        V 
Sbjct: 239 ALPTFECRHNILYWECKNYLGFGAGAHSYMEGVRYSNIENIKDYIKSILERKSA----VK 294

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQF 373
           EK  L+ E +  EF+ +G+R+ +G+  KD++   G +L    ++ +Q+   +G IE +  
Sbjct: 295 EKIKLAKEDRMAEFMFLGMRMTKGVCDKDFKKRFGISLFEFYKKVIQKYLNEGLIE-IDN 353

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             ++ T+RG+ + + +     
Sbjct: 354 ECVKLTERGIDVSNVIFEEFL 374


>gi|206969798|ref|ZP_03230752.1| oxygen-independent coproporphyrinogen III oxidase [Bacillus cereus
           AH1134]
 gi|206735486|gb|EDZ52654.1| oxygen-independent coproporphyrinogen III oxidase [Bacillus cereus
           AH1134]
          Length = 379

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 180/379 (47%), Gaps = 11/379 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN      +   + ++     E+    Q     SI +IF GGGTP
Sbjct: 6   YIHIPFCQHICHYCDFNKVFIERQ-PVDQYLDYLEKEIINTVQKVPFDSIKTIFVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKN-WTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +  +    +L+ I ++    + N E+T EANP  +         + GVNRIS GVQ+ 
Sbjct: 65  TALNMEQTKKLLEIINRHLRPFAPNCELTFEANPGDLPKEKLNVLLEGGVNRISFGVQTF 124

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            ++ L  +GR H   +A  AI  A+ +    ++ D+IYALP QT+   +  L  A +  V
Sbjct: 125 RDELLEKIGRKHTREDAFLAIREAQEVGFKNINVDIIYALPGQTIEDVKETLDIAFTLGV 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H S Y L +E  T+FY +   G L LP E+    +Y +       HG + YEISN S  
Sbjct: 185 QHFSAYSLIVEPKTVFYNLMNKGKLRLPGEDHEAKMYEIVMDEMEKHGYNQYEISNFSKG 244

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             +S HNL YW   +Y G G GAHS V        I      + +   + +     ++  
Sbjct: 245 DNKSRHNLTYWNNEEYYGFGAGAHSYVNGER----IQNVGPLKQYFNKIDETEFPYLDVH 300

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSRL 376
            ++ +++ +E L +GLR  +G+S   +       +D    + L   Q QG +E  +   +
Sbjct: 301 KVTEKERMEEELFLGLRKTKGVSKTAFRNKFNVEMDQVFAKQLQSNQEQGLLEE-EDGHV 359

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T++G  + + V  +  +
Sbjct: 360 RLTRKGKLLGNEVFQSFLI 378


>gi|89091919|ref|ZP_01164874.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
 gi|89083654|gb|EAR62871.1| coproporphyrinogen III oxidase [Oceanospirillum sp. MED92]
          Length = 380

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 139/382 (36%), Positives = 213/382 (55%), Gaps = 11/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+C++KCPYCDFNSH +R ++ ++ +I+  L +++        R+I SIF 
Sbjct: 6   PPLSLYIHVPWCIRKCPYCDFNSHAQRGELPEQAYIECLLEDLRSELHFAQGRTIQSIFI 65

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +  +   +L GI     +  + EIT+EANP + E   F GY+ AG+NR+S+G
Sbjct: 66  GGGTPSLFQADSFKRLLLGINAIIPIERDAEITLEANPGTFEQEKFIGYKDAGINRLSIG 125

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS     L+ LGR H++ EA+ A  LAR IFPR++ DL++ LP Q+ T    +LQ+A+ 
Sbjct: 126 IQSFNNNHLQALGRIHSSDEAVRAATLAREIFPRLNLDLMHGLPSQSETDAIADLQQAID 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              DHLS YQLTIE  T FY         LP +     +    Q + + H L  YEIS +
Sbjct: 186 LDPDHLSWYQLTIEPNTEFYSKSP----SLPVDETLWGIQEQGQQLLADHLLAQYEISAY 241

Query: 257 SF-LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           +     +S HNLNYW +GDYIGIG GAH ++ +        I +  +   K   ++   +
Sbjct: 242 AKGEQFKSRHNLNYWSFGDYIGIGAGAHGKITLPDE--DRIIRRWKQKQPKAYMQSTTRL 299

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGFIERVQF 373
              + ++ E++A EF+M  LRL  G+ V+ +    G  L        N + +G +E+   
Sbjct: 300 TGDQPITREERAFEFMMNALRLYHGVPVELFAERTGLPLTDVSALLDNARGKGLLEK-GT 358

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            RL  TQ G   L+ +++ L +
Sbjct: 359 DRLAPTQHGRLFLNDLLS-LFL 379


>gi|121590701|ref|ZP_01678033.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 2740-80]
 gi|121547432|gb|EAX57541.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           cholerae 2740-80]
          Length = 391

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 143/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGPRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + ++ ++ + L     +++  +    PR + 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQEYLDALLEDLDRDIERYQLKGDPRLLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + IA +L G+AK       +EIT+EANP ++E   F GYR AGV R
Sbjct: 65  SIFIGGGTPSLISAEGIARLLQGVAKRIAFKPEIEITMEANPGTIEAQRFAGYRTAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E + L  LGR H   EA+ A  LA  I     + DL++ LP QT  Q   +L
Sbjct: 125 ISIGVQSFEPEKLARLGRIHGQQEAVRAALLAHQIGLNSFNLDLMHGLPDQTPEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A++    HLS YQLTIE  TLFY         LP E+   D++ L     S  G   Y
Sbjct: 185 DQAIALNPPHLSWYQLTIEPNTLFYSKPPK----LPDEDALWDIFELGHQKLSDAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S LG +  HNLNYWR+GDY+GIG GAH ++     R+   +  KHP  +L  +  
Sbjct: 241 EISGYSKLGYQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKTKHPRGYLAALNN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGF 367
              A ++ E L + + +  EF M   RL E     D+    G  +D+          +G+
Sbjct: 301 LAKAYLDSEQLVADQDKPFEFFMNRFRLIEPCPKADFTATTGLTIDVIRPTLDWALSEGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +        + T++G   L+ ++    
Sbjct: 361 LSEDDL-HWQITEKGKLFLNDLLEAFM 386


>gi|323493574|ref|ZP_08098695.1| HemN family oxidoreductase [Vibrio brasiliensis LMG 20546]
 gi|323312097|gb|EGA65240.1| HemN family oxidoreductase [Vibrio brasiliensis LMG 20546]
          Length = 390

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 137/394 (34%), Positives = 203/394 (51%), Gaps = 14/394 (3%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG--- 67
           M      +L +YVH P+CV+KCPYCDFNSH  +  + ++ +I + L +++   +      
Sbjct: 1   MNTLIPPALSLYVHIPWCVQKCPYCDFNSHALKADIPEQEYIAALLQDLETDIERYQLNN 60

Query: 68  -PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYR 126
            PR + SIF GGGTPSLI  + IA +L GI       S++EIT+EANP ++E   F GY+
Sbjct: 61  SPRPLHSIFIGGGTPSLISAEGIATLLQGIEARIPFKSDIEITMEANPGTIEAERFAGYQ 120

Query: 127 KAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMT 185
           KAGV RIS+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ 
Sbjct: 121 KAGVTRISVGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSVE 180

Query: 186 QWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
           Q   +L +A+     HLS YQLTIE  T+FY         LP ++   D++       + 
Sbjct: 181 QALADLDKAIELDPPHLSWYQLTIEPNTMFYYKQP----TLPDDDDLWDIFEQGHKKLAD 236

Query: 246 HGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL 305
            G   YEIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + +       
Sbjct: 237 AGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGY 296

Query: 306 KMVRKN--GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERN 361
                N     + ++  +    +  EF M   RL E    +D+    G       E    
Sbjct: 297 LAAFDNMVKPYLSDETEVDDTDRPFEFFMNRFRLIEACPKQDFLDTTGLGFTAIQETIDW 356

Query: 362 LQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
              +G+I+    S  + T++G   L+ ++    V
Sbjct: 357 AIEKGYIDESD-SHWQITKKGKLFLNDLLEAFMV 389


>gi|330826507|ref|YP_004389810.1| oxygen-independent coproporphyrinogen III oxidase [Alicycliphilus
           denitrificans K601]
 gi|329311879|gb|AEB86294.1| oxygen-independent coproporphyrinogen III oxidase [Alicycliphilus
           denitrificans K601]
          Length = 410

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 132/383 (34%), Positives = 212/383 (55%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSH--VRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH P+C++KCPYCDFNSH       + +  +  + + +++    L   R++ +I
Sbjct: 33  PPLSLYVHLPWCLRKCPYCDFNSHHAPGGEPLPEARYTAALVADLEAALPLVWGRTVQTI 92

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL  PQ+I  +L  I     + ++ E+T+EANP + E   F+ YR AGV R+S
Sbjct: 93  FIGGGTPSLFAPQSIDRLLSDIRARLRLEADCEVTLEANPGTFEKERFRAYRDAGVTRLS 152

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQS  ++ L+ LGR H+ ++A+AA+  A   F   + D++YALP QT  + E ++++A
Sbjct: 153 IGVQSFNDRHLQALGRVHDRAQALAAVEEAAQAFETFNLDIMYALPGQTPAEQEQDMRQA 212

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L+ A  H+S+Y LTIE  T F K        LP ++ A  + +    +T+A GL  YE+S
Sbjct: 213 LALAPPHISIYHLTIEPNTYFAKYPPR----LPEDDQAYAMLDRITELTAAAGLSRYEVS 268

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++  G + LHN NYW++GDY+GIG GAHS++      V     + P+ ++         
Sbjct: 269 AYAREGHQCLHNRNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRLRDPQLYMAGALSGRAI 328

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQ 372
             + E +       EF++  LRLREG +++D+    G+ L       +  + +G I R  
Sbjct: 329 AQD-EDVRRADLPFEFMLNALRLREGFALQDFTERTGQPLTAIAQGLQQAEARGLIAR-D 386

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
              +R T+RG   L   +  L +
Sbjct: 387 MGHVRPTERGFDFLSD-LQALFL 408


>gi|317122992|ref|YP_004102995.1| oxygen-independent coproporphyrinogen III oxidase [Thermaerobacter
           marianensis DSM 12885]
 gi|315592972|gb|ADU52268.1| oxygen-independent coproporphyrinogen III oxidase [Thermaerobacter
           marianensis DSM 12885]
          Length = 431

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 116/380 (30%), Positives = 202/380 (53%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG-PRSISSIFFGG 78
            +YVH P+C ++C YCDFN+++     G+  ++ +   E+  +    G  R + S++ GG
Sbjct: 54  ALYVHVPYCRQRCYYCDFNTYLL-DPEGKARYLAALQRELALLATDPGLTRPLVSVYVGG 112

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPS++EP  +  +L  + +++ ++ + EIT+E NP +++       R  GV R+SLG+Q
Sbjct: 113 GTPSILEPAELERLLGAVHRHFCLAPDAEITVECNPGTLDEGRLAALRDGGVTRLSLGLQ 172

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           +++++ LR +GR+H  ++  A     R   F  ++ DLI+ LP QT+ QWE  L+  +  
Sbjct: 173 AVQDELLRAMGRDHTWADFCATYRRVRQAGFDNVNIDLIFGLPGQTLDQWEASLRAVVDL 232

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H+S Y L +  GT F++  + G+LVLP E+    +++L      A G   YEISN +
Sbjct: 233 DPEHVSCYGLELHPGTPFHRWWEAGELVLPGEDAERAMFDLAYERLGAAGFVRYEISNFA 292

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES+HN  YW  G Y+G GPGA S  +    R       HP ++   + ++   V  
Sbjct: 293 RPGRESVHNRVYWLNGSYLGAGPGAWSCWRGERRRN----RLHPAAYAAELAEDRLPVDV 348

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
           +E +   +  +E +++GLRL EG+    +    G             L  +G++ R +  
Sbjct: 349 REPVDRRRAMEETMILGLRLAEGVDEARFARRFGLTPAEAFPAAVARLLDEGWLVR-EGG 407

Query: 375 RLRCTQRGMTMLDSVIANLA 394
           RLR +   + + +SV+A   
Sbjct: 408 RLRLSPGAVPVANSVLAYFV 427


>gi|157693050|ref|YP_001487512.1| coproporphyrinogen III oxidase [Bacillus pumilus SAFR-032]
 gi|157681808|gb|ABV62952.1| coproporphyrinogen dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 379

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 113/378 (29%), Positives = 188/378 (49%), Gaps = 11/378 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN    + +   + ++ +   EMQ   +  G + + +IF GGGTP
Sbjct: 5   YIHIPFCEHICHYCDFNKFFIKTQ-PVDEYLAALEKEMQHTIEQKGEQELKTIFIGGGTP 63

Query: 82  SLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +    +  +++ I +      + VE  +EANP  + +      ++AGVNR+S GVQ+ 
Sbjct: 64  TSLTVSQLDQLMNSIHRVLKPSKNLVEFAVEANPDELSLEKLHVLKEAGVNRLSFGVQTF 123

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           E+  L+ +GR H   + + +   AR++ F  +S DL++ LP Q        L+ A S   
Sbjct: 124 EDDLLKKIGRVHQKKDVLTSFERARDVGFDNISLDLMFGLPHQEKHHVMNSLETAFSLGA 183

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           +H S+Y L +E  T+FY + + G L LP +    ++Y L       HGLH YEISN++  
Sbjct: 184 EHYSVYSLIVEPKTVFYNLMQKGKLHLPPQEREAEMYELVMDEMERHGLHQYEISNYAKP 243

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G ES HNL YW   DY G G GAH  V    +  A  ++ + E    ++ + G    E  
Sbjct: 244 GFESQHNLTYWSNEDYFGFGAGAHGYVDGIRNVNAGPVKHYLE----LIEQTGFPHKETH 299

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFSRL 376
            ++  +Q +E + +GLR  EG+    ++   G + +         L+ +G I +     +
Sbjct: 300 QVTKAEQIEEEMFLGLRKIEGVKSAGFQAKYGASPEALFPSVLEELEEKGLIVKDDIG-I 358

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T++G  + + V     
Sbjct: 359 RLTRKGKLLGNEVFQAFL 376


>gi|254243485|ref|ZP_04936807.1| hypothetical protein PA2G_04301 [Pseudomonas aeruginosa 2192]
 gi|126196863|gb|EAZ60926.1| hypothetical protein PA2G_04301 [Pseudomonas aeruginosa 2192]
          Length = 384

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 123/381 (32%), Positives = 203/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYVDALLADLEQDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRMSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++   HG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDEHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             LR ++RG   L+ ++ +  
Sbjct: 363 QHLRPSERGQLFLNDLLQHFL 383


>gi|301631758|ref|XP_002944962.1| PREDICTED: oxygen-independent coproporphyrinogen-III oxidase-like
           protein HI_0463-like [Xenopus (Silurana) tropicalis]
          Length = 398

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 208/382 (54%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             L +YVH P+C++KCPYCDFNSH  +     ++ +I + + +++    L   R++ SIF
Sbjct: 22  PPLSLYVHLPWCLRKCPYCDFNSHAMQAGTLPEQRYIDALVADLEAALPLVWGRTVHSIF 81

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P +I  +L  +     + ++ E T+EANP + E   F+ +R AGV R+S+
Sbjct: 82  IGGGTPSLFSPDSIDRLLSDLRARLRIEADCETTLEANPGTFEKERFRAFRAAGVTRLSI 141

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQS ++  L+ LGR HN ++A+AA+  A   F   + D++YALP Q+M   E +L+ AL
Sbjct: 142 GVQSFDDGHLQALGRVHNRAQALAAVQEAAQAFETFTLDIMYALPGQSMADLERDLETAL 201

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           ++A  HLS+Y LTIE  T F          LP  + A  + +    +T A GL  YE+S 
Sbjct: 202 AFAPPHLSVYHLTIEPNTWF----AKHPPALPEGDEAYAMLDRITEMTGAAGLTRYEVSA 257

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G + +HN NYW++GDY+GIG GAHS++      V     + P  ++        AV
Sbjct: 258 YARKGHQCVHNGNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRYREPRRYMDKALAG-CAV 316

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
            + E +       E+++  LRLR+G +++ +    G  +          +R+G I R   
Sbjct: 317 AQDEDVRRADLPFEYMLNALRLRQGFALQHFCERTGLPVTAIARGLEQAERKGLIVR-DM 375

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
             +R T+RG   L   +  L +
Sbjct: 376 GHVRPTERGFDFLSD-LQTLFL 396


>gi|330873955|gb|EGH08104.1| HemN family oxidoreductase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 404

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 202/382 (52%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSANALGRLLRGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +   L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQASKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +  G   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATQGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIIR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD   E  R  +++G +     
Sbjct: 324 AGAKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAEARRQAEQKGLLHE-DP 382

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +RL  T +G   L+ ++    +
Sbjct: 383 ARLIATPQGQLFLNDLLQYFLI 404


>gi|107099371|ref|ZP_01363289.1| hypothetical protein PaerPA_01000383 [Pseudomonas aeruginosa PACS2]
          Length = 384

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 124/381 (32%), Positives = 203/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYVDALLADLEHDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L +AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLSQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++   HG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDEHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RLR ++RG   L+ ++ +  
Sbjct: 363 QRLRPSERGQLFLNDLLQHFL 383


>gi|299529925|ref|ZP_07043353.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Comamonas testosteroni S44]
 gi|298722097|gb|EFI63026.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Comamonas testosteroni S44]
          Length = 409

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 131/383 (34%), Positives = 216/383 (56%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH P+C+KKCPYCDFNSH   +   + ++ +I + + +++    L   R++ S+
Sbjct: 34  PPLSLYVHLPWCLKKCPYCDFNSHAWAKGDALPEDRYIDALMADLESALPLIWGRTVHSV 93

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL  P++I  ++ G+     +  + EIT+EANP + E + F+ +R AGVNR+S
Sbjct: 94  FMGGGTPSLFSPESIDKLIAGLRARLRMEPDCEITMEANPGTFEKDRFKAFRAAGVNRLS 153

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQS +++ L+ +GR H+A++A AA+  A + F   + DL+YALP Q+M   + ++  A
Sbjct: 154 IGVQSFDDRYLQAVGRVHDAAQAQAAVREAADNFETFNIDLMYALPGQSMVDLQRDVDTA 213

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           LS+A  HLS+Y LTIE  T F K       V+P ++ A ++ +L  + T A G+  YE+S
Sbjct: 214 LSFAPPHLSIYHLTIEPNTYFAKYPP----VVPEDDTAYEMLDLITASTRAAGMQRYEVS 269

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++  G +  HN NYW++GDY+GIG GAHS++      V     + P  ++ M       
Sbjct: 270 AYAKDGHQCFHNSNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRFRDPARYIDMALAGTPL 329

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQ 372
             + E +       E+++  LRLR G +++++    G  +          Q +G I R  
Sbjct: 330 AQDNE-VKRADLPFEYMLNALRLRGGFALQEFMERTGLPMSAIAKGLDQAQAKGLISR-D 387

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
             R+  T+RG   L   +  + +
Sbjct: 388 LGRVVPTERGFDFLSD-LQEMFL 409


>gi|127512064|ref|YP_001093261.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella loihica PV-4]
 gi|126637359|gb|ABO23002.1| coproporphyrinogen III oxidase, anaerobic [Shewanella loihica PV-4]
          Length = 379

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 124/377 (32%), Positives = 198/377 (52%), Gaps = 10/377 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++   L +++        RS+ SIF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQHGELPQQEYVDDLLNDLKNDAAYVQGRSLHSIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  +LDG+      + ++EIT+EANP ++E ++F  Y  AGV R+S+G
Sbjct: 65  GGGTPSLFDASQIERLLDGVRAQIPFAPDIEITMEANPGTLEHDDFSAYCAAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H+  EA   A   A+  +   + DL++ LP Q+  +   ++ +A 
Sbjct: 125 VQSFSSDKLNLLGRIHDKHEAEVAATKAAQAGYQSFNLDLMHGLPNQSFEEAMRDIDKAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEALWQIYEQGQQRLAALGYEQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYW++GDY+GIG GAH ++ +   +         +     +    +  
Sbjct: 241 YAKPGYQCRHNLNYWQFGDYLGIGCGAHGKITMAEDQRIYRTV-KIKHPKGYLGAGDYLF 299

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            + E L +E +A E+LM  LRL   I  +++E   G + +   E       +G +  +Q 
Sbjct: 300 DKSEVL-AEDRALEYLMNRLRLMSPIPKREFESRTGLSAEVLNEGMARGAAKGLV-IIQD 357

Query: 374 SRLRCTQRGMTMLDSVI 390
              + T +G   ++ ++
Sbjct: 358 EHWQLTAKGQMFVNELL 374


>gi|163797075|ref|ZP_02191030.1| putative oxygen-independent coproporphyrinogen III oxidase [alpha
           proteobacterium BAL199]
 gi|159177591|gb|EDP62144.1| putative oxygen-independent coproporphyrinogen III oxidase [alpha
           proteobacterium BAL199]
          Length = 400

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 174/388 (44%), Positives = 238/388 (61%), Gaps = 6/388 (1%)

Query: 11  MTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRS 70
           +T      +GVYVHWPFC  KCPYCDFNSHV    V  + +  + + E++      G R 
Sbjct: 8   LTTTLDEPMGVYVHWPFCRSKCPYCDFNSHVS-DTVDHDRWRTALVRELETQAARVGRRR 66

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           + S+FFGGGTPSL+EP+ +A +LD +  ++ +++++E+T+EANP+SVE     G+R AGV
Sbjct: 67  VESVFFGGGTPSLMEPETVAAVLDTVRSSFRIANDLEVTLEANPTSVEAGRLDGFRDAGV 126

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEME 190
           NR+SLGVQ+L+++ LRFLGR H ASEA+AA+  AR  F R+SFDLIYA P Q+   W+ E
Sbjct: 127 NRVSLGVQALDDEVLRFLGRTHAASEALAAVAAARERFDRVSFDLIYARPGQSPQSWKRE 186

Query: 191 LQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHA 250
           L  AL +A  HLSLYQLTIE  T F+ +H  G   LP E+ A  L+++TQ    A GL A
Sbjct: 187 LSEALKHAAGHLSLYQLTIEPTTPFHSLHARGAFRLPDEDTAATLWDVTQETLDAAGLSA 246

