RPSBLAST alignment for GI: 254780628 and conserved domain: PRK08898

>gnl|CDD|181577 PRK08898, PRK08898, coproporphyrinogen III oxidase; Provisional. Length = 394
 Score =  309 bits (793), Expect = 1e-84
 Identities = 131/371 (35%), Positives = 210/371 (56%), Gaps = 16/371 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG--QENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           L +YVH+P+CV+KCPYCDFNSH  +      +  ++ +   +++    L   R + ++F 
Sbjct: 20  LSLYVHFPWCVRKCPYCDFNSHEWKDGGAIPEAAYLDALRADLEQALPLVWGRQVHTVFI 79

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     +  + EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 80  GGGTPSLLSAAGLDRLLSDVRALLPLDPDAEITLEANPGTFEAEKFAQFRASGVNRLSIG 139

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  +  L+ LGR H+ +EA AAI +A   F   + DL+YALP QT+ +   +++ AL+
Sbjct: 140 IQSFNDAHLKALGRIHDGAEARAAIEIAAKHFDNFNLDLMYALPGQTLDEALADVETALA 199

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLY LT+E  TLF K        LP ++ + D+ +  ++  +A G   YE+S +
Sbjct: 200 FGPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIEARLAAAGYAHYEVSAY 255

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSH-RVAISIE-KHPESWLKMVRKNGHA 314
           +  G +  HNLNYW++GDY+GIG GAH   K+    R+   +  KHP ++L+  +  G A
Sbjct: 256 AKPGRQCRHNLNYWQFGDYLGIGAGAHG--KLSFPDRILRQMRYKHPATYLEQAKA-GTA 312

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERV 371
           V E+  + +     EF++  LRL +G+    ++   G  L    E  L    ++G +ER 
Sbjct: 313 VQEEREVGARDLPFEFMLNALRLTDGVPAHLFQERTGLPL-AAIEPQLAAAEQRGLLER- 370

Query: 372 QFSRLRCTQRG 382
             +R+R T  G
Sbjct: 371 DHTRIRPTPLG 381