RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase
[Candidatus Liberibacter asiaticus str. psy62]
         (395 letters)



>gnl|CDD|181629 PRK09057, PRK09057, coproporphyrinogen III oxidase; Provisional.
          Length = 380

 Score =  614 bits (1587), Expect = e-177
 Identities = 225/376 (59%), Positives = 282/376 (75%), Gaps = 1/376 (0%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
            G+YVHWPFC+ KCPYCDFNSHVR   + Q  F  +FL E+      TGPR+++SIFFGG
Sbjct: 5   FGLYVHWPFCLAKCPYCDFNSHVRH-AIDQARFAAAFLRELATEAARTGPRTLTSIFFGG 63

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL++P+ +A +LD IA+ W V+ ++EIT+EANP+SVE   F+GYR AGVNR+SLGVQ
Sbjct: 64  GTPSLMQPETVAALLDAIARLWPVADDIEITLEANPTSVEAGRFRGYRAAGVNRVSLGVQ 123

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +L +  LRFLGR H+ +EA+AAI LAR IFPR+SFDLIYA P QT+  W  EL+ ALS A
Sbjct: 124 ALNDADLRFLGRLHSVAEALAAIDLAREIFPRVSFDLIYARPGQTLAAWRAELKEALSLA 183

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
            DHLSLYQLTIE+GT FY +H  G L+LP E++A DLY LTQ IT+A GL AYEISNH+ 
Sbjct: 184 ADHLSLYQLTIEEGTAFYGLHAAGKLILPDEDLAADLYELTQEITAAAGLPAYEISNHAR 243

Query: 259 LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEK 318
            GAES HNL YWRYGDY GIGPGAH R+ +G  R A + EK PE+WL+ V +NGH ++E+
Sbjct: 244 PGAESRHNLTYWRYGDYAGIGPGAHGRLTLGGERHATATEKAPEAWLERVERNGHGIIEE 303

Query: 319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRC 378
           E L  E++ADEFL+MGLRLREGI +  +  L+GR LD E   +L  +G IER   SRLR 
Sbjct: 304 ERLDPEERADEFLLMGLRLREGIDLARYAALSGRPLDPERLADLIEEGLIERDGGSRLRA 363

Query: 379 TQRGMTMLDSVIANLA 394
           T  G  +LD+V+A+LA
Sbjct: 364 TPAGRLVLDAVVADLA 379


>gnl|CDD|180630 PRK06582, PRK06582, coproporphyrinogen III oxidase; Provisional.
          Length = 390

 Score =  382 bits (982), Expect = e-106
 Identities = 162/382 (42%), Positives = 232/382 (60%), Gaps = 9/382 (2%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIF 75
           +N L +Y+HWPFC+ KCPYCDFNSHV    +    +++S+  E+++ + +   + I SIF
Sbjct: 9   ANDLSIYIHWPFCLSKCPYCDFNSHVAS-TIDHNQWLKSYEKEIEYFKDIIQNKYIKSIF 67

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           FGGGTPSL+ P  +  I++ I+    + +  EIT+E NP+S E   F+ ++ AG+NR+S+
Sbjct: 68  FGGGTPSLMNPVIVEGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKLAGINRVSI 127

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRAL 195
           GVQSL+E  L+ LGR H+  +AI  I  A  IFPR+SFDLIYA   QT+  W+ EL++A+
Sbjct: 128 GVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFPRVSFDLIYARSGQTLKDWQEELKQAM 187

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
             A  H+SLYQLTIEKGT FYK+ K+G+L+LP  + A ++Y  T     +     YEISN
Sbjct: 188 QLATSHISLYQLTIEKGTPFYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISN 247

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHA 314
           ++ +G E LHNL YW Y  Y+GIGPGAHSR+   S  V AI +   PE WL  V+     
Sbjct: 248 YAKIGQECLHNLTYWNYNSYLGIGPGAHSRIIESSSSVSAIMMWHKPEKWLDAVKTKNVG 307

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN----LDIECERNLQRQGFIER 370
           +     L+ ++  +E LMMGLRL +GI++   E          LD+   ++ Q    I  
Sbjct: 308 IQTNTKLTHQEIIEEILMMGLRLSKGINISTLEQKLNTKLENILDMNNLKHYQALDLIRL 367

Query: 371 VQFSRLRCTQRGMTMLDSVIAN 392
            +   L  T +G+ ML S I  
Sbjct: 368 DENIYL--TDKGL-MLHSYIVP 386


>gnl|CDD|180187 PRK05660, PRK05660, HemN family oxidoreductase; Provisional.
          Length = 378

 Score =  310 bits (797), Expect = 3e-85
 Identities = 136/385 (35%), Positives = 208/385 (54%), Gaps = 30/385 (7%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           L +Y+H P+CV+KCPYCDFNSH  + +V ++ ++   L ++     L   R + SIF GG
Sbjct: 7   LSLYIHIPWCVQKCPYCDFNSHALKGEVPEDEYVDHLLADLDADLPLVQGREVHSIFIGG 66

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTPSL   + I  +LDG+      + + EIT+EANP +VE + F GY++AGVNRIS+GVQ
Sbjct: 67  GTPSLFSAEAIQRLLDGVRARLPFAPDAEITMEANPGTVEADRFVGYQRAGVNRISIGVQ 126

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSF--DLIYALPKQTMTQWEMELQRALS 196
           S  E+ L+ LGR H   EA  A  LA+ +  R SF  DL++ LP Q++ +   +L++A++
Sbjct: 127 SFSEEKLKRLGRIHGPDEAKRAAKLAQGLGLR-SFNLDLMHGLPDQSLEEALDDLRQAIA 185