Query: 251 YEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRK 310
           YE+SNH+  G E  HN+ YW Y DY+G+GPGAH R+     + A    + P  WL  V +
Sbjct: 247 YEVSNHARPGDECRHNVVYWTYRDYLGVGPGAHGRLSEAGGKTATRTHRAPSIWLDRVER 306

Query: 311 NGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQG 366
           +GHA+V+ + L  ++   E  + GLRL  G+S + W  L  R      DI     L   G
Sbjct: 307 DGHALVDDQMLDPDEVLVEATLTGLRLASGLSRERWHALFDRPPEDLFDIRTIGLLTDGG 366

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
           F+E  +   LR T  G   LD+V   L 
Sbjct: 367 FLELDEVG-LRATATGRARLDAVTDRLL 393


>gi|15595583|ref|NP_249077.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PAO1]
 gi|9946239|gb|AAG03775.1|AE004476_5 probable oxidase [Pseudomonas aeruginosa PAO1]
          Length = 384

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 123/381 (32%), Positives = 203/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYVDALLADLEQDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++   HG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDEHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             LR ++RG   L+ ++ +  
Sbjct: 363 QHLRPSERGQLFLNDLLQHFL 383


>gi|327395109|dbj|BAK12531.1| oxygen-independent coproporphyrinogen III oxidase- like protein
           YggW [Pantoea ananatis AJ13355]
          Length = 379

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 205/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L +++    L   R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKDEVPHVEYVQHLLRDLEHDLPLIQGREVRTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    + +++DG+ +  T++++ E+T+EANP +VE + F  Y++AG+NRIS+G
Sbjct: 65  GGGTPSLLSSSAMQMLMDGVRERLTLTADAEVTMEANPGTVEADRFSAYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   Q L  LGR H   EA  A  LA+ +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSPQKLERLGRIHGPEEAKRAAALAQGLGLRSFNLDLMHGLPDQSLAEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF          LP ++   D++     + +A G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFGSRPP----TLPDDDALWDIFEQGHQLLTAAGYEQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G    HNLNYWR+GDY+GIG GAH ++     R+  ++    +         G+ +
Sbjct: 241 YAKPGYRCEHNLNYWRFGDYLGIGCGAHGKLTQPDGRIVRTV----KVRHPRGFMKGNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQGFIERVQF 373
            ++  ++ E +  EF M   RL E     D+    G    L           G+I     
Sbjct: 297 DKQYDVADEDKPFEFFMNRFRLLEAAPRADFSRYTGLHETLIRPQLDEAIAAGYITE-SP 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T++G   L+S++  L +
Sbjct: 356 EHWQITEKGKLFLNSLL-ELFL 376


>gi|256962102|ref|ZP_05566273.1| coproporphyrinogen III oxidase [Enterococcus faecalis Merz96]
 gi|293383126|ref|ZP_06629043.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis R712]
 gi|293387721|ref|ZP_06632266.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis S613]
 gi|312907286|ref|ZP_07766277.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis DAPTO 512]
 gi|312909904|ref|ZP_07768752.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis DAPTO 516]
 gi|256952598|gb|EEU69230.1| coproporphyrinogen III oxidase [Enterococcus faecalis Merz96]
 gi|291079465|gb|EFE16829.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis R712]
 gi|291082910|gb|EFE19873.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis S613]
 gi|310626314|gb|EFQ09597.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis DAPTO 512]
 gi|311289862|gb|EFQ68418.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis DAPTO 516]
          Length = 382

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NHLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|83589446|ref|YP_429455.1| coproporphyrinogen III oxidase, anaerobic [Moorella thermoacetica
           ATCC 39073]
 gi|83572360|gb|ABC18912.1| coproporphyrinogen III oxidase, anaerobic [Moorella thermoacetica
           ATCC 39073]
          Length = 388

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 116/378 (30%), Positives = 190/378 (50%), Gaps = 9/378 (2%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +Y+H PFCV+KC YCDF S+  +       + +    EM+       P   +++F GGGT
Sbjct: 16  IYIHIPFCVRKCNYCDFISYPEQSPEVMAVYCRLLEEEMKLAAGTWQPGPAATVFLGGGT 75

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           P+++    +  IL  +   +      E+++EANP ++ +   +  R AGVNR+SLGVQS 
Sbjct: 76  PTILPADLLERILVAVEGYFNRQPEAEVSVEANPGTITLEKLRVLRSAGVNRLSLGVQSF 135

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
           +++ L+ +GR H   +   A HLAR      ++ DLI+ LP QT+  W+  L+ AL+   
Sbjct: 136 DDRLLKAMGRIHRRRDIYQAYHLARRAGFANINLDLIFGLPGQTLENWQATLREALALQP 195

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           +HL+ Y L +E+ T + ++   G+L LP E + + +Y   +   +A G   YEISN +  
Sbjct: 196 EHLAAYSLQVEEDTPWGRLAAAGNLNLPGEELELAMYQEAREKLAAAGYQQYEISNFARP 255

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G    HN+ YW    Y+G+G  A S  +    +      K+ E +   +        E E
Sbjct: 256 GYRCRHNVTYWLNHPYLGLGAAAASSWRGERWQNY----KNLEQYGAALSAGRLPRAEIE 311

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE---RNLQRQGFIERVQFSRL 376
             +  QQ  E + M LRL  G++++ +    G++           L R G IE VQ   L
Sbjct: 312 VTTPRQQMAETMFMSLRLLAGVNLQAFRQRFGKDAREVYAGEMERLLRAGLIE-VQGHHL 370

Query: 377 RCTQRGMTMLDSVIANLA 394
           + T+RG+ + + V A   
Sbjct: 371 KLTERGLPLANEVFAAFV 388


>gi|264679918|ref|YP_003279827.1| oxygen-independent coproporphyrinogen [Comamonas testosteroni
           CNB-2]
 gi|262210433|gb|ACY34531.1| putative oxygen-independent coproporphyrinogen [Comamonas
           testosteroni CNB-2]
          Length = 409

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 130/383 (33%), Positives = 216/383 (56%), Gaps = 11/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
             L +YVH P+C+KKCPYCDFNSH   +   + ++ +I + + +++    L   R++ S+
Sbjct: 34  PPLSLYVHLPWCLKKCPYCDFNSHAWAKGDALPEDRYIDALMADLESALPLIWGRTVHSV 93

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSL  P+++  ++ G+     +  + EIT+EANP + E + F+ +R AGVNR+S
Sbjct: 94  FMGGGTPSLFSPESMDKLIAGLRARLRMEPDCEITMEANPGTFEKDRFKAFRAAGVNRLS 153

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           +GVQS +++ L+ +GR H+A++A AA+  A + F   + DL+YALP Q+M   + ++  A
Sbjct: 154 IGVQSFDDRYLQAVGRVHDAAQAQAAVREAADNFETFNIDLMYALPGQSMVDLQRDVDTA 213

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           LS+A  HLS+Y LTIE  T F K       V+P ++ A ++ +L  + T A G+  YE+S
Sbjct: 214 LSFAPPHLSIYHLTIEPNTYFAKYPP----VVPEDDTAYEMLDLITASTRAAGMQRYEVS 269

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            ++  G +  HN NYW++GDY+GIG GAHS++      V     + P  ++ M       
Sbjct: 270 AYAKDGHQCFHNSNYWQFGDYLGIGAGAHSKLSFAHRIVRQVRFRDPARYMDMALAGTPL 329

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQ 372
             + E +       E+++  LRLR G +++++    G  +          Q +G I R  
Sbjct: 330 AQDNE-VKRADLPFEYMLNALRLRGGFALQEFMERTGLPMSAIAKGLDQAQAKGLISR-D 387

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
             R+  T+RG   L   +  + +
Sbjct: 388 LGRVVPTERGFDFLSD-LQEMFL 409


>gi|171779991|ref|ZP_02920895.1| hypothetical protein STRINF_01778 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281339|gb|EDT46774.1| hypothetical protein STRINF_01778 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 376

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 115/384 (29%), Positives = 202/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   + ++Q+ + E +        + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDEYLQALIREFESY----DIKKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + K+  +S   E TIEANP  +  +  +  + + VNR+SL
Sbjct: 58  IGGGTPTSITAEQLEYLLTNLTKHLDLSVLEEFTIEANPGDLTEDKIEVLKHSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+  ++ L+ +GR+HN ++      +L    F  +S DLIYALP QTM   +  + +A
Sbjct: 118 GVQTFNDKHLKQIGRSHNEAQIYSTISNLKEAGFHNISIDLIYALPGQTMEDVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           ++  + HLSLY L +E  T+F    + G L LP E++  +++    S   A+G   YEIS
Sbjct: 178 IALDIPHLSLYSLILEHHTVFMNKMRRGKLQLPKEDLEAEMFEYIISELEANGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   +    +R    I+ + ++        G+A
Sbjct: 238 NFTKPGFESRHNLMYWDNAEYFGVGAGASGYLNGVRYRNRGPIQHYLKAV-----AQGNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERV 371
            + +E L+ ++  +E L +GLR + G+S+  +E   G + +       R L +QG +   
Sbjct: 293 RLSEEKLTKDEMMEEELFLGLRKKTGVSIARFEEKFGLSFEERYGQIVRELCQQGLLVP- 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T++G+ + D+V+    +
Sbjct: 352 DDKVVRMTKKGLFLGDTVVERFIL 375


>gi|55821243|ref|YP_139685.1| coproporphyrinogen III oxidase [Streptococcus thermophilus LMG
           18311]
 gi|55737228|gb|AAV60870.1| coproporphyrinogen III oxidase [Streptococcus thermophilus LMG
           18311]
          Length = 378

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 209/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++++ + E +    L+  + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLRALIREWE----LSDIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSHLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I   ++     +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESIDSLKSAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +    LQ  G + + 
Sbjct: 294 RLNEEHLTKVEMMEEEFFLGLRKKSGVSIKRFEEKFGMSFSDTYGDIVEKLQADGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|254784467|ref|YP_003071895.1| oxygen-independent coproporphyrinogen III oxidase [Teredinibacter
           turnerae T7901]
 gi|237687347|gb|ACR14611.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Teredinibacter turnerae T7901]
          Length = 388

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 195/382 (51%), Gaps = 9/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH  R ++  + +I + L +    R     R I S+FF
Sbjct: 10  PPLSLYVHIPWCVRKCPYCDFNSHSVRSELPVDAYIDALLADCSADRHFAQQRKIRSVFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + IA +LDG+ +    + + EIT+E NP + E +NF  YR AGVNRISLG
Sbjct: 70  GGGTPSLLPGKAIARLLDGLRERLDFTRDCEITLETNPGTAEYSNFADYRAAGVNRISLG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
            QS     L+ LGR H       A   AR+  F  ++ DL++AL  Q       +L+ A+
Sbjct: 130 AQSFNALQLQQLGRIHQPENIQIAFTQARDAGFDNINLDLMFALQGQNCADAMRDLEAAI 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +   +H+S YQLTIE  T FY         LP ++ + ++      + +      YE+S 
Sbjct: 190 ALEPEHISWYQLTIEPNTAFYSNPP----SLPDDDTSWEIQQAGMQLLADSNYAQYEVSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVG-SHRVAISIEKHPESWLKMVRKNGHA 314
           ++  G ++ HN+NYW +GDY+ IG GAH ++     +R+    +           +    
Sbjct: 246 YARAGKQAAHNINYWEFGDYMAIGAGAHGKITWPEENRIERYQKTRLPDHYLAAAQTCAF 305

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQ 372
              +E L+      EF+M  LRL +G++ + +    G  L         L+ +G +    
Sbjct: 306 TSHRETLAEHNLPFEFMMNALRLNQGVASELFTARTGLPLASLEPQLTPLREKGLLG-TD 364

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             RL  T  G   L+SV+ +L 
Sbjct: 365 PQRLYTTTLGHQYLNSVLESLL 386


>gi|312278573|gb|ADQ63230.1| Coproporphyrinogen III oxidase, anaerobic [Streptococcus
           thermophilus ND03]
          Length = 378

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 210/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++++ + E +    L+  + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLRALIREWE----LSDIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSHLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I+  ++     +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESINSLKSAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +    LQ  G + + 
Sbjct: 294 RLNEEHLTKVEMMEEEFFLGLRKKSGVSIKRFEEKFGMSFADTYGDIVEKLQADGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|221310474|ref|ZP_03592321.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221314798|ref|ZP_03596603.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221319720|ref|ZP_03601014.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. subtilis
           str. JH642]
          Length = 377

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 116/380 (30%), Positives = 189/380 (49%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN +  + +   + ++ +   EM      TG   + +IF GGG
Sbjct: 3   SAYIHIPFCEHICHYCDFNKYFIQSQ-PVDEYLNALEQEMINTIAKTGQPDLKTIFIGGG 61

Query: 80  TPSLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           TP+ +  + +  ++D I +     S   E  +EANP  +     +  ++AGVNR+S GVQ
Sbjct: 62  TPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEKLKILKEAGVNRLSFGVQ 121

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           + E+  L  +GR H   +   +   AR I F  +S DL++ LP QT+   E  +  ALS 
Sbjct: 122 TFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGLPGQTLKHLEHSINTALSL 181

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H S+Y L +E  T+FY + + G L LP +    ++Y +  S   AHG+H YEISN +
Sbjct: 182 DAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEIVMSKMEAHGIHQYEISNFA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YW    Y G G GAH  +          ++ + +    ++ + G    +
Sbjct: 242 KAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYID----LIAEKGFPYRD 297

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
              +++E+Q +E + +GLR   G+S K +    GR+LD       ++L  +G I   + +
Sbjct: 298 THEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESA 357

Query: 375 RLRCTQRGMTMLDSVIANLA 394
            +  T +G  + + V     
Sbjct: 358 -VYLTHQGKLLGNEVFGAFF 376


>gi|322376217|ref|ZP_08050710.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus sp. M334]
 gi|321282024|gb|EFX59031.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus sp. M334]
          Length = 376

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 206/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L+G+ KN  +S+  E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLNGLTKNLDLSALEELTIEANPGDLDADKIAVLKNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMEQVKDNVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 IGLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +  +     G+A
Sbjct: 238 NFSKSGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLSAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR  D    E  R+L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGRTFDGLYGEIVRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           +  R+R T+RG+ + D+V     +
Sbjct: 352 EGDRVRMTKRGLFLGDTVAERFIL 375


>gi|291484998|dbj|BAI86073.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 379

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 116/380 (30%), Positives = 190/380 (50%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN +  + +   + ++ +   EM      TG   + +IF GGG
Sbjct: 3   SAYIHIPFCEHICHYCDFNKYFIQSQ-PVDEYLNALEQEMINTIAKTGQPDLKTIFIGGG 61

Query: 80  TPSLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           TP+ +  + +  ++D I +     S   E  +EANP  +     +  ++AGVNR+S GVQ
Sbjct: 62  TPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEKLKILKEAGVNRLSFGVQ 121

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           + E+  L  +GR H   +   +   AR+I F  +S DL++ LP QT+   E  +  ALS 
Sbjct: 122 TFEDDLLEKIGRVHKQKDVFTSFERARDIGFENISLDLMFGLPGQTLKHLEHSINTALSL 181

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H S+Y L +E  T+FY + + G L LP +    ++Y +  S   AHG+H YEISN +
Sbjct: 182 DAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEMVMSQMEAHGIHQYEISNFA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YW    Y G G GAH  +          ++ + +    ++ + G    +
Sbjct: 242 KAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYID----LIAEKGFPYRD 297

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
              +++E+Q +E + +GLR   G+S K +    GR+LD       ++L  +G I   + +
Sbjct: 298 THEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESA 357

Query: 375 RLRCTQRGMTMLDSVIANLA 394
            +  T +G  + + V     
Sbjct: 358 -VYLTHQGKLLGNEVFGAFL 376


>gi|109899593|ref|YP_662848.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudoalteromonas atlantica T6c]
 gi|109701874|gb|ABG41794.1| coproporphyrinogen III oxidase, anaerobic [Pseudoalteromonas
           atlantica T6c]
          Length = 396

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 129/385 (33%), Positives = 200/385 (51%), Gaps = 13/385 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKV-GQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             + +Y+H P+CV+KCPYCDFNSH ++     +  ++   L ++     L G R + SIF
Sbjct: 18  PPVALYIHIPWCVQKCPYCDFNSHGQKQDSLPEAEYVSHLLDDLAQDANLIGDRPVHSIF 77

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL  P  I  +L G+ +   ++ + EIT+EANP +VE   F G+ +AGVNRIS+
Sbjct: 78  IGGGTPSLFSPDAIGRLLTGVRERVNLAVDAEITLEANPGTVESERFNGFAQAGVNRISI 137

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRA 194
           GVQS +++ L  LGR H+  +A+ A   ARN      + DL++ LP+Q++     +L++ 
Sbjct: 138 GVQSFQQEKLERLGRIHDEQQALNAAGYARNAGLNSFNLDLMHGLPEQSIDDALFDLRQG 197

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           ++    HLS YQLTIE  T F+         LP +++  D+      I +A G   YEIS
Sbjct: 198 IAQQPPHLSWYQLTIEPNTQFHSKPP----TLPEDDILWDIQEQGHDILTAAGYEQYEIS 253

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
            +S  G +  HNLNYWR+GDY+GIG GAH ++ +      I      +     +      
Sbjct: 254 GYSLAGQQCQHNLNYWRFGDYLGIGCGAHGKITLKDSG-QILRTVKVKHPKGYMDLTRSY 312

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI-----ECERNLQRQGFIE 369
           + ++  +  E+   EF M  LRL E    +D+    G   D      E   +   +G + 
Sbjct: 313 MHQQHTVQDEELPFEFFMNRLRLLEPCPKQDFSAFTGLVFDEQTDLKENLASAVNKGLLA 372

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
               +  + T  G   L+S++  L 
Sbjct: 373 ESD-THWQVTPLGRRYLNSLLEMLV 396


>gi|116627982|ref|YP_820601.1| coproporphyrinogen III oxidase [Streptococcus thermophilus LMD-9]
 gi|116101259|gb|ABJ66405.1| coproporphyrinogen III oxidase, anaerobic [Streptococcus
           thermophilus LMD-9]
          Length = 378

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 210/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++++ + E +    L+  + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLRALIREWE----LSDIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSHLQKNLNLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I+  ++     +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESINSLKSAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +    LQ  G + + 
Sbjct: 294 RLNEEHLTKVEMMEEEFFLGLRKKSGVSIKRFEEKFGMSFADTYGDIVEKLQADGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|62391133|ref|YP_226535.1| coproporphyrinogen III oxidase [Corynebacterium glutamicum ATCC
           13032]
 gi|161486712|ref|NP_601492.2| coproporphyrinogen III oxidase [Corynebacterium glutamicum ATCC
           13032]
 gi|41326472|emb|CAF20634.1| PUTATIVE ANAEROBIC COPROPORPHYRINOGEN III OXIDASE [Corynebacterium
           glutamicum ATCC 13032]
          Length = 380

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 123/382 (32%), Positives = 181/382 (47%), Gaps = 14/382 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYK---VGQENFIQSFLTEMQWM-RQLTGPRSISSI 74
            GVY+H PFC  +C YCDFN++         G + ++ S   E++     L  PR   +I
Sbjct: 4   FGVYIHVPFCSTRCGYCDFNTYTAGELGSTAGPDTYLDSLEVELEMAVASLDNPRQAETI 63

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           F GGGTPSLI    +A +L  +   + ++   E+T E+NP S     F G R+AG NRIS
Sbjct: 64  FIGGGTPSLIGADGLARVLGAVRNTFGIADGAEVTTESNPESTSPEFFDGLREAGYNRIS 123

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQR 193
           LG+QS     L+ L R H     +AA   AR   F  ++ D+IY  P +T       L  
Sbjct: 124 LGMQSASSSVLKVLDRTHTPGRPVAAAKEAREAGFEHVNLDMIYGTPTETDDDVRKTLDA 183

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
            L   VDH+S Y L +E GT   +  + G+L  P E+V  D + L  +   + G   YE+
Sbjct: 184 VLEANVDHVSAYSLIVEDGTAMARKVRKGELPAPDEDVYADRFELIDARLRSAGFDWYEV 243

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SN +  G E  HN+ YW  GD+ G GPGAHS +            KHP  +   +     
Sbjct: 244 SNWAKPGGECKHNMGYWVDGDWWGAGPGAHSHIGDRR----FYNIKHPARYSAQIAAGEL 299

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQF 373
            + E E L++E    E +M+GLRL++G+ +  +                   G +     
Sbjct: 300 PIKETERLTAEDHHTERVMLGLRLKQGVPLNLFA-----PAARPVIDRHIAGGLLHVNAL 354

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
             L  T  G  + D +IA++ +
Sbjct: 355 GNLAVTDAGRLLADGIIADILL 376


>gi|213424104|ref|ZP_03356997.1| coproporphyrinogen III oxidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 573

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 205/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V  ++++Q  L+++         R + +IF 
Sbjct: 200 PPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLSDLDADVAWAQGREVKTIFI 259

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +LDG+     ++++ EIT+EANP +VE + F  Y++AGVNRIS+G
Sbjct: 260 GGGTPSLLSGPAMQTLLDGVRARLNLAADAEITMEANPGTVEADRFIDYQRAGVNRISIG 319

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  E  L+ LGR H   EA+ A  LA  +  R  + DL++ LP QT+ +   +L++A+
Sbjct: 320 VQSFSEPKLKRLGRIHGPQEAMRAARLANGLGLRSFNLDLMHGLPDQTLEEALNDLRQAI 379

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S 
Sbjct: 380 ALNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSA 435

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH +V     R+  +     ++        G  +
Sbjct: 436 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPDGRILRTT----KTRHPRGYMQGRYL 491

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
             +  +S + +  EF M   RL E     ++    G    +          QG++   + 
Sbjct: 492 ESQRDVSDDDKPFEFFMNRFRLLERAPRAEFVDYTGLTEAVIRQPIDEAIAQGYLTECE- 550

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T+ G   L+S++  L +
Sbjct: 551 QYWQITRHGKLFLNSLL-ELFL 571


