RPSBLAST alignment for GI: 254780628 and conserved domain: TIGR01211

>gnl|CDD|162253 TIGR01211, ELP3, histone acetyltransferase, ELP3 family. The Saccharomyces cerevisiae member YPL086C has been characterized in vitro as an N-terminal acetyltransferase for all four core histones. It is a component of the RNA polymerase II holoenzyme, designated Elp3p for Elongator Protein 3. Members of this family are found in eukaryotes and archaea. These proteins are part of the larger set of GNAT acetyltransferases. Length = 522
 Score = 51.7 bits (124), Expect = 4e-07
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 16/161 (9%)

Query: 85  EPQNIALILDGIAKNWTVSS-NVEITIEANPS---SVEVNNFQGYRKAGVNRISLGVQSL 140
           E +  + + + I  N T     V +TIE  P       ++        G  R+ LGVQ++
Sbjct: 171 ELKGNSTLEEAIRINETSKHRCVGLTIETRPDYCREEHIDRMLKL---GATRVELGVQTI 227

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ--RAL--- 195
               L    R H   + + A  L R+   ++ + ++  LP  +    E +L+  R +   
Sbjct: 228 YNDILERTKRGHTVRDVVEATRLLRDAGLKVVYHIMPGLPGSSF---ERDLEMFREIFED 284

Query: 196 -SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDL 235
             +  D L +Y   + +GT  Y++ K G+    +   AV+L
Sbjct: 285 PRFKPDMLKIYPTLVTRGTELYELWKRGEYKPYTTEEAVEL 325