RPSBLAST alignment for GI: 254780628 and conserved domain: smart00729

>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases. Length = 216
 Score =  163 bits (415), Expect = 7e-41
 Identities = 61/221 (27%), Positives = 117/221 (52%), Gaps = 7/221 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWM-RQLTGPRSISSIFF 76
            L +Y+    C ++C +C F S   + +     ++++ + E++ +  +      + ++F 
Sbjct: 1   PLALYIITRGCPRRCTFCSFPSARGKLR---SRYLEALVREIELLAEKGEKEILVGTVFI 57

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+L+ P+ +  +L+ I +   ++ +VEITIE  P ++     +  ++AGVNR+SLG
Sbjct: 58  GGGTPTLLSPEQLEELLEAIREILGLADDVEITIETRPGTLTEELLEALKEAGVNRVSLG 117

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  ++ L+ + R H   + + A+   R   P ++S DLI  LP +T   +E  L+   
Sbjct: 118 VQSGSDEVLKAINRGHTVEDVLEAVEKLREAGPIKVSTDLIVGLPGETEEDFEETLKLLK 177

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLY 236
               D +S++ L+   GT   K++K   L  P +   ++L 
Sbjct: 178 ELGPDRVSIFPLSPRPGTPLAKLYK--RLKPPDKEERLELL 216