>gi|228941484|ref|ZP_04104034.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228974414|ref|ZP_04134982.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228981009|ref|ZP_04141311.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis Bt407]
 gi|228778669|gb|EEM26934.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis Bt407]
 gi|228785250|gb|EEM33261.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818134|gb|EEM64209.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326942100|gb|AEA17996.1| coproporphyrinogen III oxidase [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 379

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 181/379 (47%), Gaps = 11/379 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN      +   + ++     E+    Q     S+ +IF GGGTP
Sbjct: 6   YIHIPFCQHICHYCDFNKVFIERQ-PVDQYLDYLEKEIINTVQKVPFDSMKTIFVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKN-WTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +  +    +L+ I ++    + N E+T EANP  +         + GVNRIS GVQ+ 
Sbjct: 65  TALNMEQTKKLLEIINRHLRPFAPNCELTFEANPGDLPKEKLNVLLEGGVNRISFGVQTF 124

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            ++ L  +GR H   +A  AI  A+ +    ++ D+IYALP QT+   +  L  A +  V
Sbjct: 125 RDELLEKIGRKHTREDAFLAIREAQEVGFKNINVDIIYALPGQTIEDVKETLDIAFTLGV 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H S Y L +E  T+FY +   G L LP E+    +Y +       HG + YEISN S  
Sbjct: 185 QHFSAYSLIVEPKTVFYNLMNKGKLRLPGEDHEAKMYEMVMDEMEKHGYNQYEISNFSKG 244

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             +S HNL YW   +Y G G GAHS V        I      + +   + + G   ++  
Sbjct: 245 DNKSRHNLTYWNNEEYYGFGAGAHSYVNGER----IQNVGPLKQYFNKIDETGFPYLDVH 300

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSRL 376
            ++ +++ +E L +GLR  +G+S   +       +D    + L   Q QG +E  +   +
Sbjct: 301 KVTEKERMEEELFLGLRKTKGVSKTAFRNKFNVEMDQVFAKQLQSNQEQGLLEE-ENGHV 359

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T++G  + + V  +  +
Sbjct: 360 RLTRKGKLLGNEVFQSFLI 378


>gi|321312034|ref|YP_004204321.1| coproporphyrinogen III oxidase [Bacillus subtilis BSn5]
 gi|320018308|gb|ADV93294.1| coproporphyrinogen III oxidase [Bacillus subtilis BSn5]
          Length = 379

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 116/380 (30%), Positives = 189/380 (49%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN +  + +   + ++ +   EM      TG   + +IF GGG
Sbjct: 3   SAYIHIPFCEHICHYCDFNKYFIQSQ-PVDEYLNALEQEMINTIAKTGQPDLKTIFIGGG 61

Query: 80  TPSLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           TP+ +  + +  ++D I +     S   E  +EANP  +     +  ++AGVNR+S GVQ
Sbjct: 62  TPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEKLKILKEAGVNRLSFGVQ 121

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           + E+  L  +GR H   +   +   AR I F  +S DL++ LP QT+   E  +  ALS 
Sbjct: 122 TFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGLPGQTLKHLEHSINTALSL 181

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H S+Y L +E  T+FY + + G L LP +    ++Y +  S   AHG+H YEISN +
Sbjct: 182 DAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEMVMSQMEAHGIHQYEISNFA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YW    Y G G GAH  +          ++ + +    ++ + G    +
Sbjct: 242 KAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYID----LIAEKGFPYRD 297

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
              +++E+Q +E + +GLR   G+S K +    GR+LD       ++L  +G I   + +
Sbjct: 298 THEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESA 357

Query: 375 RLRCTQRGMTMLDSVIANLA 394
            +  T +G  + + V     
Sbjct: 358 -VYLTHQGKLLGNEVFGAFL 376


>gi|315174393|gb|EFU18410.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX1346]
          Length = 382

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFHEPIEAIYGEVIQLLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|312866178|ref|ZP_07726399.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus downei F0415]
 gi|311098582|gb|EFQ56805.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptococcus downei F0415]
          Length = 377

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 119/384 (30%), Positives = 209/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++Q+ L E ++       +++ +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLQALLEEFRFY----DIKNLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L G+ ++  +S+  E TIEANP  +  +  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTALSASQLEVLLLGLQESLDLSALEEFTIEANPGDLTADKVEVLQKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+HN ++       L +  F  +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKELKRIGRSHNEAQIYQSVSALKQAGFDNISIDLIYALPGQTMDQVKTNVKKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L+  + HLSLY L +E  T+F    + G L LP+E+V  D++         HG   YEIS
Sbjct: 178 LALDIPHLSLYSLILENHTVFMNKMRRGRLHLPNEDVESDMFTYIIDELEKHGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   +    +R    I+ + ++  +     GHA
Sbjct: 238 NFTKPGYESRHNLVYWDNVEYYGLGAGASGYLDGVRYRNRGPIQHYLKAVAQA----GHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERV 371
            + +E L+  +Q +E + +GLR + GIS+  ++     +          +L   G + + 
Sbjct: 294 RLHEEKLTKSEQMEEEIFLGLRKKSGISINRFQEKFQEDFQQRYGQIVADLLADGLL-QT 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           Q  ++R T+RG+ + D+V     +
Sbjct: 353 QGDQIRMTKRGLFLGDTVAEKFFI 376


>gi|257089709|ref|ZP_05584070.1| coproporphyrinogen III oxidase [Enterococcus faecalis CH188]
 gi|256998521|gb|EEU85041.1| coproporphyrinogen III oxidase [Enterococcus faecalis CH188]
 gi|315578402|gb|EFU90593.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0630]
          Length = 382

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDALTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMEKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQQKFQEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|148980494|ref|ZP_01816091.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
 gi|145961219|gb|EDK26533.1| coproporphyrinogen III oxidase [Vibrionales bacterium SWAT-3]
          Length = 395

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 133/387 (34%), Positives = 205/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG----PRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +       PR + 
Sbjct: 9   PALSLYVHIPWCVQKCPYCDFNSHALKTEIPEKEYIDALLEDLDTDIEKYQLNGMPRPLH 68

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIFFGGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAG+ R
Sbjct: 69  SIFFGGGTPSLFSPEGIGRLLQGIEQRIPFKPEIEITMEANPGTIEAERFAGYQKAGITR 128

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L
Sbjct: 129 ISVGVQSFEQEKLERLGRIHGQDEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADL 188

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+     HLS YQLTIE  T+FY         LP ++   D++ L     +  G   Y
Sbjct: 189 DKAIELDPPHLSWYQLTIEPNTMFYYKTP----TLPDDDDLWDIFELGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + +           +N
Sbjct: 245 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQN 304

Query: 312 --GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI--ECERNLQRQGF 367
                + ++  +++E +  EF M   RL E    +D+    G   D         +  G+
Sbjct: 305 MVKPYISDEFEVANEDRPFEFFMNRFRLMEACPKQDFIDTTGLGFDAVQPTIEWAKELGY 364

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +     +  + T++G   L+ ++    
Sbjct: 365 LNETD-THWQITEKGKLFLNDLLEAFM 390


>gi|152984897|ref|YP_001345880.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PA7]
 gi|150960055|gb|ABR82080.1| probable oxidase [Pseudomonas aeruginosa PA7]
          Length = 384

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 123/381 (32%), Positives = 202/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++   +    R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYVDALLADLEQDLRHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQAKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+  EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGDEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++   HG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDEHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+      +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAALADACAAARDAGLLAE-DP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RLR ++RG   L+ ++ +  
Sbjct: 363 QRLRPSERGQLFLNDLLQHFL 383


>gi|326779437|ref|ZP_08238702.1| oxygen-independent coproporphyrinogen III oxidase [Streptomyces cf.
           griseus XylebKG-1]
 gi|326659770|gb|EGE44616.1| oxygen-independent coproporphyrinogen III oxidase [Streptomyces cf.
           griseus XylebKG-1]
          Length = 413

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 118/398 (29%), Positives = 192/398 (48%), Gaps = 22/398 (5%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-------QENFIQSFLTEMQWM 62
            + G     LG Y+H P+C  +C YCDFN++      G       ++N+    + E++  
Sbjct: 24  ALEGAADRPLGFYLHVPYCATRCGYCDFNTYTATELRGSGGALASRDNYAAHLIEEVRQA 83

Query: 63  RQLTG--PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           R++ G  PR + ++F GGGTP+L+   ++  +L  I + + ++ + EIT EANP SV+  
Sbjct: 84  RKVLGDDPRPVRTVFVGGGTPTLLPAADLVRMLAAIREEFGLADDAEITTEANPESVDPA 143

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYAL 179
                R+ G NR+S G+QS ++  L+ L R H      A +  AR   F  ++ DLIY  
Sbjct: 144 YLTALREGGFNRVSFGMQSAKQHVLKILDRTHTPGRPEACVAEARAAGFDHVNLDLIYGT 203

Query: 180 PKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLT 239
           P ++   W   L  A+    DH+S Y L +E+GT   +  + G++ +  ++   D Y + 
Sbjct: 204 PGESDDDWRATLDAAIGAGPDHVSAYALIVEEGTQLARRIRRGEIPMTDDDAHADRYLIA 263

Query: 240 QSITSAHGLHAYEISNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE 298
               +A G H YE+SN +       LHN  YWR  D+ G GPGAHS V            
Sbjct: 264 DEAFAAAGFHWYEVSNWATTEAGRCLHNELYWRGADWWGAGPGAHSHVGGVR----WWNV 319

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC 358
           KHP ++ + + +       +E L+ E +  E +++ LRLREG  +   +        +  
Sbjct: 320 KHPGAYAQALAEGRSPGAGREILAEEDRRVERILLELRLREGCPLDLLK-----PDGLAA 374

Query: 359 ERNLQRQGFI--ERVQFSRLRCTQRGMTMLDSVIANLA 394
            R     G +  E     R   T RG  + D+V+ +L 
Sbjct: 375 SRRALADGLLAPEPYDRGRAVLTLRGRLLADAVVRDLV 412


>gi|302391388|ref|YP_003827208.1| oxygen-independent coproporphyrinogen III oxidase [Acetohalobium
           arabaticum DSM 5501]
 gi|302203465|gb|ADL12143.1| oxygen-independent coproporphyrinogen III oxidase [Acetohalobium
           arabaticum DSM 5501]
          Length = 378

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 127/380 (33%), Positives = 211/380 (55%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
           G+Y+H+PFC++KC YCDFNS   +  +  E F  +   E++ +        + SIF GGG
Sbjct: 5   GLYIHFPFCIQKCYYCDFNSVAWQDDLAAE-FFTALCEEIKLVAADYDYPQLKSIFLGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPS    Q IA +L  +   + + + +E+TIEANP +V+ N  + +++ G+NR+S GVQS
Sbjct: 64  TPSCFSGQTIAELLSVLEDEFRLKTELEVTIEANPGTVDQNKLEIFKEVGINRLSFGVQS 123

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYA 198
            + + L  LGR H A +A    +LAR +    ++ DLI+A+P Q ++QW++ L+ AL  A
Sbjct: 124 FDNRILNKLGRIHTAQKAEKNYYLAREVGFANINLDLIFAIPGQKLSQWKVTLESALQLA 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            +HL+ Y L IE GT   K    G +    +++ +++Y LT+ +   +G   YEISN + 
Sbjct: 184 PEHLATYNLKIEPGTKLGKDLAQGRIEPVCQDLDLEMYQLTKKLLIDNGYEHYEISNFAK 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G  S HN  YW+   Y+ +GPGAH            +  +    ++ +++     V  +
Sbjct: 244 PGYRSEHNQIYWQNEPYLALGPGAHFYDGEFRG----NNLESIGEYINVIKDGEKPVEIE 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR---NLDIECERNLQRQGFIERVQFSR 375
           E LS E +  E +++GLRL+EGIS  ++E   G    N+  E  + L +QG IE +   +
Sbjct: 300 ESLSREDKIIETMILGLRLKEGISTLEFEERFGESVHNIYNEELKKLNKQGLIE-INSQQ 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           +  T++G  + + V+A   +
Sbjct: 359 IALTEKGRVLANDVLAEFIL 378


>gi|296386884|ref|ZP_06876383.1| coproporphyrinogen III oxidase [Pseudomonas aeruginosa PAb1]
          Length = 384

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 124/381 (32%), Positives = 203/381 (53%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +E ++ + L +++        R + SIFF
Sbjct: 10  PPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYVDALLADLEQDLHHVHGRRLGSIFF 69

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +L+G+ +    +  +EIT+EANP + E   F  YR+ G+NR+S+G
Sbjct: 70  GGGTPSLFSAKALGRLLEGVERRVGFADGIEITLEANPGTFEQVKFADYRRLGINRLSIG 129

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +   L+ LGR H+ +EA+ A  +AR   F   + DL++ LP Q++     +L++AL
Sbjct: 130 VQSFQADKLQALGRIHDGAEAVRAADMARQAGFDNFNLDLMHGLPGQSLDDALADLRQAL 189

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+    +    LP +++  D+    Q++  AHG   YE S 
Sbjct: 190 ALAPTHLSWYQLTMEPNTVFWSQPPE----LPEDDILWDIQEAGQALLDAHGYRQYETSA 245

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD++GIG GAH+++     R+              +       
Sbjct: 246 YARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDGRIVR--TWKTRLPKDYLNPQKAFQ 303

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
             +  L +     EF+M  LRL +G+    +    G+ L    +     +  G +     
Sbjct: 304 AGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQPLAAIADACAAARDAGLLA-DDP 362

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             LR ++RG   L+ ++ +  
Sbjct: 363 QHLRPSERGQLFLNDLLQHFL 383


>gi|123443632|ref|YP_001007604.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090593|emb|CAL13462.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 376

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 128/383 (33%), Positives = 204/383 (53%), Gaps = 15/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLDVDVPLVSGREISTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSAEAMQQLLDGVRARLPLAIDAEITMEANPGAVEADRFSGYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSAEKLTRLGRIHGPDEAKRAAELATSLELRSFNLDLMHGLPDQSLEEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  T F          LP ++   D++     + S  G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTGFSSRPP----TLPDDDALWDIFQQGHQLLSTAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+        ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFRDGRILR----TIKTKHPRGFMQGKYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR---NLDIECERNLQRQGFIERVQ 372
            ++  + +  +  EF M   RL E     D+    G     +  + +  L ++  IE  +
Sbjct: 297 DKQYEVEAADRPFEFFMNRFRLLEAAPRADFTHFTGLAESTIRPQLDEALAKEYLIETEE 356

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
               + T++G   L+S++  L +
Sbjct: 357 --YWQITEKGKLFLNSLL-ELFL 376


>gi|312963629|ref|ZP_07778110.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas fluorescens WH6]
 gi|311282138|gb|EFQ60738.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudomonas fluorescens WH6]
          Length = 400

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 132/381 (34%), Positives = 206/381 (54%), Gaps = 10/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + +E ++ + L ++         R +SSIFF
Sbjct: 26  PPLALYIHIPWCVRKCPYCDFNSHTASQVLPEEEYVDALLDDLDQDLHAVYGRELSSIFF 85

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+      + ++EIT+EANP + E   F  YRK G+NR+S+G
Sbjct: 86  GGGTPSLFSAAALGRLLKGVEARIPFAGDIEITLEANPGTFEQEKFVAYRKLGINRLSIG 145

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS +++ L  LGR HN  EA+ A  +AR   F   + DL++ LP Q++     +L++A+
Sbjct: 146 VQSFQQEKLEALGRIHNGDEAVRAAGMARQAGFDNFNLDLMHGLPNQSLDDALSDLRQAI 205

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLT+E  T+F+        VLP ++   D+    Q++ + HG   YE+S 
Sbjct: 206 ALKPTHLSWYQLTLEPNTVFWNQPP----VLPEDDTLWDIQEAGQALLAEHGYRQYEVSA 261

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+         +    +       
Sbjct: 262 YAQPGRPARHNLNYWSFGDFIGIGAGAHGKLSHPDGRIVR--TWKTRAPKDYLNPAKPFQ 319

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECE--RNLQRQGFIERVQF 373
              + L++E+   EFLM  LRL EG+  + +    G +     E  R  ++ G + +V+ 
Sbjct: 320 AGAKELTNEELPFEFLMNALRLTEGVEARLYAERTGLDQASLAEGRREAEQSGLM-QVEP 378

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
           SRL  T RG   L+ ++    
Sbjct: 379 SRLAATDRGQLFLNDLLQTFL 399


>gi|55823155|ref|YP_141596.1| coproporphyrinogen III oxidase [Streptococcus thermophilus
           CNRZ1066]
 gi|55739140|gb|AAV62781.1| coproporphyrinogen III oxidase [Streptococcus thermophilus
           CNRZ1066]
          Length = 378

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 210/384 (54%), Gaps = 14/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++++ + E +    L+  + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLRALIHEWE----LSDIKELRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  + +  +L  + KN  +S   E TIEANP  + V+  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTAISAEQLDYLLSHLQKNLDLSKLEEFTIEANPGDLTVDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ LR +GR+HN ++   +I   ++     +S DLIYALP QTM Q +  +++A
Sbjct: 118 GVQTFDDKHLRQIGRSHNQAQIYESIDSLKSAGFHNISIDLIYALPGQTMDQVKENVRKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + HLSLY L +E  T+F    + G L LP+E++  ++++        +G   YEIS
Sbjct: 178 LELDIPHLSLYSLILEHHTVFMNKMRRGKLNLPTEDLEAEMFDYIIQELEKNGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   V    +R    I+ + +     + ++GHA
Sbjct: 238 NFTKPGMESRHNLMYWNNDEYYGVGAGASGYVNGVRYRNRGPIQHYLK----AIAEDGHA 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERV 371
            + +E L+  +  +E   +GLR + G+S+K +E   G +      +  + LQ  G + + 
Sbjct: 294 RLNEEHLTKVEMMEEEFFLGLRKKSGVSIKRFEEKFGLSFSDTYGDIVKKLQEDGLLVK- 352

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T+RG+ + DSV     +
Sbjct: 353 DPEVVRMTKRGLFLGDSVAEQFIL 376


>gi|239995547|ref|ZP_04716071.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alteromonas macleodii ATCC 27126]
          Length = 379

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 130/385 (33%), Positives = 208/385 (54%), Gaps = 14/385 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +  L +Y+H P+CV+KCPYCDFNSH  +  + ++ ++   L ++    +    R + +IF
Sbjct: 3   NPPLSLYIHIPWCVQKCPYCDFNSHGLKSDLPEKEYVAHLLDDLAIDAKRIADRPVETIF 62

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL   + +A IL G+ +   +S   EIT+EANP +VE   F G+ +AG+NRIS+
Sbjct: 63  IGGGTPSLFSSEAMADILKGVKQRVNLSDTAEITMEANPGTVEAGKFAGFYQAGINRISV 122

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIF-PRMSFDLIYALPKQTMTQWEMELQRA 194
           G+QS + + L+ LGR HN S+A  A+  A +   P  + DL++ LP+Q++     +L++ 
Sbjct: 123 GIQSFQPKHLKVLGRIHNESQAENAVKQAHSAGLPTFNLDLMHGLPEQSVENAMGDLKQG 182

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +     HLS YQLTIE  T FY    +    LP +++  ++     S+    G H YEIS
Sbjct: 183 IELDPYHLSWYQLTIEPNTPFYSKPPE----LPDDDILWEIQEKGHSLLERAGYHQYEIS 238

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKV--GSHRVAISIEKHPESWLKMVRKNG 312
            ++  G +  HNLNYWR+GDY+GIG GAH ++              KHP  +++M     
Sbjct: 239 GYAKAGHQCRHNLNYWRFGDYLGIGCGAHGKITDAANGTIHRTVKVKHPRGYMEMS---R 295

Query: 313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIE 369
             +  +  +S++    EF M   RL E   + D+    G  L  + +R L     QG + 
Sbjct: 296 PYLDTQTLVSADDLPFEFFMNRFRLVEPCPMSDFSDFTGTELTDDVKRALSDAHHQGLLS 355

Query: 370 RVQFSRLRCTQRGMTMLDSVIANLA 394
            +  S  + T +G   L+S+++   
Sbjct: 356 -ISDSHWQVTAKGRRYLNSLLSCFV 379


>gi|291550851|emb|CBL27113.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Ruminococcus torques L2-14]
          Length = 385

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 132/388 (34%), Positives = 214/388 (55%), Gaps = 15/388 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
             +L +Y+H PFCV+KC YCDF S     +  Q  ++ + + E+Q  ++L+G   + +IF
Sbjct: 3   KRNLELYLHIPFCVRKCNYCDFFS-ASGTEEEQAAYVSAMVQEIQSYQELSGEYEVQTIF 61

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTPSL+ P+ I  I + I   ++V+ N EIT+E NP +V++      + AGVNR+S+
Sbjct: 62  LGGGTPSLLTPEQIEQIFNAIYHTFSVNENAEITMEMNPGTVDIEKLHAMKAAGVNRLSI 121

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHL-ARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           G+QS + + L+ LGR H   E +    L  +  F   + DL+ ALP QT+  +E  L + 
Sbjct: 122 GLQSAQNEELKMLGRIHTFEEFLETWKLIEQAGFKNRNIDLMSALPGQTIESYEDTLSKV 181

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVL-----PSENVAVDLYNLTQSITSAHGLH 249
           L+   +H+S Y L +E+GT+FY  ++ G L       PSE     +  LT    +  G++
Sbjct: 182 LALEPEHISAYSLILEEGTVFYDWYEKGKLDRGAWKLPSEEEEYAMGELTILRLAEAGMY 241

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YEISN++  G E  HNL YW   +Y+GIG G+ S +K              +++++ +R
Sbjct: 242 RYEISNYAKPGKECRHNLGYWDRVEYLGIGAGSSSLIKGERFDHIRDR----KAYIEKIR 297

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQG 366
                ++++E LS E Q +EF+ +GLR  EG+S  D++   G+N+D         L+ + 
Sbjct: 298 NGESILIDREILSVESQMEEFMYLGLRKVEGVSRTDFQNCFGKNVDDVYGKILDKLEEEQ 357

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIANLA 394
            +E     R+R T RGM + + V+A   
Sbjct: 358 LLE-FSGDRIRLTHRGMDVSNCVLAEFL 384


>gi|255767587|ref|NP_390428.2| coproporphyrinogen III oxidase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|251757469|sp|P54304|HEMN_BACSU RecName: Full=Oxygen-independent coproporphyrinogen-III oxidase 1;
           Short=Coprogen oxidase; Short=Coproporphyrinogenase
 gi|225185215|emb|CAB14492.2| coproporphyrinogen III oxidase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 379

