RPSBLAST alignment for GI: 254780628 and conserved domain: PRK08599

>gnl|CDD|181496 PRK08599, PRK08599, coproporphyrinogen III oxidase; Provisional. Length = 377
 Score =  295 bits (757), Expect = 1e-80
 Identities = 130/379 (34%), Positives = 198/379 (52%), Gaps = 21/379 (5%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-----FIQSFLTEMQWMRQLTGPRSISSI 74
             Y+H PFC   C YCDFN      KV  +N     ++ + + EM     +     + +I
Sbjct: 3   SAYIHIPFCEHICYYCDFN------KVFIKNQPVDEYLDALIKEMNTY-AIRPFDKLKTI 55

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           + GGGTP+ +  + +  +L  I +N  +S   E T EANP  +     Q  + +GVNRIS
Sbjct: 56  YIGGGTPTALSAEQLERLLTAIHRNLPLSGLEEFTFEANPGDLTKEKLQVLKDSGVNRIS 115

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQR 193
           LGVQ+  ++ L+ +GR HN  +   AI  A+   F  +S DLIYALP QT+  ++  L +
Sbjct: 116 LGVQTFNDELLKKIGRTHNEEDVYEAIANAKKAGFDNISIDLIYALPGQTIEDFKESLAK 175

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL+  + H S Y L +E  T+FY + + G L LP E++  ++Y        AHG H YEI
Sbjct: 176 ALALDIPHYSAYSLILEPKTVFYNLMRKGKLRLPGEDLEAEMYEYLMDEMEAHGFHQYEI 235

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SN +  G ES HNL YW   +Y G G GA   V  G     I   KH   +LK + + G 
Sbjct: 236 SNFAKPGFESRHNLTYWNNEEYYGFGAGASGYVN-GVRYQNIGPIKH---YLKAINEEGL 291

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIER 370
             +E+  L+ ++Q +E + +GLR + G+S   +E   G++ +    E  + LQ QG +E 
Sbjct: 292 PRLEEHVLTKKEQMEEEMFLGLRKKSGVSKARFEEKFGQSFEDVFGETIQELQEQGLLEE 351

Query: 371 VQFSRLRCTQRGMTMLDSV 389
                +R T++G  + + V
Sbjct: 352 DD-DHVRLTKKGKFLGNEV 369