RPSBLAST alignment for GI: 254780628 and conserved domain: PRK09058

>gnl|CDD|181630 PRK09058, PRK09058, coproporphyrinogen III oxidase; Provisional. Length = 449
 Score =  118 bits (297), Expect = 3e-27
 Identities = 57/209 (27%), Positives = 95/209 (45%), Gaps = 18/209 (8%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQ--LTGPRSISSIFFGG 78
           +Y+H PFC   C +C F  +    +     +  + + E+       LT    I +++FGG
Sbjct: 64  LYIHIPFCRTHCTFCGFFQNAWNPEAVAR-YTDALIRELAMEADSPLTQSAPIHAVYFGG 122

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTP+ +  +++A ++  + +   ++ + EIT+E   +  +         AG NR S+GVQ
Sbjct: 123 GTPTALSAEDLARLITALREYLPLAPDCEITLEGRINGFDDEKADAALDAGANRFSIGVQ 182

Query: 139 SLEEQSLRFLGRNHNASEAIAAIH-LARNIFPRMSF--DLIYALPKQTMTQWEMELQRAL 195
           S   Q  R  GR  +  E +A +  L      R +   DLI+ LP QT   W+ +L    
Sbjct: 183 SFNTQVRRRAGRKDDREEVLARLEELVAR--DRAAVVCDLIFGLPGQTPEIWQQDLAIVR 240

Query: 196 SYAVDHLSLYQL----------TIEKGTL 214
              +D + LY L           +EKG L
Sbjct: 241 DLGLDGVDLYALNLLPGTPLAKAVEKGKL 269