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 116/380 (30%), Positives = 189/380 (49%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN +  + +   + ++ +   EM      TG   + +IF GGG
Sbjct: 3   SAYIHIPFCEHICHYCDFNKYFIQSQ-PVDEYLNALEQEMINTIAKTGQPDLKTIFIGGG 61

Query: 80  TPSLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           TP+ +  + +  ++D I +     S   E  +EANP  +     +  ++AGVNR+S GVQ
Sbjct: 62  TPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEKLKILKEAGVNRLSFGVQ 121

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           + E+  L  +GR H   +   +   AR I F  +S DL++ LP QT+   E  +  ALS 
Sbjct: 122 TFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGLPGQTLKHLEHSINTALSL 181

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H S+Y L +E  T+FY + + G L LP +    ++Y +  S   AHG+H YEISN +
Sbjct: 182 DAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEIVMSKMEAHGIHQYEISNFA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YW    Y G G GAH  +          ++ + +    ++ + G    +
Sbjct: 242 KAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYID----LIAEKGFPYRD 297

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
              +++E+Q +E + +GLR   G+S K +    GR+LD       ++L  +G I   + +
Sbjct: 298 THEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESA 357

Query: 375 RLRCTQRGMTMLDSVIANLA 394
            +  T +G  + + V     
Sbjct: 358 -VYLTHQGKLLGNEVFGAFL 376


>gi|190575705|ref|YP_001973550.1| coproporphyrinogen III oxidase [Stenotrophomonas maltophilia K279a]
 gi|190013627|emb|CAQ47262.1| putative coproporphyrinogen III oxidase family protein
           [Stenotrophomonas maltophilia K279a]
          Length = 408

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 131/383 (34%), Positives = 213/383 (55%), Gaps = 9/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH  + ++  + +I + L ++     L   R + S+FF
Sbjct: 29  PPLSLYVHLPWCVRKCPYCDFNSHQAKGELPFDAYIDALLRDLDQDLPLVWGRVVHSVFF 88

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL  P+ I   L   +     + N EIT+E NP + E   F  YR AGVNR+S G
Sbjct: 89  GGGTPSLFPPEAIDRFLQQASARLRFAPNAEITLETNPGTAEHGRFDRYRAAGVNRLSFG 148

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS ++  L+ LGR H++ EA  A+ +A++  +   + DL+YALP+QT+   E +L+RA 
Sbjct: 149 IQSFDDAMLKRLGRIHDSGEAERAVKMAQDAGYDNFNIDLMYALPEQTLAGAEADLERAF 208

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    H+S YQLT+E  T+F+     G   +P E+ A D+    Q++ +  G   YE+S 
Sbjct: 209 ALQPAHISHYQLTLEPNTVFFARPPQG---IPDEDNAWDMQEHCQALLAQAGFGQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +S HNLNYWR+GDY+GIG GAH ++  G+    +   K       +      A 
Sbjct: 266 YARPGRQSAHNLNYWRFGDYLGIGAGAHGKISSGAEEHVLRRWKLKHPQAYLDSAGTPAS 325

Query: 316 VEK-EFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNLDIECERNLQRQGFIERVQ 372
               + ++ E+   E+++  LRL EG  ++D+E   G  R++         ++G+++   
Sbjct: 326 FGGNDVIAPERLPFEYMLNLLRLHEGFGLRDFESRTGLPRSVLDAPLAEAVQRGWLDVTD 385

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
              ++ T+ G    + V++ L +
Sbjct: 386 -GHVQPTELGRRFTNDVVS-LFL 406


>gi|171057394|ref|YP_001789743.1| oxygen-independent coproporphyrinogen III oxidase [Leptothrix
           cholodnii SP-6]
 gi|170774839|gb|ACB32978.1| oxygen-independent coproporphyrinogen III oxidase [Leptothrix
           cholodnii SP-6]
          Length = 457

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 134/406 (33%), Positives = 208/406 (51%), Gaps = 34/406 (8%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHV-------------------------RRYKVGQENF 51
             L +Y+H P+C++KCPYCDFNSH                           R  + +  +
Sbjct: 58  PPLSLYIHLPWCLRKCPYCDFNSHEWAPETPAASSPRGGASGLGRPGAGQARGGIPEARY 117

Query: 52  IQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIE 111
           + +   +++    L   R I SIF GGGTPSL  P+ I  +L  +     +  + EIT+E
Sbjct: 118 LDALRADLEAALPLIWGRQILSIFIGGGTPSLFSPEGINRLLSDVRALLPLMPDCEITLE 177

Query: 112 ANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRM 171
           ANP + E   F+ +R AGVNR+S+GVQS  +  LR LGR H+  +A+AA   A + F   
Sbjct: 178 ANPGTFERERFRAFRGAGVNRLSIGVQSFNDDHLRALGRVHDRGQALAAAEEAADAFDTF 237

Query: 172 SFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENV 231
           + DL+YALP Q++ Q   +L+ AL+    HLS+Y LTIE  TLF         V P ++ 
Sbjct: 238 NLDLMYALPGQSLAQAGEDLRTALALQPPHLSVYHLTIEPNTLFAVRPP----VTPDDDA 293

Query: 232 AVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSH 291
           A ++ +    +T A GL  YE+S  +  G    HNLNYW++GDY+GIG GAHS++     
Sbjct: 294 ASEMLDQIVDLTGATGLERYEVSAFAKPGHRCAHNLNYWQFGDYLGIGAGAHSKLSFPHR 353

Query: 292 RVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
            +     + P +++           E E +  +    EF++  LRLREG +++ +    G
Sbjct: 354 VLRQVRWREPAAYMTQALAGQAVSNE-EEVGRKALPFEFMLNALRLREGFALELFRERTG 412

Query: 352 RNLD--IECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
             L       +  +++G I R  F+++R + RG   L+  +  L +
Sbjct: 413 LPLSSIEAALQQAEQRGLITR-DFAQMRPSARGFDFLND-LQELFL 456


>gi|77361524|ref|YP_341099.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76876435|emb|CAI87657.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 378

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 195/382 (51%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH ++ ++ +  ++Q  + +++    L   R I SIF 
Sbjct: 4   PPLSLYVHVPWCVQKCPYCDFNSHGQKGEIPEAEYVQHLIDDLKADLHLVQGRKIHSIFI 63

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+       +L  +     +  N EIT+EANP +VE   F+ Y KAG+NRIS+G
Sbjct: 64  GGGTPSLLTGAAYTRLLSEVKSLIGLEDNCEITLEANPGTVETGRFKDYVKAGINRISIG 123

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS++   L+ LGR H + EA  A   A+       + DL++ LP QT+     +L++ +
Sbjct: 124 VQSMQNDKLKALGRIHGSDEANYAAEQAKEAGLNSFNLDLMHGLPGQTLDDALGDLKQII 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    H+S YQLTIE  T F          LP +    D+    Q + +  G   YEIS 
Sbjct: 184 ALNPPHISWYQLTIEPNTQFASKPP----TLPQDETLWDIQEQGQELLAQAGYLQYEISG 239

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDYIGIG GAH +V   +  +    EK  +     +      +
Sbjct: 240 YAKPGYQCQHNLNYWRFGDYIGIGCGAHGKVTDANTGIITRTEKV-KHPRGYMDLIKPYL 298

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
            +   +  +  A EF M   RL E   + D+  L  + L       +   + G + +   
Sbjct: 299 FKSWQVEQDDLAFEFFMNRFRLVEPCPINDFNALTQQPLQSQQHALQQAIKTGLLIQTD- 357

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           S  + T +G   L+ ++  L V
Sbjct: 358 SHWQVTLKGQRFLNDLL-ELFV 378


>gi|302331204|gb|ADL21398.1| Coproporphyrinogen III oxidase [Corynebacterium pseudotuberculosis
           1002]
          Length = 384

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 121/391 (30%), Positives = 190/391 (48%), Gaps = 18/391 (4%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQL---- 65
            Q S   GVY+H PFC  +C YCDFN++           E+++ +   E+    Q+    
Sbjct: 2   SQKSTPFGVYIHVPFCSSRCGYCDFNTYTPGELGSSASPESYLNALEIELDLAAQIRASS 61

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R  S++F GGGTPS++    +  +L  +  +  ++   E+T E+NP S     F   
Sbjct: 62  GDTREASTVFVGGGTPSMLGAAGLDRVLLAVRSSTGIAPGAEVTTESNPESTSPEFFHSL 121

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRM-SFDLIYALPKQTM 184
            ++G  R+SLG+QS     L+ L R H    A AA   A        + D+IY  P +T 
Sbjct: 122 LESGFTRVSLGMQSASSSVLKVLERKHTPGRAFAAAKEALAAGFNHVNLDMIYGTPTETN 181

Query: 185 TQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS 244
                 L R +   VDH+S Y L +E GT   +  + G+L  P E+   D Y +      
Sbjct: 182 EDVRETLSRVVDTGVDHVSAYSLIVEDGTAMARKVRRGELPPPDEDTYADRYWMIDQALR 241

Query: 245 AHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESW 304
             G   YE+SN +  G E  HN+ YWR GD+ G GPGAHS +            KHP S+
Sbjct: 242 QEGFSWYEVSNWAREGGECQHNMGYWRDGDWWGAGPGAHSHIAQRR----FHNIKHPASY 297

Query: 305 LKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR 364
            K +      V E+E LS  ++ +E +M+GLRL+EG+S+ ++        +++      +
Sbjct: 298 SKALLAGELPVKEEETLSDVERHEEKVMLGLRLKEGVSIAEFSA-----GELDVIEPRVK 352

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           QG +  +   R+R T++   + D +IA++ V
Sbjct: 353 QGLL-HMNAGRVRLTEKSRLLADGIIADILV 382


>gi|291618776|ref|YP_003521518.1| YggW [Pantoea ananatis LMG 20103]
 gi|291153806|gb|ADD78390.1| YggW [Pantoea ananatis LMG 20103]
          Length = 379

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 205/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L +++    L   R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKDEVPHVEYVQHLLRDLEHDLPLIQGREVRTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    + +++DG+ +  T++++ E+T+EANP +VE + F  Y++AG+NRIS+G
Sbjct: 65  GGGTPSLLSSSAMQMLMDGVRERLTLTADAEVTMEANPGTVEADRFSAYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   Q L  LGR H   EA  A  LA+ +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSPQKLERLGRIHGPEEAKRAAVLAQGLGLRSFNLDLMHGLPDQSLAEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF          LP ++   D++     + +A G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFGSRPP----TLPDDDALWDIFEQGHQLLTAAGYEQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G    HNLNYWR+GDY+GIG GAH ++     R+  ++    +         G+ +
Sbjct: 241 YAKPGYRCEHNLNYWRFGDYLGIGCGAHGKLTQPDGRIVRTV----KVRHPRGFMKGNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQGFIERVQF 373
            ++  ++ E +  EF M   RL E     D+    G    L           G+I     
Sbjct: 297 DKQYDVADEDKPFEFFMNRFRLLEAAPRADFSRYTGLHETLIRPQLDEAIAAGYITE-SP 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T++G   L+S++  L +
Sbjct: 356 KHWQITEKGKLFLNSLL-ELFL 376


>gi|329296968|ref|ZP_08254304.1| HemN family oxidoreductase [Plautia stali symbiont]
          Length = 376

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 129/381 (33%), Positives = 206/381 (54%), Gaps = 13/381 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + +V    ++Q  L ++     L+  R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHGEYVQHLLNDLDQDLPLSAGREVRTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  ++DG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSSEAMQQLMDGVRARLPLAMDAEITMEANPGTVEADRFSGYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   Q L  LGR H   EA  A  LA  +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSPQKLTRLGRIHGPDEARRAAQLAAGLGLRSFNLDLMHGLPDQSLEEAPDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF         VLP ++   D++     + SA G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLSAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G    HNLNYWR+GDY+GIG GA+ ++     R+  ++    ++        G+ +
Sbjct: 241 YAKPGYRCEHNLNYWRFGDYLGIGCGAYGKLTQPDGRIVRTV----KTRHPRGFMKGNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERVQF 373
            ++  +  E +  EF M   RL E     D++   G +  +           G+++  Q 
Sbjct: 297 DKQHDVPDEDKPFEFFMNRFRLLEAAPRADFQRYTGLDEAVIRPQIDAAIAAGYVQE-QP 355

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
              + T++G   L+S++  L 
Sbjct: 356 EHWQITEKGKLFLNSLL-ELF 375


>gi|332162816|ref|YP_004299393.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667046|gb|ADZ43690.1| coproporphyrinogen III oxidase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 376

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 129/383 (33%), Positives = 205/383 (53%), Gaps = 15/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLDVDVPLVSGREISTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSAEAMQQLLDGVRARLPLAIDAEITMEANPGAVEADRFSGYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSAEKLTRLGRIHGPDEAKRAAELATSLELRSFNLDLMHGLPDQSLEEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  T F          LP ++   D++     + SA G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTGFSSRPP----TLPDDDALWDIFQQGHQLLSAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+        ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFRDGRILR----TIKTKHPRGFMQGKYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR---NLDIECERNLQRQGFIERVQ 372
            ++  + +  +  EF M   RL E     D+    G     +  + +  L ++  IE  +
Sbjct: 297 DKQYEVEAADRPFEFFMNRFRLLEAAPRADFTHFTGLAESTIRPQLDEALAKEYLIETEE 356

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
               + T++G   L+S++  L +
Sbjct: 357 --YWQITEKGKLFLNSLL-ELFL 376


>gi|318604343|emb|CBY25841.1| radical SAM family enzyme, similar to coproporphyrinogen III
           oxidase, oxygen-independent,clustered with
           nucleoside-triphosphatase RdgB [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 376

 Score =  248 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 129/383 (33%), Positives = 205/383 (53%), Gaps = 15/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + +++  L ++     L   R IS+IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHLLADLDVDVPLVSGREISTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSAEAMQQLLDGVRARLPLAIDAEITMEANPGAVEADRFSGYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSAEKLTRLGRIHGPYEAKRAAELATSLELRSFNLDLMHGLPDQSLEEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  T F          LP ++   D++     + SA G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTGFSSRPP----TLPDDDALWDIFQQGHQLLSAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+        ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFRDGRILR----TIKTKHPRGFMQGKYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR---NLDIECERNLQRQGFIERVQ 372
            ++  + +  +  EF M   RL E     D+    G     +  + +  L ++  IE  +
Sbjct: 297 DKQYEVEAADRPFEFFMNRFRLLEAAPRADFTHFTGLAESTIRPQLDEALAKEYLIETEE 356

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
               + T++G   L+S++  L +
Sbjct: 357 --YWQITEKGKLFLNSLL-ELFL 376


>gi|300723971|ref|YP_003713285.1| putative oxidase [Xenorhabdus nematophila ATCC 19061]
 gi|297630502|emb|CBJ91167.1| putative oxidase [Xenorhabdus nematophila ATCC 19061]
          Length = 376

 Score =  248 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 202/382 (52%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L +++    + G R +S IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLRADLPMIGDREVSMIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+  +  +S   EIT+EANP +VE + F  Y++AG+NRIS+G
Sbjct: 65  GGGTPSLLSAEGMQRLLDGVRDSLRLSPQAEITMEANPGTVEADRFNAYQQAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H   EA  A  LA  +  R  + DL++ LP QT+ +   +L++A+
Sbjct: 125 VQSFGSDKLIRLGRIHGPEEAKRAAKLADGLGLRSFNLDLMHGLPNQTLNEALNDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             +  HLS YQLTIE  T F         VLP ++   D+++    + +  G   YE S 
Sbjct: 185 ELSPPHLSWYQLTIEPNTRFGSRPP----VLPDDDALWDIFSQGHQLLTEAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  ++    ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKISFEDGRILRTV----KTKHPRGYMQGRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERVQF 373
            +K  +  + +  EF M   RL E +  +D+    G               +G+I     
Sbjct: 297 DQKNQVDHDDRPFEFFMNRFRLLESMPRQDFSDFTGLPGSAIRPQLDEALAKGYITEND- 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +  + T+ G   L+S++  L +
Sbjct: 356 THWQITKHGKLFLNSLL-ELFL 376


>gi|323436159|ref|ZP_01050978.2| oxygen-independent coproporphyrinogen III oxidase, putative
           [Dokdonia donghaensis MED134]
 gi|321496474|gb|EAQ38129.2| oxygen-independent coproporphyrinogen III oxidase, putative
           [Dokdonia donghaensis MED134]
          Length = 377

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 112/378 (29%), Positives = 187/378 (49%), Gaps = 9/378 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            +Y+H PFC + C YCDF  H       +E  I + ++E++  +       +S+++FGGG
Sbjct: 3   SIYIHIPFCKQACHYCDF--HFSTTMGKKEEMITAIISELEMRKAEFENDEVSNLYFGGG 60

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPS++  + I  I+D    ++ +  + EIT+EANP  +     +    + +NR+S+GVQS
Sbjct: 61  TPSVLNTEEIEQIIDACYTHYKIEKDPEITLEANPDDLTEQKIRELAASPINRLSIGVQS 120

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
             E+ L+ + R HNA EAI  + L R  FP  S DLIY +P  +  +WE  + + L+  +
Sbjct: 121 FYEEDLKLMNRAHNAQEAIDCLRLTRATFPNSSLDLIYGIPGMSNERWEQNIDKVLALDL 180

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H+S Y LT+E  T      K G +    + VA   + L      A G   YE SN +  
Sbjct: 181 PHISAYALTVEPKTALENFIKKGIVPPVEDEVAQQHHELLIRKMEAAGYENYEFSNFAKP 240

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
           G  S +N  YW+   YIGIGP AHS           +  K+ ++        G    E E
Sbjct: 241 GYHSRNNTAYWQGKKYIGIGPSAHSYDGKRRAWNINNNPKYIKAITA-----GELPQEVE 295

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR--QGFIERVQFSRLR 377
            LS   Q +E++M  LR + G+S+ + +   G         + Q+  +  +  ++  R+ 
Sbjct: 296 ELSLTDQYNEYVMTRLRTQYGVSLLEIKTQYGERFYNYFLEHAQKHIEEHLLFIEEDRVY 355

Query: 378 CTQRGMTMLDSVIANLAV 395
            +++G  + D + ++L +
Sbjct: 356 VSKKGKFLSDGIASDLFL 373


>gi|302551342|ref|ZP_07303684.1| coproporphyrinogen III oxidase [Streptomyces viridochromogenes DSM
           40736]
 gi|302468960|gb|EFL32053.1| coproporphyrinogen III oxidase [Streptomyces viridochromogenes DSM
           40736]
          Length = 429

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 120/399 (30%), Positives = 193/399 (48%), Gaps = 22/399 (5%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-------QENFIQSFLTEMQW 61
           + + G     LG Y+H P+C  +C YCDFN++      G       ++N+ ++ + E++ 
Sbjct: 39  SALAGAADRPLGFYLHVPYCATRCGYCDFNTYTATELRGTGGVLASRDNYAETLVEEVRL 98

Query: 62  MRQLTG--PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEV 119
            R++ G  PR + ++F GGGTP+L++  ++  +L  I   + ++ + E+T EANP SV  
Sbjct: 99  ARKVLGDDPRPVRTVFVGGGTPTLLDAGDLVRMLGAIRDEFGLAPDAEVTTEANPESVGP 158

Query: 120 NNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYA 178
                 R+ G NRIS G+QS  +  L+ L R H        +  AR   F  ++ DLIY 
Sbjct: 159 AYLAALREGGFNRISFGMQSARQHVLKVLDRTHTPGRPERCVAEARAAGFEHVNLDLIYG 218

Query: 179 LPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNL 238
            P ++   W   L+ AL    DH+S Y L +E+GT   +  + G++ +  ++V  D Y +
Sbjct: 219 TPGESDDDWRASLEAALGAGPDHVSAYALIVEEGTQLARRIRRGEVPMTDDDVHADRYLI 278

Query: 239 TQSITSAHGLHAYEISNHSF-LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISI 297
            + + SA G   YE+SN +       LHN  YWR  D+ G GPGAHS V           
Sbjct: 279 AEEMLSAAGFEWYEVSNWATSQAGRCLHNELYWRGADWWGAGPGAHSHVGGVR----WWN 334

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
            KHP ++   +         +E LS E +  E +++ LRLREG+ +            + 
Sbjct: 335 VKHPGAYAAALAAGRSPGAGREVLSEEDRRVERILLELRLREGVPLSLLREEG-----LA 389

Query: 358 CERNLQRQGFIER--VQFSRLRCTQRGMTMLDSVIANLA 394
             R    +G +E       R   T RG  + D V+ +L 
Sbjct: 390 ASRRALSEGLLETGPYAEGRAVLTLRGRLLADGVVRDLV 428


>gi|30022396|ref|NP_834027.1| coproporphyrinogen III oxidase [Bacillus cereus ATCC 14579]
 gi|218235720|ref|YP_002369126.1| coproporphyrinogen III oxidase [Bacillus cereus B4264]
 gi|228960585|ref|ZP_04122233.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|229129597|ref|ZP_04258566.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus BDRD-Cer4]
 gi|229152519|ref|ZP_04280710.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus m1550]
 gi|296504811|ref|YP_003666511.1| coproporphyrinogen III oxidase [Bacillus thuringiensis BMB171]
 gi|29897954|gb|AAP11228.1| Coproporphyrinogen oxidase, anaerobic [Bacillus cereus ATCC 14579]
 gi|218163677|gb|ACK63669.1| coproporphyrinogen dehydrogenase [Bacillus cereus B4264]
 gi|228630950|gb|EEK87588.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus m1550]
 gi|228653865|gb|EEL09734.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           cereus BDRD-Cer4]
 gi|228799098|gb|EEM46067.1| Oxygen-independent coproporphyrinogen III oxidase 1 [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|296325863|gb|ADH08791.1| coproporphyrinogen III oxidase [Bacillus thuringiensis BMB171]
          Length = 379

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 113/379 (29%), Positives = 181/379 (47%), Gaps = 11/379 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN      +   + ++     E+    Q     S+ +IF GGGTP
Sbjct: 6   YIHIPFCQHICHYCDFNKVFIERQ-PVDQYLDYLEKEIINTVQKVPFDSMKTIFVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKN-WTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           + +  +    +L+ I ++    + N E+T EANP  +         + GVNRIS GVQ+ 
Sbjct: 65  TALNMEQTKKLLEIINRHLRPFAPNCELTFEANPGDLPKEKLNVLLEGGVNRISFGVQTF 124

