RPSBLAST alignment for GI: 254780628 and conserved domain: PRK09057

>gnl|CDD|181629 PRK09057, PRK09057, coproporphyrinogen III oxidase; Provisional. Length = 380
 Score =  614 bits (1587), Expect = e-177
 Identities = 225/376 (59%), Positives = 282/376 (75%), Gaps = 1/376 (0%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+YVHWPFC+ KCPYCDFNSHVR   + Q  F  +FL E+      TGPR+++SIFFGG
Sbjct: 5   FGLYVHWPFCLAKCPYCDFNSHVRH-AIDQARFAAAFLRELATEAARTGPRTLTSIFFGG 63

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P+ +A +LD IA+ W V+ ++EIT+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 64  GTPSLMQPETVAALLDAIARLWPVADDIEITLEANPTSVEAGRFRGYRAAGVNRVSLGVQ 123

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LRFLGR H+ +EA+AAI LAR IFPR+SFDLIYA P QT+  W  EL+ ALS A
Sbjct: 124 ALNDADLRFLGRLHSVAEALAAIDLAREIFPRVSFDLIYARPGQTLAAWRAELKEALSLA 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT FY +H  G L+LP E++A DLY LTQ IT+A GL AYEISNH+ 
Sbjct: 184 ADHLSLYQLTIEEGTAFYGLHAAGKLILPDEDLAADLYELTQEITAAAGLPAYEISNHAR 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYGDY GIGPGAH R+ +G  R A + EK PE+WL+ V +NGH ++E+
Sbjct: 244 PGAESRHNLTYWRYGDYAGIGPGAHGRLTLGGERHATATEKAPEAWLERVERNGHGIIEE 303

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L  E++ADEFL+MGLRLREGI +  +  L+GR LD E   +L  +G IER   SRLR 
Sbjct: 304 ERLDPEERADEFLLMGLRLREGIDLARYAALSGRPLDPERLADLIEEGLIERDGGSRLRA 363

Query: 379 TQRGMTMLDSVIANLA 394
           T  G  +LD+V+A+LA
Sbjct: 364 TPAGRLVLDAVVADLA 379