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAV 199
            ++ L  +GR H   +A  AI  A+ +    ++ D+IYALP QT+   +  L  A +  V
Sbjct: 125 RDELLEKIGRKHTREDAFLAIREAQEVGFKNINVDIIYALPGQTIEDVKETLDIAFTLGV 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
            H S Y L +E  T+FY +   G L LP E+    +Y +       HG + YEISN S  
Sbjct: 185 QHFSAYSLIVEPKTVFYNLMNKGKLRLPGEDHEAKMYEIVMDEMEKHGYNQYEISNFSKG 244

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             +S HNL YW   +Y G G GAHS V        I      + +   + + G   ++  
Sbjct: 245 DNKSRHNLTYWNNEEYYGFGAGAHSYVNGER----IQNVGPLKQYFNKIDETGFPYLDVH 300

Query: 320 FLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNL---QRQGFIERVQFSRL 376
            ++ +++ +E L +GLR  +G+S   +       +D    + L   Q QG +E  +   +
Sbjct: 301 KVTEKERMEEELFLGLRKTKGVSKTAFRNKFNVEMDQVFAKQLQSNQEQGLLEE-EDGHV 359

Query: 377 RCTQRGMTMLDSVIANLAV 395
           R T++G  + + V  +  +
Sbjct: 360 RLTRKGKLLGNEVFQSFLI 378


>gi|307709061|ref|ZP_07645520.1| coproporphyrinogen III oxidase [Streptococcus mitis SK564]
 gi|307620007|gb|EFN99124.1| coproporphyrinogen III oxidase [Streptococcus mitis SK564]
          Length = 376

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 120/384 (31%), Positives = 205/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   + +++  L E +        + + +++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDIYLEHLLEEFRSY----DIQKLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L G+ KN  +S+  E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSASQLEVLLKGLTKNLDLSALEELTIEANPGDLDADKIAVLKNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLVKDIYENIDRLKLAGFDNISIDLIYALPGQTMEQVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 IGLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAALERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +  +     G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLSAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + +E LS ++Q +E + +GLR + G+S+  +E   GR+ D    E  ++L +QG + ++
Sbjct: 293 RITEEHLSQKEQMEEEMFLGLRKKSGVSMVRFEEKFGRSFDGLYGEIVKDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           +  R+R T+RG+ + D+V     +
Sbjct: 352 EGDRVRMTKRGLFLGDTVAERFIL 375


>gi|257453736|ref|ZP_05619017.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enhydrobacter aerosaccus SK60]
 gi|257448828|gb|EEV23790.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enhydrobacter aerosaccus SK60]
          Length = 382

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 134/382 (35%), Positives = 200/382 (52%), Gaps = 15/382 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
            L +Y+H P+CVKKCPYCDFNSH  R  +    ++ + L +++        R IS+IF G
Sbjct: 8   PLSLYIHIPWCVKKCPYCDFNSHESRTPIDFVGYVDALLDDLKSQLSFVQGRKISTIFIG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+       +  GI    T++ + EIT+EANP++VE   F  Y   G+NR+SLGV
Sbjct: 68  GGTPSLLPIAQYQQLFAGINAQLTLTEDCEITMEANPATVEHAPFHEYLAVGINRLSLGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAA-IHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           QS + Q L  LGR HN  +A+ A  +  +  F +++ DL++ LP QT+T    +LQ+A+ 
Sbjct: 128 QSFQAQKLAALGRIHNPQQALFAIQNAQQAGFKKLNVDLMHGLPNQTLTDALSDLQQAID 187

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V H+S YQLTIE  T+FY        +LP + + VD++     +  A+G   YE+S  
Sbjct: 188 LGVSHISWYQLTIEPNTVFY----RNTPILPDDEILVDIFEQGAELLQANGFVQYEVSAW 243

Query: 257 SFL--GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           S       S HNLNYW++GDY+ IG GAH +V         S  + P+ +       G  
Sbjct: 244 SRQADFQPSQHNLNYWQFGDYLAIGAGAHGKVTRPDGIYRFSKSRLPKDYRVNQAAIGWQ 303

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQGFIERVQ 372
            +E           EF+M GLRL+ G+  + W    G   ++       L  +G +E + 
Sbjct: 304 AIE-----PSDLPFEFMMNGLRLKNGVPKQFWTQRTGLAWSVIEPQLIQLHNRGLVE-LS 357

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
              + CT +G   L+ V+    
Sbjct: 358 GDHIHCTAQGFLFLNQVLQEFL 379


>gi|182438782|ref|YP_001826501.1| coproporphyrinogen III oxidase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178467298|dbj|BAG21818.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 410

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 118/398 (29%), Positives = 191/398 (47%), Gaps = 22/398 (5%)

Query: 10  NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-------QENFIQSFLTEMQWM 62
            + G     LG Y+H P+C  +C YCDFN++      G       ++N+    + E++  
Sbjct: 21  ALEGAADRPLGFYLHVPYCATRCGYCDFNTYTATELRGSGGALASRDNYAAHLIEEVRQA 80

Query: 63  RQLTG--PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           R++ G  PR + ++F GGGTP+L+   ++  +L  I + + ++ + EIT EANP SV+  
Sbjct: 81  RKVLGDDPRPVRTVFVGGGTPTLLPAADLVRMLAAIREEFGLADDAEITTEANPESVDPA 140

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYAL 179
                R+ G NR+S G+QS  +  L+ L R H      A +  AR   F  ++ DLIY  
Sbjct: 141 YLTALREGGFNRVSFGMQSARQHVLKILDRTHTPGRPEACVAEARAAGFDHVNLDLIYGT 200

Query: 180 PKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLT 239
           P ++   W   L  A+    DH+S Y L +E+GT   +  + G++ +  ++   D Y + 
Sbjct: 201 PGESDDDWRATLDAAIGAGPDHVSAYALIVEEGTQLARRIRRGEIPMTDDDAHADRYLIA 260

Query: 240 QSITSAHGLHAYEISNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE 298
               +A G H YE+SN +       LHN  YWR  D+ G GPGAHS V            
Sbjct: 261 DEAFAAAGFHWYEVSNWATTEAGRCLHNELYWRGADWWGAGPGAHSHVGGVR----WWNV 316

Query: 299 KHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC 358
           KHP ++ + + +       +E L+ E +  E +++ LRLREG  +   +        +  
Sbjct: 317 KHPGAYAQALAEGRSPGAGREILAEEDRRVERILLELRLREGCPLDLLK-----PDGLAA 371

Query: 359 ERNLQRQGFI--ERVQFSRLRCTQRGMTMLDSVIANLA 394
            R     G +  E     R   T RG  + D+V+ +L 
Sbjct: 372 SRRALADGLLAPEPYDRGRAVLTLRGRLLADAVVRDLV 409


>gi|294139808|ref|YP_003555786.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           violacea DSS12]
 gi|293326277|dbj|BAJ01008.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Shewanella violacea DSS12]
          Length = 378

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 197/380 (51%), Gaps = 10/380 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L +++        R I +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQEYVDALLADLRNDLHYVQEREIHTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  +L G+ +    S  +EIT+EANP ++E ++F+ Y  AGV R+S+G
Sbjct: 65  GGGTPSLFDAAQIERLLTGVNQMIPFSEQIEITMEANPGTLEHDDFEAYSNAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H   EA  A   A++   R  + DL++ LP Q+  +   ++  A 
Sbjct: 125 VQSFSTDKLNLLGRIHGKDEAEVAARKAQSSGYRSFNLDLMHGLPNQSFEEAMADIDTAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  HLS YQLTIE+ TLF+         LP +     +Y   Q   +  G   YEIS 
Sbjct: 185 ELAPPHLSWYQLTIEQNTLFHSKPPQ----LPDDEALWHIYEQGQKKLADLGYEQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HN+NYW++GDY+GIG GAH +V +   +  I      +     +  + +  
Sbjct: 241 YAKPGFQCQHNINYWQFGDYLGIGCGAHGKVTLLE-QNQILRTVKIKHPKGYLAADEYTF 299

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERVQF 373
              E ++ +++  E+LM   RL   I   ++E   G +  +  +     +++  +   + 
Sbjct: 300 DTVE-VTEDERPLEYLMNRFRLMSAIPKTEFEQRTGLSHRVIAQGIEKAKQKTLLTENE- 357

Query: 374 SRLRCTQRGMTMLDSVIANL 393
           +    T +G   ++ +++  
Sbjct: 358 THWELTAKGKMFVNELLSQF 377


>gi|299822877|ref|ZP_07054763.1| coproporphyrinogen dehydrogenase [Listeria grayi DSM 20601]
 gi|299816406|gb|EFI83644.1| coproporphyrinogen dehydrogenase [Listeria grayi DSM 20601]
          Length = 375

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 106/379 (27%), Positives = 182/379 (48%), Gaps = 10/379 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
            VY+H PFC   C YCDFN          + ++   + EM+ +        I ++F GGG
Sbjct: 3   SVYIHIPFCEHICYYCDFNKVFL-EGQPVDRYVDLLIREMEMVTGKQELEPIDTVFVGGG 61

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + +A +   I +   +  N E + EANP  + +   Q  +  GVNRIS+GVQS
Sbjct: 62  TPTTLNEKQLARLCTAIHRLLPLRENAEFSFEANPGDLSLEKIQVLKDHGVNRISMGVQS 121

Query: 140 LEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
              + L+ +GR H   +      +L +     +S DLI++LP QT   ++  L +AL   
Sbjct: 122 FNNELLKKIGRIHTTKDVYQSVDNLRKIGLDNVSIDLIFSLPTQTFADFKDTLTQALDLD 181

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H S Y L IE  T+FY + + G L+LP + +  ++Y+   +    HG   YEISN + 
Sbjct: 182 LPHYSAYSLIIEPKTIFYNLMQKGQLILPKQEIEANMYDTLMNEMEKHGRRQYEISNFAK 241

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HN+ YW    Y G G GAH  +    +          + +++ +      V + 
Sbjct: 242 PGFESRHNIVYWSNEHYYGFGAGAHGYLGEQRYSNFG----PIKKYMEPLENGELPVFQS 297

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQFSR 375
             L  +++ +E + +GLR  +G+S   +    G+NL+      +++   +G +   +  R
Sbjct: 298 RVLPLQEKMEEEMFLGLRKVDGVSKAHFLQKFGQNLNDVFPHAIEKTLAEGLLYENE-ER 356

Query: 376 LRCTQRGMTMLDSVIANLA 394
           +  T+ G  + ++V     
Sbjct: 357 IALTRDGRFLGNNVFQEFI 375


>gi|307288258|ref|ZP_07568256.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0109]
 gi|306500774|gb|EFM70094.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX0109]
 gi|315164176|gb|EFU08193.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecalis TX1302]
          Length = 382

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 118/380 (31%), Positives = 192/380 (50%), Gaps = 10/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN          + +IQS L E+Q  + L   + + +I+ GGG
Sbjct: 5   SAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYIQSLLKEIQLTQALYPEQEMKTIYIGGG 63

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + + ++L G+ +  T     E T+EANP  +     Q  +  GVNR+S+GVQ+
Sbjct: 64  TPTSLSAKQLDVLLKGVREQLTFDDRNEFTVEANPGDLTQEKLQVMKNYGVNRLSMGVQT 123

Query: 140 LEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
            +++ L+ +GR H A++       L +  F  +S DLIYALP QT+  +   L RAL+  
Sbjct: 124 FDDRLLKKIGRKHTAADVYETMKFLEKENFTNVSIDLIYALPGQTLESFRDTLTRALALD 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           + H SLY L +E  T+F    + G L LP E +   +++ T       G H YE+SN + 
Sbjct: 184 LPHYSLYSLILENKTMFMNWVRQGRLQLPEEEIEAQMFDETIEAMDKKGRHQYEVSNFAL 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G ES HNL YW    Y G G GA   +    ++    I+ + +   +    N   +VE 
Sbjct: 244 TGKESQHNLAYWNNDHYYGFGAGASGYLGQTRYKNHGPIQHYLKPLRE----NQLPIVET 299

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIERVQFSR 375
           E L+   Q +E L +GLR + GIS + ++      ++    E  + L ++  +   +   
Sbjct: 300 EELTRLNQIEEELFLGLRKKVGISKQKFQHKFQEPIEAIYGEVIQRLIKEELLIE-EADI 358

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           LR T++G+ + ++V     +
Sbjct: 359 LRLTKKGLFVGNNVFEAFLL 378


>gi|332284448|ref|YP_004416359.1| coproporphyrinogen III oxidase [Pusillimonas sp. T7-7]
 gi|330428401|gb|AEC19735.1| coproporphyrinogen III oxidase [Pusillimonas sp. T7-7]
          Length = 416

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 131/381 (34%), Positives = 213/381 (55%), Gaps = 8/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH    ++ +++++ +   +++    L   R + SIF 
Sbjct: 40  PPLSLYVHVPWCVRKCPYCDFNSHELGAELPEQDYLTALQADLEQALPLIWGRQVVSIFI 99

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  Q +  +L        +  + EIT+EANP +VE   F  Y  +GVNRISLG
Sbjct: 100 GGGTPSLLSGQALDQMLAMFRACLNLLPDAEITLEANPGTVEAGRFADYAASGVNRISLG 159

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS + ++L  LGR H+A +A AA+ +A+ +  R++ D++YALP Q++     +L +A+S
Sbjct: 160 IQSFDNRALEALGRIHDAEQARAAVEIAQKVVDRVNLDIMYALPGQSIDDCAQDLHQAMS 219

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLY LT+E  T+F K        +P ++ +  + +L    T+A G   YE+S +
Sbjct: 220 FQTGHLSLYHLTLEPNTVFAKYPP----TVPDDDTSAAMQDLIADATAAGGWERYEVSAY 275

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWL-KMVRKNGHAV 315
           +  G    HNLNYW +GDY+GIGPGAH ++      V  +  K+P SW+ K + ++G  +
Sbjct: 276 ARSGQRCRHNLNYWEFGDYLGIGPGAHGKLSFHDKIVRQAKLKNPSSWMKKAMLRDGSHL 335

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            E   +  +    EF++  LRL+ G+    +    G+++            +G +E    
Sbjct: 336 AEDRQVDWKDLGFEFMLNVLRLKHGVPRSSYIERTGQSILAIAPALERAVARGLLEP-GH 394

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
            RL+ T+ G   L+ + A   
Sbjct: 395 ERLQATEHGWQFLNDLQAEFL 415


>gi|172056816|ref|YP_001813276.1| coproporphyrinogen III oxidase [Exiguobacterium sibiricum 255-15]
 gi|171989337|gb|ACB60259.1| oxygen-independent coproporphyrinogen III oxidase [Exiguobacterium
           sibiricum 255-15]
          Length = 381

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 118/383 (30%), Positives = 188/383 (49%), Gaps = 14/383 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
                YVH PFC   C YCDFN    + +     ++ +   E++   Q      + +IF 
Sbjct: 2   TPRAAYVHIPFCEHICYYCDFNKVFLKNQ-PVAEYLDALEREIELTLQHYPTDRLETIFI 60

Query: 77  GGGTPSLIEPQNIALILDGIAKN--WTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           GGGTP+ +    +  ++D I+K+      + +E T+E+NP  V        +  GVNR+S
Sbjct: 61  GGGTPTALNEAQMQRLMDIISKHLLPLTDATLEYTVESNPDGVSPEKLDIMKAGGVNRVS 120

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
            GVQS ++  L  +GR H  ++    +  A   F  +S DL++ LP QT+ Q   +++RA
Sbjct: 121 FGVQSFDDGLLERIGRTHREAKVAETLDHAAKRFDNISVDLMFGLPNQTLEQVRYDVKRA 180

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           L   + H+S Y L +E  T+F    + G L LP++++  D+Y L      A GLH YEIS
Sbjct: 181 LHLPITHISSYSLILEPHTVFAIQERKGKLPLPTQDLEADMYRLMIETIEAGGLHQYEIS 240

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HN  YW   +Y G G G+HS +          I  + ++        G  
Sbjct: 241 NFSLPGRESRHNRVYWENDEYYGFGAGSHSYINKTRRANIAPIPHYIKAE-------GLP 293

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERV 371
           V  +  L+  ++ +E + +GLR++EG+S + +E   G +LD         L  +G +ER 
Sbjct: 294 VRNETPLTEVERMEEEMFLGLRMKEGVSERHFEEKYGHSLDRVFGQTIAKLLPRGLVERT 353

Query: 372 QFSRLRCTQRGMTMLDSVIANLA 394
             + LR T  G+ + + V A   
Sbjct: 354 -ATHLRLTDAGVPLANEVFAEFI 375


>gi|293374233|ref|ZP_06620561.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Turicibacter sanguinis PC909]
 gi|292647066|gb|EFF65048.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Turicibacter sanguinis PC909]
          Length = 378

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 115/380 (30%), Positives = 197/380 (51%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
           G+Y+H PFC   C YCDF   + + +     +I++ + E++  +Q  G  ++ SI+ GGG
Sbjct: 4   GLYIHIPFCDHICTYCDFPKLLTKGQR-HAEYIEALIQELKLYQQNVGFSNLQSIYIGGG 62

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TP+ +  + I  + D + +   ++   E +IEANP ++  +  Q  +  GVNR SLGVQ+
Sbjct: 63  TPTALSVEQIQPLFDFLTEQIQMNQIQEFSIEANPENLTRDKIQYLKAQGVNRFSLGVQT 122

Query: 140 LEEQSLRFLGRNHNASEAIAAI-HLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
             E  L+ +GR H A E I A+ +L +     ++ DLIYA+P QT+ +   +L++ +S  
Sbjct: 123 FHESLLKRIGRKHQAQEVIQAVANLKQCGIKNINLDLIYAIPGQTLDELRDDLRQVISLE 182

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
           V+H+S Y L +E+ T  Y  +    + L    +   +Y +T    +  G   YEISN + 
Sbjct: 183 VEHISAYSLIVEEHTQLYLAYMRDQIELTDNEIEAKMYEVTIETLTEAGYEHYEISNFAK 242

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
               SLHN  YW+   YIG+G GAH  VK   ++   SI  + E            ++E 
Sbjct: 243 SKP-SLHNQWYWKNETYIGVGLGAHGYVKGQRYQNTRSINTYIELLKD----GKLPMIES 297

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFSR 375
             L+ E+  +E + +GLRL +G+++K        N+D         L ++G++E+ + + 
Sbjct: 298 HALTKEEMIEEEMFLGLRLLKGVNLKAISDKYDVNIDEIYGKAFEELIQKGYLEQKELN- 356

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           +R T  G+ M + V     +
Sbjct: 357 VRLTPSGLLMANEVFEQFLL 376


>gi|114762201|ref|ZP_01441669.1| coproporphyrinogen III oxidase [Pelagibaca bermudensis HTCC2601]
 gi|114545225|gb|EAU48228.1| coproporphyrinogen III oxidase [Roseovarius sp. HTCC2601]
          Length = 383

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 173/378 (45%), Positives = 233/378 (61%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+YVHWPFC  KCPYCDFNSHV    V Q  +  + ++E+    + T  R + SI+FG
Sbjct: 9   GFGLYVHWPFCEAKCPYCDFNSHVV-SHVDQTRWAAALVSELARYGRQTEGRVLRSIYFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL+ P+ +  +LD    +W  ++++EIT+EANP SVE+N F+G+  AGVNR+SLGV
Sbjct: 68  GGTPSLMAPETVRAVLDASRDHWAWANDIEITLEANPRSVEINKFEGFAMAGVNRVSLGV 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L    LR LGR H+  +A+ A+ +A++ F R++FDLIY    Q+++ WE+EL+ AL  
Sbjct: 128 QALRPDDLRRLGRLHDVDDAVRALEIAKSTFNRVNFDLIYGRQGQSLSDWEVELREALDL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           A DHLSLYQLTIE+GT F+   + G L   PSE++  DLY  TQ I  A G  AYE+SNH
Sbjct: 188 AADHLSLYQLTIEEGTAFWDRAQAGKLRDLPSEDLGADLYLATQEICEAAGKPAYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           S  G ES HNL YWR GDY+GIGPGAH RV V   R A    + P  W+K       A  
Sbjct: 248 SGEGDESRHNLVYWRGGDYVGIGPGAHGRVTVNGQRSATVARRAPGDWIKAAEAG-SADQ 306

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
           E E L  +    E+LMMGLRL EG+ ++   M+  +         L   G I R +  R 
Sbjct: 307 EVESLMLQDVWAEYLMMGLRLSEGLDLERARMIDPKRTAALSLDPLVELGLIWRNEA-RF 365

Query: 377 RCTQRGMTMLDSVIANLA 394
             TQ+G  +L+++ A L 
Sbjct: 366 GATQQGRMLLNTLTAELL 383


>gi|220905467|ref|YP_002480779.1| oxygen-independent coproporphyrinogen III oxidase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219869766|gb|ACL50101.1| oxygen-independent coproporphyrinogen III oxidase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 484

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 127/389 (32%), Positives = 204/389 (52%), Gaps = 17/389 (4%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG------QENFIQSFLTEMQWMRQLTGPRS 70
           N + VY+H PFC  +C YC F S      V         +++ +   E+       G   
Sbjct: 13  NPMLVYIHVPFCSTRCRYCAFYSSPLGRGVDPVSSPAVRDYVDTLFMELAHWGDRLGGSP 72

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEV-NNFQGYRKAG 129
           + ++FFGGGTPSL+ P+ IAL+++ + + +T+    E+T+EANP S+   +    Y +AG
Sbjct: 73  VQTVFFGGGTPSLLPPRVIALVMERLGRYFTLVPKAEVTLEANPESLRGGHRVAQYLEAG 132

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWE 188
           VNR+S+G+QSL+E  LR LGR H A +++ A  LAR      ++ DL++ LP Q++ QW 
Sbjct: 133 VNRLSIGIQSLDEGMLRMLGRPHKAQDSLHAAFLAREAGCANINVDLMWGLPGQSVRQWL 192

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL 248
             L+  +  + DH+S Y LT+E GT      ++G L+LP E     ++    ++   HG 
Sbjct: 193 QTLKDVMRMSPDHISAYGLTLEPGTPLELDVEEGRLMLPPERDQNIMFMEGAALLEQHGY 252

Query: 249 HAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMV 308
             YEISN + +G +  HNL YW   DY+G+GP A S +         S     +    + 
Sbjct: 253 LHYEISNFARMGFQCRHNLGYWEGEDYLGLGPSATSTIGGRRWTNPAS-----QKAWDVR 307

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL---DIECERNLQRQ 365
            + G    + E L+ + +  E LM+ LR   G+ VK +  + GR+         + L   
Sbjct: 308 TREGSLGQDVEELTPQTRVLELLMLRLRTTRGLRVKAYREMTGRDFVRDHQRLVQALHEN 367

Query: 366 GFIERVQFSRLRCTQRGMTMLDSVIANLA 394
           G I R++   LR T+ GM + +S+++NL 
Sbjct: 368 GLI-RIRNGYLRLTRSGMLVSNSILSNLF 395


>gi|332535501|ref|ZP_08411279.1| radical SAM family enzyme [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035078|gb|EGI71594.1| radical SAM family enzyme [Pseudoalteromonas haloplanktis ANT/505]
          Length = 378

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 194/382 (50%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH ++ ++ +  ++Q  + +++    L   R I SIF 
Sbjct: 4   PPLSLYVHVPWCVQKCPYCDFNSHGQKGEIPEAEYVQHLIDDLKADLHLVQGRKIHSIFI 63

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+       +L+ +     +  + EIT+EANP +VE   F+ Y KAG+NRIS+G
Sbjct: 64  GGGTPSLLTGAAYTRLLNEVDNLIGLEEHCEITLEANPGTVETGRFKDYVKAGINRISIG 123

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS++   L+ LGR H + EA  A   A+       + DL++ LP QT+     +L++ +
Sbjct: 124 VQSMQNDKLKALGRIHGSDEANYAAQQAKEAGLNSFNLDLMHGLPGQTLDDALSDLKQII 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    H+S YQLTIE  T F          LP +    D+      + +  G   YEIS 
Sbjct: 184 ALDPPHISWYQLTIEPNTQFASKPP----TLPQDETLWDIQEQGVELLAQAGYVQYEISG 239

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH +V   +  +    EK  +     +      +
Sbjct: 240 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTDANTGLITRTEKV-KHPRGYMDLIKPYM 298

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERNLQRQGFIERVQF 373
            +   +  +  A EF M   RL E   + D+  L    L  +         +G + +   
Sbjct: 299 YKSWHVEQDDLAFEFFMNRFRLVEPCPINDFNKLTTLPLQSQQSALNQAINKGLLTQTD- 357

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           S  + T +G   L+ ++  L V
Sbjct: 358 SHWQVTLKGHRFLNDLL-ELFV 378


>gi|288905645|ref|YP_003430867.1| coproporphyrinogen III oxidase [Streptococcus gallolyticus UCN34]
 gi|288732371|emb|CBI13943.1| putative coproporphyrinogen III oxidase [Streptococcus gallolyticus
           UCN34]
          Length = 376

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/384 (30%), Positives = 204/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++Q+ + E +        + + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLQALIREFESY----DIKQLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  Q +  +L  + K+  +S   E TIEANP  +  +  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTSITAQQLDYLLTNLTKHLDLSVLEEFTIEANPGDLTDDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+  ++ L+ +GR+HN ++      HL    F  +S DLIYALP QTM   +  + +A
Sbjct: 118 GVQTFNDKQLKRIGRSHNEAQIYSTIDHLKTAGFDNISIDLIYALPGQTMEDVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           ++  + HLSLY L +E  T+F    + G L LP E++  +++    +   A+G   YEIS
Sbjct: 178 IALDIPHLSLYSLILEHHTVFMNKMRRGKLNLPQEDLEAEMFEYIIAELEANGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   +    +R    I+ + ++  +     G+A
Sbjct: 238 NFTKPGFESRHNLMYWDNAEYYGVGAGASGYLNGVRYRNRGPIQHYLKAVSE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER---NLQRQGFIERV 371
            + +E L+ ++  +E L +GLR + G+S+  +E   G + +    +    L +QG +   
Sbjct: 293 RLSEEVLTKDEMMEEELFLGLRKKSGVSIAKFEEKFGVSFEERYGQIVIELCQQGLLVP- 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T++G+ + D+V     +
Sbjct: 352 DDKVVRMTKKGLFLGDTVAERFIL 375


>gi|297199599|ref|ZP_06916996.1| coproporphyrinogen III oxidase [Streptomyces sviceus ATCC 29083]
 gi|197713473|gb|EDY57507.1| coproporphyrinogen III oxidase [Streptomyces sviceus ATCC 29083]
          Length = 420

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/399 (29%), Positives = 194/399 (48%), Gaps = 22/399 (5%)

Query: 9   NNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVG-------QENFIQSFLTEMQW 61
           + + G     LG Y+H P+C  +C YCDFN++      G       ++N+ ++ + E++ 
Sbjct: 30  SALAGSADRPLGFYLHVPYCATRCGYCDFNTYTATELRGSGGVLASRDNYAETLIDEIRL 89

Query: 62  MRQLTG--PRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEV 119
            R++ G  PR + ++F GGGTP+L+   ++  +L  I   + ++++ E+T EANP SV+ 
Sbjct: 90  ARKVLGDDPRPVRTVFVGGGTPTLLAAGDLVRMLGAIRDEFGLAADAEVTTEANPESVDP 149

Query: 120 NNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYA 178
                 R+ G NR+S G+QS  +  L+ L R H      A +  AR      ++ DLIY 
Sbjct: 150 EYLAALREGGFNRVSFGMQSARQHVLKVLDRTHTPGRPEACVAEARAAGFAHVNLDLIYG 209

Query: 179 LPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNL 238
            P ++   W   L+ A+    DH+S Y L +E+GT   +  + G++ +  ++   D Y +
Sbjct: 210 TPGESDDDWRASLEAAIGAGPDHVSAYALIVEEGTQLARRIRRGEVPMTDDDEHADRYLI 269

Query: 239 TQSITSAHGLHAYEISNHSFLG-AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISI 297
             S+ +  G   YE+SN +    A  LHN  YWR  D+ G GPGAHS V           
Sbjct: 270 ADSMLAEAGFDWYEVSNWATSEAARCLHNELYWRGADWWGAGPGAHSHVGGVR----WWN 325

Query: 298 EKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE 357
            KHP ++   +         +E L  E +  E +++ LRLREG+ +            + 
Sbjct: 326 VKHPGAYAAALASGRSPGAGRELLPEEDRRVERILLELRLREGVPLSLLREEG-----LA 380

Query: 358 CERNLQRQGFIE--RVQFSRLRCTQRGMTMLDSVIANLA 394
             R    +G +E    +  R   T RG  + D+V+ +L 
Sbjct: 381 ASRRALGEGLLEGGPYEEGRAVLTLRGRLLADAVVRDLV 419


>gi|158320265|ref|YP_001512772.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alkaliphilus oremlandii OhILAs]
 gi|158140464|gb|ABW18776.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Alkaliphilus oremlandii OhILAs]
          Length = 379

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/383 (30%), Positives = 212/383 (55%), Gaps = 10/383 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           NS+ +Y+H PFC KKC YCDFNS+  +  +  + +I++   EMQ   ++    S++++FF
Sbjct: 2   NSIALYIHIPFCEKKCHYCDFNSYSGKNHL-VDGYIKALKKEMQQYGEIIKGHSVATVFF 60

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPS++  + +A I++ + + +T+    EI++EANP ++  +  + Y K+G+NR+S+G
Sbjct: 61  GGGTPSILTGEQMAEIMETLRRYYTLEEQAEISMEANPGTLNFHKLKAYYKSGINRLSMG 120

Query: 137 VQSLEEQSLRFLGRNHNASEA-IAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +   L+ LGR H+  E         +  F  ++ DL+++LP QT   W+  L++ +
Sbjct: 121 LQSCQNHLLKTLGRIHSFEEYVKNLEDARKAGFTNINTDLMFSLPGQTERDWQESLEKIV 180

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S  + H+S Y L +E+GT F+   ++  ++LP E V +++Y+ T     + G H YEISN
Sbjct: 181 SLGIPHISAYSLIVEEGTPFFSWVENKKIILPDEEVDMNMYHYTIEYLKSRGYHHYEISN 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G E  HN+ YW    YIG+G GAHS           +     + ++ ++ +    V
Sbjct: 241 YAKNGFECKHNITYWHNEHYIGLGAGAHSYFDQKR----FNNFADIDKYIHLLGEGSSPV 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG---RNLDIECERNLQRQGFIERVQ 372
            E+  +S   +  E + +GLR+ EGIS+  +          +  +    L++QG I+  +
Sbjct: 297 EEEILVSKNDEIAETMFLGLRMMEGISIDGFFKRFHTTPLAIYEDTLEKLRKQGLIQWDE 356

Query: 373 FSRLRCTQRGMTMLDSVIANLAV 395
              +  T +G+ + + V   + +
Sbjct: 357 KG-IWLTSKGIDLSNVVFEKMLL 378


>gi|213971467|ref|ZP_03399579.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           syringae pv. tomato T1]
 gi|301383506|ref|ZP_07231924.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061939|ref|ZP_07253480.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           K40]
 gi|302134686|ref|ZP_07260676.1| coproporphyrinogen III oxidase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213923749|gb|EEB57332.1| oxygen-independent coproporphyrinogen III oxidase [Pseudomonas
           syringae pv. tomato T1]
          Length = 404

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 201/382 (52%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH     + ++ ++ + L ++         R + SIFF
Sbjct: 30  PPLSLYIHIPWCVRKCPYCDFNSHTASPVLPEQEYVDALLADLDLDLPHVYGRELQSIFF 89

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     +  +L G+ +    +S++EIT+EANP + E   F  YR  G+NR+S+G
Sbjct: 90  GGGTPSLFSANALGRLLRGVEQRIRFASDIEITLEANPGTFEQAKFSAYRGLGINRLSIG 149

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS +   L+ LGR HN  EAI A  +AR   F   + DL++ LP Q+  +   +L++A+
Sbjct: 150 IQSFQASKLKALGRIHNGDEAIRAADMARQAGFDNFNLDLMHGLPDQSQDEALDDLRQAI 209

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + A  HLS YQLT+E  T+F+        VLP +++  D+    Q + +  G   YE+S 
Sbjct: 210 ALAPTHLSWYQLTLEPNTVFWNQPP----VLPEDDILWDIQETGQQLLATQGYAQYEVSA 265

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G  + HNLNYW +GD+IGIG GAH ++     R+              +  +    
Sbjct: 266 YAQPGKPARHNLNYWAFGDFIGIGAGAHGKLSHPDGRIIR--TWKTRLPKDYLNPDKPFQ 323

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE--CERNLQRQGFIERVQF 373
              + L  ++   EFLM  LRL  G+    +    G +LD      R  +++G +   Q 
Sbjct: 324 AGSKLLPLDELPFEFLMNALRLTNGVDAALFRERTGLSLDSLAGARRQAEQKGLLHEDQA 383

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
            RL  T +G   L+ ++    +
Sbjct: 384 -RLIATPQGQLFLNDLLQYFLI 404


>gi|307266438|ref|ZP_07547974.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918546|gb|EFN48784.1| oxygen-independent coproporphyrinogen III oxidase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 375

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 117/381 (30%), Positives = 205/381 (53%), Gaps = 11/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             +G+Y+H PFC +KC YCDFNS+   Y    +++I++ L E++     T   ++ S++ 
Sbjct: 2   REIGLYIHIPFCKRKCYYCDFNSYA-GYDYLFDDYIRALLMEIE--SNSTKDYNVVSVYI 58

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+L+ P  I  IL  + KN+ +    EITIE NP  +     + Y+  G+NR+S+G
Sbjct: 59  GGGTPNLLPPSYIEKILKSVFKNYKILDGCEITIEMNPGLITEEKLKIYKDNGINRVSIG 118

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+ + + L+++GR H   +      L +  F  ++ DL+YALP QT  +W+  L+  + 
Sbjct: 119 LQAFQNRLLKYIGRIHTIEDFFENYELVKKFFGNINIDLMYALPTQTFKEWQETLKEVVK 178

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               H+S Y L +E  T FY++++ G L +  E   + +Y+         G H YEISN 
Sbjct: 179 LQPTHVSTYSLILEPNTSFYRLYEKGQLPIVDEEEELKMYHWGIEFLKEKGYHHYEISNF 238

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    E  HN+ YW   +Y+G G GAHS ++   +    +I+ + +S L+        V 
Sbjct: 239 ALPTFECRHNILYWECKNYLGFGAGAHSYMEDVRYSNIENIKDYIKSILERKSA----VK 294

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR---QGFIERVQF 373
           EK  L+ E +  EF+ +G+R+ +G+  KD++   G +L    ++ +Q+   +G IE +  
Sbjct: 295 EKIKLAKEDRMAEFMFLGMRMTKGVCDKDFKKRFGISLFEFYKKVIQKYLNEGLIE-IDN 353

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
              + T+RG+ + + +     
Sbjct: 354 ECAKLTERGIDVSNVIFEEFL 374


>gi|300858954|ref|YP_003783937.1| oxygen-independent coproporphyrinogen III oxidase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686408|gb|ADK29330.1| oxygen-independent coproporphyrinogen III oxidase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206654|gb|ADL10996.1| Oxygen-independent coproporphyrinogen III oxidase [Corynebacterium
           pseudotuberculosis C231]
 gi|308276897|gb|ADO26796.1| oxygen-independent Coproporphyrinogen III oxidase [Corynebacterium
           pseudotuberculosis I19]
          Length = 384

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 121/391 (30%), Positives = 191/391 (48%), Gaps = 18/391 (4%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRY---KVGQENFIQSFLTEMQWMRQL---- 65
            Q S   GVY+H PFC  +C YCDFN++           E+++ +   E+    Q+    
Sbjct: 2   SQKSTPFGVYIHVPFCSSRCGYCDFNTYTPGELGSSASPESYLNALEIELDLAAQIRASS 61

Query: 66  TGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGY 125
              R  S++F GGGTPS++    +  +L  +  +  ++   E+T E+NP S     F   
Sbjct: 62  GDTREASTVFVGGGTPSMLGAAGLDRVLLAVRSSTGIAPGAEVTTESNPESTSPEFFHSL 121

Query: 126 RKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRM-SFDLIYALPKQTM 184
            ++G  R+SLG+QS     L+ L R H    A AA   A        + D+IY  P +T 
Sbjct: 122 LESGFTRVSLGMQSASSSVLKVLERKHTPGRAFAAAKEALAAGFNHVNLDMIYGTPTETN 181

Query: 185 TQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS 244
                 L R +   VDH+S Y L +E GT   +  + G+L  P E+   D Y +      
Sbjct: 182 EDVRETLSRVVDTGVDHVSAYSLIVEDGTAMARKVRRGELPPPDEDTYADRYWMIDQALR 241

Query: 245 AHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESW 304
             G   YE+SN +  G E  HN+ YWR GD+ G GPGAHS +            KHP S+
Sbjct: 242 QEGFSWYEVSNWAREGGECQHNMGYWRDGDWWGAGPGAHSHIAQRR----FHNIKHPASY 297

Query: 305 LKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQR 364
            K +      V E+E LS  ++ +E +M+GLRL+EG+S+ ++        +++   +  +
Sbjct: 298 SKALLAGELPVKEEETLSDVERHEEKVMLGLRLKEGVSIAEFSA-----GELDVIESRVK 352

Query: 365 QGFIERVQFSRLRCTQRGMTMLDSVIANLAV 395
           QG +  +   R+R T++   + D +IA++ V
Sbjct: 353 QGLL-HMNAGRVRLTEKSRLLADGIIADILV 382


>gi|269960450|ref|ZP_06174823.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           harveyi 1DA3]
 gi|269834877|gb|EEZ88963.1| oxygen-independent coproporphyrinogen III oxidase, putative [Vibrio
           harveyi 1DA3]
          Length = 390

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 142/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLT----EMQWMRQLTGPRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L     +++  R    PR + 
Sbjct: 5   PALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV R
Sbjct: 65  SIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E++ L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L
Sbjct: 125 ISIGVQSFEQRKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   Y
Sbjct: 185 DKAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++  G  R+   +  KHP  +L   + 
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFGDGRIVRTTKVKHPRGYLMAYQN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                ++ E L + E +  EF M   RL E    +D+    G  L    +        G+
Sbjct: 301 MVKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDYIDTTGLPLSSIQDTIDWALEMGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +   +    + T++G   L+ ++    
Sbjct: 361 LSETEA-HWQITEKGKLFLNDLLEAFM 386


>gi|170725687|ref|YP_001759713.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           woodyi ATCC 51908]
 gi|169811034|gb|ACA85618.1| oxygen-independent coproporphyrinogen III oxidase [Shewanella
           woodyi ATCC 51908]
          Length = 378

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 118/382 (30%), Positives = 197/382 (51%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + ++++    Q    R + SIF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQEYVDALISDLAHDLQYVQGRKLHSIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL     I  +L  +++      ++EIT+EANP ++E ++F+ Y +AGV R+S+G
Sbjct: 65  GGGTPSLFHASQIEKLLTHVSQVIPFQDDIEITMEANPGTLEHDDFEAYYQAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H+  EA   A       +   + DL++ LP Q+  +   ++  A 
Sbjct: 125 VQSFSSDKLNLLGRIHDEDEAKVAAQKALSAGYKSFNLDLMHGLPNQSFAEAMADIDTAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + +  HLS YQLTIE+ TLF+         LP +    ++Y   Q   +A G   YEIS 
Sbjct: 185 ALSPPHLSWYQLTIEQNTLFHSRPPQ----LPDDEALWEIYEQGQKKLAALGYQQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVK--VGSHRVAISIEKHPESWLKMVRKNGH 313
           ++  G +  HN+NYW++GDY+GIG GAH ++     +  +     KHP+           
Sbjct: 241 YAKPGFQCRHNINYWQFGDYLGIGCGAHGKITILNENKIIRTVKIKHPKG----YLATDS 296

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERV 371
              E   ++ E +A E+LM   RL   I  +++E   G + ++     +  + +  +   
Sbjct: 297 YNFETTEVAKEDRALEYLMNRFRLMSPIPKREFEQRTGLSREVLTSGIQRAKEKQLLTEN 356

Query: 372 QFSRLRCTQRGMTMLDSVIANL 393
                  T RG   ++ +++  
Sbjct: 357 D-EYWELTSRGKLFVNELLSQF 377


>gi|86146419|ref|ZP_01064743.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
 gi|85835898|gb|EAQ54032.1| coproporphyrinogen III oxidase [Vibrio sp. MED222]
          Length = 395

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 135/387 (34%), Positives = 206/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG----PRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +       PR + 
Sbjct: 9   PALSLYVHIPWCVQKCPYCDFNSHALKAEIPEKEYIDALLEDLDTDIEKYQLNDAPRPLH 68

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAGV+R
Sbjct: 69  SIFIGGGTPSLFSPEGIGRLLQGIKQRIPFKPEIEITMEANPGTIEAERFAGYQKAGVSR 128

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L
Sbjct: 129 ISVGVQSFEQEKLERLGRIHGQDEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADL 188

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+     HLS YQLTIE  T+FY         LP ++   D+++L     +  G   Y
Sbjct: 189 DKAIELDPPHLSWYQLTIEPNTMFYYKTPK----LPDDDDLWDIFDLGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + +           +N
Sbjct: 245 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN 304

Query: 312 --GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                + ++  + +E +  EF M   RL E    +D+    G   D   E     +  G+
Sbjct: 305 LVKPYLSDELEVPNEDRPFEFFMNRFRLMEACPKQDFIDTTGLGFDSIQETIEWAKELGY 364

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +     S  + T++G   L+ ++    
Sbjct: 365 LNET-NSHWQITEKGKLFLNDLLEAFM 390


>gi|15613906|ref|NP_242209.1| coproporphyrinogen III oxidase [Bacillus halodurans C-125]
 gi|10173959|dbj|BAB05062.1| coproporphyrinogen III oxidase [Bacillus halodurans C-125]
          Length = 385

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/377 (30%), Positives = 180/377 (47%), Gaps = 10/377 (2%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC   C YCDFN    + +     ++Q+  TEM  +      +S+ +++ GGGTP
Sbjct: 6   YIHIPFCEHICYYCDFNKFYLKNQ-PVNEYLQALETEMAMVVAEQPTKSLQTLYVGGGTP 64

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           + +    +A +L  I +   +S   E T E NP S++       R  GV+R+S+GVQ+ +
Sbjct: 65  TALTADQLAQLLASIKRTLPLSDLEEFTFEVNPDSIDEEKLDVLRSYGVDRLSIGVQAFQ 124

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
              L+ +GR H+      A+  +R      +S DL+  LPKQT   +   L+ A +  V+
Sbjct: 125 PLLLKEIGRTHDQKSVEQAVEKSRQAGFANLSLDLMLGLPKQTPEMFAETLKEAFALEVE 184

Query: 201 HLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLG 260
           HLS Y L +E  T+FY   + G L LP E+  V +Y      T  HG   YEISN +  G
Sbjct: 185 HLSCYSLKVEAKTVFYNRQRQGRLTLPPEDDEVKMYRQLCYETEKHGFKQYEISNFAKKG 244

Query: 261 AESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEF 320
            ES HNL YW   +Y G G GAH  V    +            +L+ + +    V E   
Sbjct: 245 YESRHNLVYWNNDEYYGFGAGAHGYVGGVRY----MNHGPLPKYLQAMEEGRRPVFESHH 300

Query: 321 LSSEQQADEFLMMGLRLREGISVKDWEMLAGR---NLDIECERNLQRQGFIERVQFSRLR 377
           +S  +Q +E + +GLR R G+  + +    G    +L  +    L  +  +ER    R+R
Sbjct: 301 VSRVEQMEEQMFLGLRKRSGVEERVFVERFGVSMFSLYEKQIAQLVARCLLERTD-DRVR 359

Query: 378 CTQRGMTMLDSVIANLA 394
            T  G+ + + V     
Sbjct: 360 LTDEGLLLGNEVFEQFL 376


>gi|212709351|ref|ZP_03317479.1| hypothetical protein PROVALCAL_00387 [Providencia alcalifaciens DSM
           30120]
 gi|212688263|gb|EEB47791.1| hypothetical protein PROVALCAL_00387 [Providencia alcalifaciens DSM
           30120]
          Length = 379

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 209/382 (54%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  + ++ Q  +++  L ++    +L G R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHTLKGEIPQTEYVEHLLNDLDKDAELIGSRPVKTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  +++ +++DG+ +   +  N E+T+EANP +VE + F GY+ +G+NRIS+G
Sbjct: 65  GGGTPSLLSAESMQMLMDGVRQRVNLDPNAEVTMEANPGTVEADRFSGYQTSGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H  +EA  A  LA N+  R  + DL++ LP QT  +   +L++A+
Sbjct: 125 VQSFGDDKLIMLGRIHGPNEAKRAAQLATNLHLRSFNLDLMHGLPSQTRDEGLSDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             +  HLS YQLTIE  T F          LP ++   D+Y     + +A G   YE S 
Sbjct: 185 ELSPPHLSWYQLTIEPNTQFGSRPPR----LPDDDTLWDIYTEGHKLLTAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     ++  ++    ++        G  +
Sbjct: 241 YAKAGYQCEHNLNYWRFGDYLGIGCGAHGKITSTDGQILRTV----KTKHPRGYMEGRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQGFIERVQF 373
             +  + +E +  E+ M   RL E ++ +++    G   ++          +G+I     
Sbjct: 297 DNRYNVENEDRPFEYFMNRFRLLEAMTRREFTEYTGLAESVVRPAIDEALAKGYISETAD 356

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T+ G   L+S++  L +
Sbjct: 357 E-WQITEHGKLFLNSLL-ELFL 376


>gi|34540292|ref|NP_904771.1| oxygen-independent coproporphyrinogen III oxidase [Porphyromonas
           gingivalis W83]
 gi|34396604|gb|AAQ65670.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Porphyromonas gingivalis W83]
          Length = 376

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 123/380 (32%), Positives = 192/380 (50%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
           G+Y+H PFC  +C YCDF S        +  +IQ+ + EM   R      +I +++FGGG
Sbjct: 3   GLYIHIPFCATRCSYCDFYSQT--NSALRSEYIQALIAEMSIRRAEVTD-TIGTLYFGGG 59

Query: 80  TPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQS 139
           TPSL+ PQ I  I++ + + ++ SS+ EIT+EANP  +  +  Q  R   +NRIS+G QS
Sbjct: 60  TPSLLSPQEIGRIIEQVYRLFSFSSDAEITLEANPDDLNTSYVQELRTLPINRISMGAQS 119

Query: 140 LEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRALSYA 198
             ++ L FL R HNA + + A+   RN     +S DLIY LP QT  +W+  +   L+ +
Sbjct: 120 FHDEDLHFLNRRHNARQVLEAVDTCRNAGLTNLSIDLIYGLPGQTPARWQENISAVLALS 179

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
             HLS Y L  E+GT   ++   G +    E V+++L+ + +   +  G   YEISN + 
Sbjct: 180 PPHLSAYHLIYEEGTPLTRLLHAGKVREVDEEVSLELFRMLREQLTGAGYEHYEISNFAR 239

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            G  S HN +YW+   Y+G+GP AHS       R   S       ++  +        E 
Sbjct: 240 SGYHSCHNSSYWQDTPYLGLGPSAHSFDG---RRTRRSNPSDIRRYIVSMAAGKPLFTE- 295

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER---NLQRQGFIERVQFSR 375
           E L+   + +E +M  LR   G+S      L G+     C R      R G +      R
Sbjct: 296 EILTDNDRYNEVVMTRLRTACGLSPDQIGHLFGKESAERCIRTAAPFIRDGLLHEEADGR 355

Query: 376 LRCTQRGMTMLDSVIANLAV 395
           +R T++G+ + D +I+   +
Sbjct: 356 IRLTEKGIFLSDRIISEFFI 375


>gi|149192345|ref|ZP_01870550.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
 gi|148833823|gb|EDL50855.1| coproporphyrinogen III oxidase [Vibrio shilonii AK1]
          Length = 389

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 202/384 (52%), Gaps = 14/384 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG----PRSIS 72
             L +Y+H P+CV+KCPYCDFNSH ++  + Q+ +I + L ++    +  G     R + 
Sbjct: 10  PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPQQAYITALLEDLDTDIRQYGLASDSRPLH 69

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI P+ I  +LDG+ +      ++EIT+EANP ++E   F+ YR  GV R
Sbjct: 70  SIFIGGGTPSLIAPEYIKQLLDGVRERIPFRDDIEITMEANPGTIEAARFEQYRVVGVTR 129

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS ++  L  LGR H  SEA+ A  LA  I     + DL++ LP+Q++     +L
Sbjct: 130 ISIGVQSFQQTKLERLGRIHGESEAVNAAKLAHEIGLNSFNLDLMHGLPEQSIDDALSDL 189

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           ++A+  A  HLS YQLTIE  TLFY         LP ++   D++     +    G   Y
Sbjct: 190 KQAIELAPPHLSWYQLTIEPNTLFYSKPP----TLPDDDDLWDIFEQGHQMLVEAGYQQY 245

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EIS +S    +  HNLNYWR+GDY+GIG GAH ++     R+  + +         +   
Sbjct: 246 EISGYSKPDFQCQHNLNYWRFGDYLGIGCGAHGKLSFADGRIVRTTKVKHPRGYLNML-- 303

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIE 369
              +  +  +  + +  EF +   RL E      + +  G NLD   E  +    QG+IE
Sbjct: 304 KPYLDSETNVDMKDRPFEFFINRFRLLEPCPKVQFTLRTGLNLDIIQEPIKRCLEQGYIE 363

Query: 370 RVQFSRLRCTQRGMTMLDSVIANL 393
             +      T++G   L+ V+   
Sbjct: 364 ETE-EHWIVTEKGKLFLNDVLEQF 386


>gi|294634377|ref|ZP_06712914.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Edwardsiella tarda ATCC 23685]
 gi|291092185|gb|EFE24746.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Edwardsiella tarda ATCC 23685]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 205/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH ++ ++ Q+ ++   L ++         R++S++F 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPQQAYVDHLLADLDQELPRVAGRTLSTLFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL   + +  +LDG+     ++++ EIT+EANP +VE   F  Y++AGVNRIS+G
Sbjct: 65  GGGTPSLFSGEALQRLLDGVRARLPLAADAEITMEANPGTVEAERFSAYQRAGVNRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L+ LGR H   EAIAA  LA ++  R  + DL++ LP+Q+  +   +L++A+
Sbjct: 125 VQSFSADKLQRLGRIHGPQEAIAAAQLASSLGLRSFNLDLMHGLPQQSQQEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF          LP ++   +++     +  A+G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFGSRPPR----LPDDDALWEIFEQGDRLLRANGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+        ++        G+ +
Sbjct: 241 YALAGRQCQHNLNYWRFGDYLGIGCGAHGKLTFVDGRIERRA----KTRHPRGYMQGNYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            +++ ++   +  EF M   RL E     D+    G +             QG+I     
Sbjct: 297 DQQQQVTLADRPFEFFMNRFRLLEPAPRADFTAYTGVDEATIRPQLEAALAQGYISE-SP 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           S  + T  G   L+S++  L +
Sbjct: 356 SHWQITPHGKLFLNSLL-ELFL 376


>gi|163749430|ref|ZP_02156678.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Shewanella benthica KT99]
 gi|161330839|gb|EDQ01766.1| oxygen-independent coproporphyrinogen III oxidase, putative
           [Shewanella benthica KT99]
          Length = 378

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 119/380 (31%), Positives = 195/380 (51%), Gaps = 10/380 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ +I + L +++        R I +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQEYIDALLADLKNDLHYVQGREIHTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL +   I  +L G+ +    S  +EIT+EANP ++E ++F+ Y KAGV R+S+G
Sbjct: 65  GGGTPSLFDAAQIERLLTGVNEMIPFSEQIEITMEANPGTLEHDDFEAYSKAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H   EA  A   A++   R  + DL++ LP Q+  +   ++  A 
Sbjct: 125 VQSFSTDKLNLLGRIHGKDEAKVAAQKAQSSGYRSFNLDLMHGLPNQSFEEAMADIDTAA 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             +  HLS YQLTIE+ TLF+         LP +     +Y   Q   +  G   YEIS 
Sbjct: 185 KLSPPHLSWYQLTIEQNTLFHSKPPQ----LPDDEALWHIYEQGQKKLAELGYEQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HN+NYW++GDY+GIG GAH +V +   +  +   K      K         
Sbjct: 241 YAKPGFQCQHNINYWQFGDYLGIGCGAHGKVTLLEQKQILRTVKI--KHPKGYLAADEYT 298

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN--LDIECERNLQRQGFIERVQF 373
            +   ++ +++  E+LM   RL   I   ++E   G +  +  +     + +  +   + 
Sbjct: 299 FDTIEVTEDERPLEYLMNRFRLMSAIPKAEFEQRTGLSHRVIAQGIEKAKNKTLLIENE- 357

Query: 374 SRLRCTQRGMTMLDSVIANL 393
           +    T +G   ++ +++  
Sbjct: 358 THWELTAKGKMFVNELLSQF 377


>gi|50122553|ref|YP_051720.1| coproporphyrinogen III oxidase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49613079|emb|CAG76530.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 379

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 204/382 (53%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L ++     L G R++ SIF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLDADLPLAGGRALHSIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  +LDG+     ++ + EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSAEAMQALLDGVRARIPLTPDAEITMEANPGTVEADRFSGYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS + Q L  LGR H   EA  A  LA  +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFDPQKLTRLGRIHGPEEAKRAAQLATGLKLRSFNLDLMHGLPDQSLDEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    HLS YQLTIE  TLF          LP ++   D+Y    ++ SA G   YE S 
Sbjct: 185 ALNPPHLSWYQLTIEPNTLFSSRPP----TLPDDDALWDIYEQGHALLSAAGYEQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++      +  ++    +         G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFSDGHILRTV----KVRHPRGYMQGTYM 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGFIERVQF 373
            ++  ++++ +  EF M   RL E     D+    G               QG++     
Sbjct: 297 DKQHDVANDDRPFEFFMNRFRLLEAAPRADFTAYTGLEEHSIRPQLDQALAQGYLTET-A 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +  + T+ G   L+S++  L +
Sbjct: 356 THWQITEHGKLFLNSLL-ELFL 376


>gi|296333292|ref|ZP_06875745.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305675203|ref|YP_003866875.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296149490|gb|EFG90386.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305413447|gb|ADM38566.1| coproporphyrinogen III oxidase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 379

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 114/380 (30%), Positives = 190/380 (50%), Gaps = 11/380 (2%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG 79
             Y+H PFC   C YCDFN +  + +   + ++ +   EM      TG   + +IF GGG
Sbjct: 3   SAYIHIPFCEHICHYCDFNKYFIQSQ-PVDEYLNALEQEMINTIAKTGKPDLKTIFIGGG 61

Query: 80  TPSLIEPQNIALILDGIAK-NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           TP+ +  + +  ++D I +     S+  E  +EANP  +        +++GVNR+S GVQ
Sbjct: 62  TPTSLSEEQLKKLMDMIIRVLKPSSTLSEFAVEANPDDLSAEKLNILKESGVNRLSFGVQ 121

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           + E+  L  +GR H   +  A+   AR I F  +S DL++ LP QT+   +  L  ALS 
Sbjct: 122 TFEDDLLEKIGRVHKQKDVFASFERAREIGFDNISLDLMFGLPGQTLKHVDHSLNTALSL 181

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
             +H S+Y L +E  T+FY + + G L LP +    ++Y +      A+G+H YEISN +
Sbjct: 182 DAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEMVMRRMEANGIHQYEISNFA 241

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G ES HNL YW   +Y G G GAH  +          ++ + +    ++ + G    +
Sbjct: 242 KAGLESKHNLTYWSNEEYFGFGAGAHGYISGTRTVNVGPVKHYID----LIAEKGFPYRD 297

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQFS 374
              +++E+Q +E + +GLR   G+S K +    GR+LD       ++L  +G I   + +
Sbjct: 298 THEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDELFPNVLKDLTEKGLIHNSESA 357

Query: 375 RLRCTQRGMTMLDSVIANLA 394
            +  T +G  + + V     
Sbjct: 358 -VCLTHQGKLLGNEVFGAFL 376


>gi|218710635|ref|YP_002418256.1| coproporphyrinogen III oxidase [Vibrio splendidus LGP32]
 gi|218323654|emb|CAV19953.1| Oxygen-independent coproporphyrinogen III oxidase-like protein
           [Vibrio splendidus LGP32]
          Length = 395

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 134/387 (34%), Positives = 204/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG----PRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +       PR + 
Sbjct: 9   PALSLYVHIPWCVQKCPYCDFNSHALKAEIPEKEYIDALLEDLDTDIEKYQLNGAPRPLH 68

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAG+ R
Sbjct: 69  SIFIGGGTPSLFSPEGIGRLLQGIEQRIPFKPEIEITMEANPGTIEAERFAGYQKAGITR 128

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L
Sbjct: 129 ISVGVQSFEQEKLERLGRIHGQDEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADL 188

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            RA+     HLS YQLTIE  T+FY         LP ++   D+++L     +  G   Y
Sbjct: 189 DRAIELNPPHLSWYQLTIEPNTMFYYKTPK----LPDDDDLWDIFDLGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + +           +N
Sbjct: 245 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLAAYQN 304

Query: 312 --GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                + ++  + +E +  EF M   RL E    +D+    G   D         +  G+
Sbjct: 305 LVKPYLSDELEVPNEDRPFEFFMNRFRLMEACPKQDFIDTTGLEFDSIQPTIEWAKDLGY 364

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +     S  + T++G   L+ ++    
Sbjct: 365 LNETD-SHWQITEKGKLFLNDLLEAFM 390


>gi|306833861|ref|ZP_07466986.1| coproporphyrinogen dehydrogenase [Streptococcus bovis ATCC 700338]
 gi|304424055|gb|EFM27196.1| coproporphyrinogen dehydrogenase [Streptococcus bovis ATCC 700338]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 116/384 (30%), Positives = 202/384 (52%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +     YVH PFC + C YCDF+    + +   ++++Q+ + E +          + +++
Sbjct: 3   TKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDDYLQALIREFESY----DIEQLRTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ I  Q +  +L  + K+  +S   E TIEANP  +  +  +  +K+ VNR+SL
Sbjct: 58  IGGGTPTSITAQQLDYLLTDLTKHLDLSVLEEFTIEANPGDLTDDKIEVLKKSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAI-AAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+  ++ L+ +GR+HN S+      HL    F  +S DLIYALP QTM   +  + +A
Sbjct: 118 GVQTFNDKQLKRIGRSHNESQIYSTIDHLKTAGFDNISIDLIYALPGQTMEDVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           ++  + HLSLY L +E  T+F    + G L LP E++  +++    +   A+G   YEIS
Sbjct: 178 IALDIPHLSLYSLILEHHTVFMNKMRRGKLNLPQEDLEAEMFEYIIAELEANGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N +  G ES HNL YW   +Y G+G GA   +    +R    I+ + ++  +     G+A
Sbjct: 238 NFTKPGFESRHNLMYWDNAEYYGVGAGASGYLNGVRYRNRGPIQHYLKAVSE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER---NLQRQGFIERV 371
            + +E L+ ++  +E L +GLR + G+S+  +E   G + +    +    L + G +   
Sbjct: 293 RLSEEVLTKDEMMEEELFLGLRKKSGVSIAKFEEKFGVSFEERYGQIVTELCQHGLLVP- 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
               +R T++G+ + D+V     +
Sbjct: 352 DDEVVRMTKKGLFLGDTVAERFIL 375


>gi|149376951|ref|ZP_01894705.1| coproporphyrinogen III oxidase [Marinobacter algicola DG893]
 gi|149358728|gb|EDM47198.1| coproporphyrinogen III oxidase [Marinobacter algicola DG893]
          Length = 386

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 127/382 (33%), Positives = 196/382 (51%), Gaps = 14/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CVKKCPYCDFNSH     + +  ++ + + ++         R I ++F 
Sbjct: 15  PPLSLYVHVPWCVKKCPYCDFNSHALTGDIPENGYLDAIMEDLSGDLAFIQGRPIQTVFI 74

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+ P     + D +  + + + + EIT+EANP +VE   F G+R AG+NR+SLG
Sbjct: 75  GGGTPSLMSPDFYNTLFDRLRTHLSFTDDAEITLEANPGTVEQARFNGFRGAGINRLSLG 134

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +QS     L+ LGR H+   A  AI  ARN  F   + DL++ LP QT      +LQ A+
Sbjct: 135 IQSFNPLRLKALGRIHDDKSAHRAIEAARNAGFDNFNLDLMHGLPDQTPADALDDLQAAM 194

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S+   HLS YQLT+E  T FY         LP ++   ++Y+         G   YE+S 
Sbjct: 195 SWQPPHLSWYQLTLEPNTEFYSRPPQ----LPDDDHLWEIYSQGADYLHQQGFTDYEVSA 250

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
            S  G  S HNLNYW +GDY+ +G GAH ++   +  +      + P++++  +   G  
Sbjct: 251 WSRPGMASRHNLNYWMFGDYLALGAGAHGKITFRNGDIRRFWKTRQPDAYMNRI---GSR 307

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQ 372
               + +  E++  EFLM  LRL  G+    +    G  L         L+++  +E   
Sbjct: 308 TAGSQMVELEERPLEFLMNALRLTSGVPENLFTERTGLPLSRVAVKLEELRKENMLE--- 364

Query: 373 FSRLRCTQRGMTMLDSVIANLA 394
             R++ T+ G   L+S++    
Sbjct: 365 PGRIQTTELGQRYLNSLLERFL 386


>gi|153835258|ref|ZP_01987925.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           harveyi HY01]
 gi|148868233|gb|EDL67373.1| putative oxygen-independent coproporphyrinogen III oxidase [Vibrio
           harveyi HY01]
          Length = 390

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 143/387 (36%), Positives = 206/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLT----EMQWMRQLTGPRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L     +++  R    PR + 
Sbjct: 5   PALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV R
Sbjct: 65  SIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L
Sbjct: 125 ISIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   Y
Sbjct: 185 DKAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+   +  KHP  +L   + 
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLMAYQN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                ++ E L + E +  EF M   RL E    +D+    G  L    E        G+
Sbjct: 301 MVKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDYIDTTGLPLSSIQETIDWALEMGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +   +    + T++G   L+ ++    
Sbjct: 361 LSETEA-HWQITEKGKLFLNDLLEAFM 386


>gi|253990758|ref|YP_003042114.1| coproporphyrinogen III oxidase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211639089|emb|CAR67701.1| Hypothetical protein yggW [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782208|emb|CAQ85372.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 128/382 (33%), Positives = 207/382 (54%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH  +  V  + ++   L +++    +   R +++IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVDHLLADLKTDLPMVKGREVTTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  Q +  +LDG+     VS+  EIT+EANP +VE + F GY++AG+NRIS+G
Sbjct: 65  GGGTPSLLSSQGMQQLLDGVRTLLPVSTQAEITMEANPGTVEADRFSGYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS     L  LGR H   EA  A  LA ++  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSPDKLVRLGRIHGPDEAKRAARLAASLGLRSFNLDLMHGLPNQSLNEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           + +  HLS YQLTIE  T F         VLP ++   D+++    + +A G   YE S 
Sbjct: 185 ALSPPHLSWYQLTIEPNTRFGSRPP----VLPDDDALWDIFSQGHQLLTAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  ++    ++        G  +
Sbjct: 241 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFEDGRILRTV----KTKHPRGYMQGRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQF 373
            ++  + +E +  EF M   RL E +  +D+    G +               ++     
Sbjct: 297 DKQNQVENEDRPFEFFMNRFRLLEAMPKQDFSNFTGLSEASIRNPIDQALAANYLSET-A 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           +  + TQ+G   L+S++  L +
Sbjct: 356 THWQITQKGKLFLNSLL-ELFL 376


>gi|315127649|ref|YP_004069652.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoalteromonas sp. SM9913]
 gi|315016163|gb|ADT69501.1| oxygen-independent coproporphyrinogen III oxidase
           [Pseudoalteromonas sp. SM9913]
          Length = 378

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 130/382 (34%), Positives = 192/382 (50%), Gaps = 10/382 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +YVH P+CV+KCPYCDFNSH ++  + +  ++Q  + +++    L   R I SIF 
Sbjct: 4   PPLSLYVHVPWCVQKCPYCDFNSHGQKGDIPEAEYVQHLIDDLKADLHLVQGRKIHSIFI 63

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+       +L  +     +S N EIT+EANP +VE   F+ Y KAG+NRIS+G
Sbjct: 64  GGGTPSLLTGAAYTRLLKEVDSLIGLSDNCEITLEANPGTVETGRFKDYVKAGINRISIG 123

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS++   L+ LGR H A EA  A   A        + DL++ LP Q++     +L++ +
Sbjct: 124 VQSMQNDKLKALGRIHGADEASYAAQQASEAGLNSFNLDLMHGLPGQSLDDALSDLKQII 183

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           +    H+S YQLTIE  T F          LP +    D+    Q++ +  G   YEIS 
Sbjct: 184 ALNPPHISWYQLTIEPNTQFASKPP----TLPQDETLWDIQEQGQALLAQAGYQQYEISG 239

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH +V      V    EK  +     +      +
Sbjct: 240 YAKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTDAKTGVITRTEKV-KHPRGYMDIIKPYL 298

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL--DIECERNLQRQGFIERVQF 373
            +   +  +  A EF M   RL E   + D+  L  + L             G + +   
Sbjct: 299 YKSWQVEQDDLAFEFFMNRFRLIEPCPINDFNALTQQPLQSQQHALDKAINAGLLTKTD- 357

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           S    T +G   L+ ++A L V
Sbjct: 358 SHWHVTLQGQRFLNDLLA-LFV 378


>gi|194397558|ref|YP_002038057.1| coproporphyrinogen III oxidase [Streptococcus pneumoniae G54]
 gi|194357225|gb|ACF55673.1| Oxygen-independent coproporphyrinogen III oxidase, putative
           [Streptococcus pneumoniae G54]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 118/384 (30%), Positives = 204/384 (53%), Gaps = 15/384 (3%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
                 YVH PFC + C YCDF+    + +   +++++  L E +          +S+++
Sbjct: 3   KKPTSAYVHIPFCTQICYYCDFSKVFIKNQ-PVDSYLEHLLEEFRSY----DIEKLSTLY 57

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
            GGGTP+ +    + ++L+G+ KN  +S   E+TIEANP  ++ +     + + VNR+SL
Sbjct: 58  IGGGTPTALSAPQLEVLLNGLTKNLDLSVLEELTIEANPGDLDADKIAVLKNSAVNRVSL 117

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLAR-NIFPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ+ +++ L+ +GR+H   +    I   +   F  +S DLIYALP QTM Q +  + +A
Sbjct: 118 GVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALPGQTMEQVKENVAKA 177

Query: 195 LSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS 254
           +   + H+SLY L +E  T+F    + G L LP E +  +++    +     G   YEIS
Sbjct: 178 IELDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYIIAELERAGFEHYEIS 237

Query: 255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHA 314
           N S  G ES HNL YW   +Y GIG GA   V    ++    I  +  +  +     G+A
Sbjct: 238 NFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIRHYLSAVEE-----GNA 292

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERV 371
            + ++ LS ++Q +E + +GLR + G+S+  +E   G++      E  R+L +QG + ++
Sbjct: 293 CITEDHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGQSFAGLYGEIVRDLVQQGLM-QI 351

Query: 372 QFSRLRCTQRGMTMLDSVIANLAV 395
           +   +R T+RG+ + D+V     +
Sbjct: 352 EGDHVRMTKRGLFLGDTVAERFIL 375


>gi|254479248|ref|ZP_05092592.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Carboxydibrachium pacificum DSM 12653]
 gi|214034817|gb|EEB75547.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Carboxydibrachium pacificum DSM 12653]
          Length = 375

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 114/381 (29%), Positives = 205/381 (53%), Gaps = 11/381 (2%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             +G+Y+H PFC KKC YCDFNS+V    +  E ++++ + E+++  +      I S++ 
Sbjct: 2   REIGIYIHIPFCKKKCYYCDFNSYVGYEHL-MEEYVKALIEEIKYYSEE--DLKIVSVYI 58

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+ + P  I ++L  I +++ V  + EITIE NP  +  +  + Y+  G+NRIS+G
Sbjct: 59  GGGTPNFLPPSYIEMVLSEIHRHYNVLGDAEITIEVNPGLLTEDKLKIYKVNGINRISIG 118

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +Q+ + + L ++GR H   + +    L R  F  ++ DLIYALP QT  +W+  L + + 
Sbjct: 119 LQAFQNRLLEYIGRIHTVEDFLENYALIRKYFDNVNVDLIYALPTQTFEEWQETLIKVVE 178

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
              +H+S Y L +E+ T F +++++G L +  E   + +Y+       + G   YEISN 
Sbjct: 179 LKPEHISTYSLILEENTPFGRLYREGKLPVIDEEEELKMYHWGIEFLKSKGYCHYEISNF 238

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +  G +  HN+ YW   +Y+G G GAHS  K        +  +  E ++  +   G A  
Sbjct: 239 ALPGYQCKHNILYWELKEYLGFGAGAHSYFKGRR----WNNFERVEEYIGAILGKGDARE 294

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER---NLQRQGFIERVQF 373
           +   LS E +  EF+ +GLR+R+G+  +++    G ++    E      ++ G IE+   
Sbjct: 295 KVIELSPEDEISEFMFLGLRMRKGVCEEEFRKRFGISMFERYEEIFIKYEKMGLIEK-DK 353

Query: 374 SRLRCTQRGMTMLDSVIANLA 394
             +R T++G+ + + +  +  
Sbjct: 354 DCVRLTEKGIDVSNVIFEDFL 374


>gi|317493547|ref|ZP_07951968.1| radical SAM superfamily protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918490|gb|EFV39828.1| radical SAM superfamily protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 376

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 124/382 (32%), Positives = 200/382 (52%), Gaps = 13/382 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH ++  +    ++   L ++      T  R I +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPSTEYVDHLLADLDADVAFTSGREIGTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+  + +  ++DG+     ++ N E+T+EANP +VE + F  Y++AG+NRIS+G
Sbjct: 65  GGGTPSLLSAEGMQRLMDGVRARLPLAPNAEVTMEANPGTVEADRFSAYQRAGINRISIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMELQRAL 195
           VQS   + L  LGR H   EA  A HLA+ +  R  + DL++ LP Q++ +   +L++A+
Sbjct: 125 VQSFSAEKLTRLGRIHGPEEAKRAAHLAQGLGLRSFNLDLMHGLPDQSLDEALDDLRQAI 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
                HLS YQLTIE  TLF          LP ++   D++     +  A G   YE S 
Sbjct: 185 ELNPPHLSWYQLTIEPNTLFGSRPPK----LPDDDALWDIFQRGDELLRAAGYQQYETSA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
           ++  G +  HNLNYWR+GDY+GIG GAH ++     R+  +     ++        G  +
Sbjct: 241 YAKPGYQCHHNLNYWRFGDYLGIGCGAHGKITFEDGRILRTA----KTRHPRGYMQGRYL 296

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGR--NLDIECERNLQRQGFIERVQF 373
            ++  + ++ +  EF M   RL E     ++++  G    +          Q +I     
Sbjct: 297 DKQHEVGNDDRPFEFFMNRFRLLEPTPRAEFQLYTGLGEAVIRAQLDEALSQNYIVETD- 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
              + T+ G   L+S++  L +
Sbjct: 356 EYWQITEHGKLFLNSLL-ELFL 376


>gi|293552732|ref|ZP_06673396.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecium E1039]
 gi|291603112|gb|EFF33300.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecium E1039]
          Length = 388

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 116/386 (30%), Positives = 186/386 (48%), Gaps = 10/386 (2%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
               N +  Y+H PFC   C YCDFN          + +++  L EM+ M +     ++ 
Sbjct: 6   NPAENKVSAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVEMLLNEMRLMLESHPTANLE 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           +++ GGGTP+ +  + +  +L G  +     +  E T+EANP  +     Q  +  GVNR
Sbjct: 65  TLYVGGGTPTSLSAKQLDRLLSGAREILPFQNGNEFTVEANPGDLTREKLQVMKNYGVNR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           +S+GVQ+   + L+ +GR H A +       L    F  +S DLIYALP QT+  +   L
Sbjct: 125 LSMGVQTFNNRLLKKIGRKHTAEDVYQTMQFLEAENFTNVSIDLIYALPGQTLEGYRDTL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           ++AL+  + H SLY L +E  T+F    + G L LP +     ++  T      HG H Y
Sbjct: 185 EKALALDLPHYSLYSLILENKTMFMNWVRQGRLELPDQETETRMFEETIEAMEKHGRHQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISN    G ES HNL YW    Y G G GA   +    +R    I+ +        R N
Sbjct: 245 EISNFGLSGHESQHNLMYWNNDHYFGFGAGASGYLGDIRYRNKGPIQHYLRPL----RAN 300

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFI 368
              V+E+E L+ + Q +E + +GLR + GI+ K +     + ++    +  R L+++G +
Sbjct: 301 ERPVLEEEKLTRKNQIEEEMFLGLRKKTGITKKHFYDRYQKTIESVYGDVLRELEQEGLL 360

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
              +  R+  T RG  + ++V     
Sbjct: 361 V-NEEDRVYLTPRGTFLGNNVFERFL 385


>gi|156975839|ref|YP_001446746.1| coproporphyrinogen III oxidase [Vibrio harveyi ATCC BAA-1116]
 gi|156527433|gb|ABU72519.1| hypothetical protein VIBHAR_03584 [Vibrio harveyi ATCC BAA-1116]
          Length = 390

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 143/387 (36%), Positives = 207/387 (53%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLT----EMQWMRQLTGPRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L     +++  R    PR + 
Sbjct: 5   PALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV R
Sbjct: 65  SIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L
Sbjct: 125 ISIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+  A  HLS YQLTIE  T+FY         LP ++   D++       +A G   Y
Sbjct: 185 DKAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFEQGHEKLAAAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRK 310
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+   +  KHP  +L   + 
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIVRTTKVKHPRGYLMAYQN 300

Query: 311 NGHAVVEKEFL-SSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                ++ E L + E +  EF M   RL E    +D+    G  L    E        G+
Sbjct: 301 MVKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDYIDTTGLPLSSIQETIDWALEMGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +   + +  + T++G   L+ ++    
Sbjct: 361 LSETE-THWQITEKGKLFLNDLLEAFM 386


>gi|325845625|ref|ZP_08168909.1| coproporphyrinogen dehydrogenase [Turicibacter sp. HGF1]
 gi|325488323|gb|EGC90748.1| coproporphyrinogen dehydrogenase [Turicibacter sp. HGF1]
          Length = 378

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 115/382 (30%), Positives = 197/382 (51%), Gaps = 11/382 (2%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+H PFC   C YCDF   + + +     +I++ + E++  +Q  G  ++ SI+ G
Sbjct: 2   PKGLYIHIPFCDHICTYCDFPKLLTKGQR-HAEYIEALIQELKLYQQNVGFSNLQSIYIG 60

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTP+ +  + I  + D + +   ++   E +IEANP ++  +  Q  +  GVNR SLGV
Sbjct: 61  GGTPTALSVEQIQPVFDFLTEQIQMNQIQEFSIEANPENLTRDKIQYLKAQGVNRFSLGV 120

Query: 138 QSLEEQSLRFLGRNHNASEAIAAI-HLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q+  E  L+ +GR H A E I A+ +L +     ++ DLIYA+P QT+ +   +L++ +S
Sbjct: 121 QTFHESLLKRIGRKHQAQEVIQAVANLKQCGIKNINLDLIYAIPGQTLDELRDDLRQVIS 180

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
             V+H+S Y L +E+ T  Y  +    + L    +   +Y +T    +  G   YEISN 
Sbjct: 181 LEVEHISAYSLIVEEHTQLYLAYMRDQIELTDNEIEAKMYEVTIETLTEAGYEHYEISNF 240

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +     SLHN  YW+   YIG+G GAH  VK   ++   SI  + E            ++
Sbjct: 241 AKSKP-SLHNQWYWKNETYIGVGLGAHGYVKGQRYQNTRSINTYIELLKD----GKLPMI 295

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC---ERNLQRQGFIERVQF 373
           E   L+ E+  +E + +GLRL +G+++K        N+D         L ++G++E+ + 
Sbjct: 296 ESHALTKEEMIEEEMFLGLRLLKGVNLKAISDKYDVNIDEIYGKAFEELIQKGYLEQKEL 355

Query: 374 SRLRCTQRGMTMLDSVIANLAV 395
           + +R T  G+ M + V     +
Sbjct: 356 N-VRLTPSGLLMANEVFEQFLL 376


>gi|91794038|ref|YP_563689.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Shewanella denitrificans OS217]
 gi|91716040|gb|ABE55966.1| coproporphyrinogen III oxidase, anaerobic [Shewanella denitrificans
           OS217]
          Length = 400

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 127/400 (31%), Positives = 201/400 (50%), Gaps = 27/400 (6%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             L +Y+H P+CV+KCPYCDFNSH +  ++ Q+ ++ + L ++         R + +IF 
Sbjct: 5   PPLSLYIHIPWCVQKCPYCDFNSHGQHGELPQQAYVDALLADLAQDMDYVQGRQLHTIFI 64

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL + + I  +L G+        ++EIT+EANP ++E ++F  YR AGV R+S+G
Sbjct: 65  GGGTPSLFDAKQIERLLLGVQALIPFERDIEITMEANPGTLEHDDFSAYRAAGVTRLSIG 124

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARN-IFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  +  L  LGR H+ +EA+ A   A+   +   + DL++ LP Q+ ++   ++  A+
Sbjct: 125 VQSFAKDKLNLLGRIHDQNEAVVAAQKAKEADYLSFNLDLMHGLPNQSFSEAMHDIDTAV 184

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
           S A  HLS YQLTIE  TLF+         LP +     +Y   Q   +A G   YEIS 
Sbjct: 185 SLAPPHLSWYQLTIEPNTLFHSKPPQ----LPDDEDLWQIYQQGQQKLAALGYEQYEISA 240

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVK--VGSHRVAISIEKHP------------ 301
           ++  G +  HNLNYW++GDY+GIG GAH ++     +  +     KHP            
Sbjct: 241 YAKPGFQCRHNLNYWQFGDYLGIGCGAHGKITLMDETSVIRTVKIKHPKGYLASAETALS 300

Query: 302 -----ESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG--RNL 354
                E+      K  H       + SE    E+LM  LRL   I   ++E   G   + 
Sbjct: 301 ANKSHEASPSTANKANHFAASVTPILSEDMGLEYLMNRLRLMTPIPKTEFEQRTGQAHSS 360

Query: 355 DIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
                   + +G I +   +  + T +G   ++ +++   
Sbjct: 361 LDIGMAKAESRGLITQ-DETHWQLTSKGHMFVNDILSQFL 399


>gi|293568111|ref|ZP_06679448.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecium E1071]
 gi|291589193|gb|EFF21004.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecium E1071]
          Length = 388

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 116/386 (30%), Positives = 186/386 (48%), Gaps = 10/386 (2%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
               N +  Y+H PFC   C YCDFN          + +++  L EM+ M +     ++ 
Sbjct: 6   NPAENKVSAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVEMLLNEMRLMLESHPTANLE 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           +++ GGGTP+ +  + +  +L G  +     +  E T+EANP  +     Q  +  GVNR
Sbjct: 65  TLYVGGGTPTSLSAKQLDRLLSGAREILPFQNGNEFTVEANPGDLTREKLQVMKNYGVNR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIA-AIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           +S+GVQ+ + + L+ +GR H A +       L    F  +S DLIYALP QT+  +   L
Sbjct: 125 LSMGVQTFDNRLLKKIGRKHTAEDVYQTMQFLEAENFTNVSIDLIYALPGQTLEGYRDTL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           ++AL+  + H SLY L +E  T+F    + G L LP +     ++  T      HG H Y
Sbjct: 185 EKALALDLPHYSLYSLILENKTMFMNWVRQGRLELPDQETETRMFEETIEAMEKHGRHQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISN    G ES HNL YW    Y G G GA   +    +R    I+ +        R N
Sbjct: 245 EISNFGLSGHESQHNLMYWNNDHYFGFGAGASGYLGDIRYRNKGPIQHYLRPL----RAN 300

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFI 368
              V+E+E L+ + Q +E + +GLR + GI+ K +     + ++    +  R L+++G +
Sbjct: 301 ERPVLEEEKLTRKNQIEEEMFLGLRKKTGITKKHFYDRYQKTIESVYGDVLRELEQEGLL 360

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
              +  R+  T RG    ++V     
Sbjct: 361 V-NEEDRVYLTPRGTFFGNNVFERFL 385


>gi|294618180|ref|ZP_06697769.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecium E1679]
 gi|291595555|gb|EFF26859.1| putative oxygen-independent coproporphyrinogen III oxidase
           [Enterococcus faecium E1679]
          Length = 388

 Score =  247 bits (630), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 116/386 (30%), Positives = 187/386 (48%), Gaps = 10/386 (2%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSIS 72
               N +  Y+H PFC   C YCDFN          + +++  L EM+ M +     ++ 
Sbjct: 6   NPAENKVSAYIHIPFCEHICYYCDFNKVFL-EGQPVDEYVEMLLNEMRLMLESHPTANLE 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           +++ GGGTP+ +  + +  +L G  +     +  E T+EANP  +     Q  +  GVNR
Sbjct: 65  TLYVGGGTPTSLSAKQLDRLLSGAREILPFQNGNEFTVEANPGDLTREKLQVMKNYGVNR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASE-AIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMEL 191
           +S+GVQ+ + + L+ +GR H A +       L    F  +S DLIYALP QT+  +   L
Sbjct: 125 LSMGVQTFDNRLLKKIGRKHTAEDVYQTMQFLEAENFTNVSIDLIYALPGQTLEGYRDTL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
           ++AL+  + H SLY L +E  T+F    + G L LP +     ++  T      HG H Y
Sbjct: 185 EKALALDLPHYSLYSLILENKTMFMNWVRQGRLELPDQETETRMFEETIEAMEKHGRHQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EISN    G ES HNL YW    Y G G GA   +    +R    I+ +        R N
Sbjct: 245 EISNFGLSGHESQHNLMYWNNDHYFGFGAGASGYLGDIRYRNKGPIQHYLRPL----RAN 300

Query: 312 GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFI 368
              V+E+E L+ + Q +E + +GLR + GI+ K +     + ++    +  R L+++G +
Sbjct: 301 ERPVLEEEKLTRKNQIEEEMFLGLRKKTGITKKHFYDRYQKTIESVYGDVLRELEQEGLL 360

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANLA 394
              +  R+  T RG  + ++V     
Sbjct: 361 V-NEEDRVYLTPRGTFLGNNVFERFL 385


>gi|126734413|ref|ZP_01750160.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. CCS2]
 gi|126717279|gb|EBA14143.1| Putative oxygen-independent coproporphyrinogen III oxidase
           [Roseobacter sp. CCS2]
          Length = 385

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 171/378 (45%), Positives = 238/378 (62%), Gaps = 4/378 (1%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFG 77
             G+Y+HWPFC  KCPYCDFNSHV   ++ Q+ +  ++L+E++ + + T  R + S+FFG
Sbjct: 9   GFGLYIHWPFCQAKCPYCDFNSHVVA-QIDQKAWQAAYLSEIERIGEETKGRVLRSVFFG 67

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTPSL++P  +  IL  +   W +++++EIT+EANP+SVE   F GYR AGVNR+S+G+
Sbjct: 68  GGTPSLMDPAVVDAILTKVRATWPLANDIEITLEANPTSVEAGRFAGYRDAGVNRVSMGI 127

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           Q+L +  L+ LGR H A EA+ A  +ARN F R+SFDLIYA   Q++  W  EL +AL+ 
Sbjct: 128 QALNDADLKALGRLHTAREAMQAFDVARNAFDRVSFDLIYARQGQSLKDWTSELGQALNL 187

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVL-PSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           AVDHLSLYQLTIE GT F   +  G L   P ++ A D+Y  TQ +    GL +YE+SNH
Sbjct: 188 AVDHLSLYQLTIEDGTAFGDRYAAGKLRDLPDDDAAADMYMATQEVCGEAGLFSYEVSNH 247

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
           +    ES+HN  YW+YGDY GIGPGAH R+ +G  R A      P  WL  V K G+   
Sbjct: 248 ARPECESVHNKIYWKYGDYAGIGPGAHGRLTLGGTRYATEASLAPTIWLSQVLKTGNGDG 307

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRL 376
             E L  + Q  EFL+MG+RLREG+ +  +       +      NLQ  GF+++ Q   L
Sbjct: 308 NLEALDRQDQFVEFLLMGMRLREGVQLSRFSDCV-TYIFQNNINNLQESGFVQK-QDDVL 365

Query: 377 RCTQRGMTMLDSVIANLA 394
           R T +G  +L++V+  L 
Sbjct: 366 RVTDQGYPVLNAVLRELL 383


>gi|91228693|ref|ZP_01262607.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
 gi|91187764|gb|EAS74082.1| coproporphyrinogen III oxidase [Vibrio alginolyticus 12G01]
          Length = 392

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 139/387 (35%), Positives = 203/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLT----EMQWMRQLTGPRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ +E +I + L     +++  R    PR + 
Sbjct: 5   PALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLH 64

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSLI  + I  +L GI         +EIT+EANP ++E   F GYRKAGV R
Sbjct: 65  SIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTR 124

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E+Q L  LGR H   EA+ A  LA  I     + DL++ LP Q++ Q   +L
Sbjct: 125 ISIGVQSFEQQKLERLGRIHGQDEAVNAAQLAHQIGLNSFNLDLMHGLPDQSIEQALADL 184

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+  A  HLS YQLTIE  T+FY         LP ++   D++ L     +A G   Y
Sbjct: 185 DKAIELAPPHLSWYQLTIEPNTMFYYKPP----TLPDDDDLWDIFELGHQKLAAAGYVQY 240

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311
           EIS +S  G +  HNLNYWR+GDY+GIG G+H ++     R+  + +           +N
Sbjct: 241 EISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQN 300

Query: 312 --GHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD--IECERNLQRQGF 367
                +  +  ++ E +  EF M   RL E    +D+    G  L    E        G+
Sbjct: 301 MVKPYLHTEHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPLSTIQETIDWAIEMGY 360

Query: 368 IERVQFSRLRCTQRGMTMLDSVIANLA 394
           +     +  + T++G   L+ ++    
Sbjct: 361 LSET-ATHWQITEKGKLFLNDLLEAFM 386


>gi|84394059|ref|ZP_00992795.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
 gi|84375301|gb|EAP92212.1| coproporphyrinogen III oxidase [Vibrio splendidus 12B01]
          Length = 395

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 133/387 (34%), Positives = 205/387 (52%), Gaps = 14/387 (3%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTG----PRSIS 72
            +L +YVH P+CV+KCPYCDFNSH  + ++ ++ +I + L ++    +       PR + 
Sbjct: 9   PALSLYVHIPWCVQKCPYCDFNSHALKAEIPEKEYIDALLEDLDTDIEKYQLNGMPRPLH 68

Query: 73  SIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNR 132
           SIF GGGTPSL  P+ I  +L GI +       +EIT+EANP ++E   F GY+KAG+ R
Sbjct: 69  SIFIGGGTPSLFSPEGIGRLLQGIEQRIPFKPEIEITMEANPGTIEAERFAGYQKAGITR 128

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR-MSFDLIYALPKQTMTQWEMEL 191
           IS+GVQS E++ L  LGR H   EA+ A HLA  I     + DL++ LP Q++ Q   +L
Sbjct: 129 ISVGVQSFEQEKLERLGRIHGQVEAVNAAHLAHKIGLNSFNLDLMHGLPDQSIDQALADL 188

Query: 192 QRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            +A+     HLS YQLTIE  T+FY         LP ++   D+++L     +  G   Y
Sbjct: 189 DKAIELDPPHLSWYQLTIEPNTMFYYKTPK----LPDDDDLWDIFDLGHKKLADAGYVQY 244

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKN 311