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
               HLS YQLTIE  TLF         VLP ++   D++     + +A G   YE S +
Sbjct: 186 LNPPHLSWYQLTIEPNTLFGSRPP----VLPDDDALWDIFEQGHQLLTAAGYQQYETSAY 241

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIE-KHPESWLKMVRKNGHAV 315
           +  G +  HNLNYWR+GDY+GIG GAH ++     R+  + + KHP  ++          
Sbjct: 242 AKPGYQCQHNLNYWRFGDYLGIGCGAHGKLTFPDGRILRTWKTKHPRGYM---------- 291

Query: 316 VEKEFLSSEQQAD------EFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQG 366
            +  +L  ++  +      EF M   RL E     D+E   G    +   + +  L  QG
Sbjct: 292 -QGRYLDGQRDVEAADRPFEFFMNRFRLLEAAPRADFEAYTGLPESVIRPQLDEALA-QG 349

Query: 367 FIERVQFSRLRCTQRGMTMLDSVIA 391
           ++        + T+ G   L+ ++ 
Sbjct: 350 YL-TETADHWQITEHGKLFLNDLLE 373


>gnl|CDD|181577 PRK08898, PRK08898, coproporphyrinogen III oxidase; Provisional.
          Length = 394

 Score =  309 bits (793), Expect = 1e-84
 Identities = 131/371 (35%), Positives = 210/371 (56%), Gaps = 16/371 (4%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVG--QENFIQSFLTEMQWMRQLTGPRSISSIFF 76
           L +YVH+P+CV+KCPYCDFNSH  +      +  ++ +   +++    L   R + ++F 
Sbjct: 20  LSLYVHFPWCVRKCPYCDFNSHEWKDGGAIPEAAYLDALRADLEQALPLVWGRQVHTVFI 79

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTPSL+    +  +L  +     +  + EIT+EANP + E   F  +R +GVNR+S+G
Sbjct: 80  GGGTPSLLSAAGLDRLLSDVRALLPLDPDAEITLEANPGTFEAEKFAQFRASGVNRLSIG 139

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALS 196
           +QS  +  L+ LGR H+ +EA AAI +A   F   + DL+YALP QT+ +   +++ AL+
Sbjct: 140 IQSFNDAHLKALGRIHDGAEARAAIEIAAKHFDNFNLDLMYALPGQTLDEALADVETALA 199

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNH 256
           +   HLSLY LT+E  TLF K        LP ++ + D+ +  ++  +A G   YE+S +
Sbjct: 200 FGPPHLSLYHLTLEPNTLFAKFPP----ALPDDDASADMQDWIEARLAAAGYAHYEVSAY 255

Query: 257 SFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSH-RVAISIE-KHPESWLKMVRKNGHA 314
           +  G +  HNLNYW++GDY+GIG GAH   K+    R+   +  KHP ++L+  +  G A
Sbjct: 256 AKPGRQCRHNLNYWQFGDYLGIGAGAHG--KLSFPDRILRQMRYKHPATYLEQAKA-GTA 312

Query: 315 VVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQ---RQGFIERV 371
           V E+  + +     EF++  LRL +G+    ++   G  L    E  L    ++G +ER 
Sbjct: 313 VQEEREVGARDLPFEFMLNALRLTDGVPAHLFQERTGLPL-AAIEPQLAAAEQRGLLER- 370

Query: 372 QFSRLRCTQRG 382
             +R+R T  G
Sbjct: 371 DHTRIRPTPLG 381


>gnl|CDD|181496 PRK08599, PRK08599, coproporphyrinogen III oxidase; Provisional.
          Length = 377

 Score =  295 bits (757), Expect = 1e-80
 Identities = 130/379 (34%), Positives = 198/379 (52%), Gaps = 21/379 (5%)

Query: 20  GVYVHWPFCVKKCPYCDFNSHVRRYKVGQEN-----FIQSFLTEMQWMRQLTGPRSISSI 74
             Y+H PFC   C YCDFN      KV  +N     ++ + + EM     +     + +I
Sbjct: 3   SAYIHIPFCEHICYYCDFN------KVFIKNQPVDEYLDALIKEMNTY-AIRPFDKLKTI 55

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRIS 134
           + GGGTP+ +  + +  +L  I +N  +S   E T EANP  +     Q  + +GVNRIS
Sbjct: 56  YIGGGTPTALSAEQLERLLTAIHRNLPLSGLEEFTFEANPGDLTKEKLQVLKDSGVNRIS 115

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQR 193
           LGVQ+  ++ L+ +GR HN  +   AI  A+   F  +S DLIYALP QT+  ++  L +
Sbjct: 116 LGVQTFNDELLKKIGRTHNEEDVYEAIANAKKAGFDNISIDLIYALPGQTIEDFKESLAK 175

Query: 194 ALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI 253
           AL+  + H S Y L +E  T+FY + + G L LP E++  ++Y        AHG H YEI
Sbjct: 176 ALALDIPHYSAYSLILEPKTVFYNLMRKGKLRLPGEDLEAEMYEYLMDEMEAHGFHQYEI 235

Query: 254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGH 313
           SN +  G ES HNL YW   +Y G G GA   V  G     I   KH   +LK + + G 
Sbjct: 236 SNFAKPGFESRHNLTYWNNEEYYGFGAGASGYVN-GVRYQNIGPIKH---YLKAINEEGL 291

Query: 314 AVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDI---ECERNLQRQGFIER 370
             +E+  L+ ++Q +E + +GLR + G+S   +E   G++ +    E  + LQ QG +E 
Sbjct: 292 PRLEEHVLTKKEQMEEEMFLGLRKKSGVSKARFEEKFGQSFEDVFGETIQELQEQGLLEE 351

Query: 371 VQFSRLRCTQRGMTMLDSV 389
                +R T++G  + + V
Sbjct: 352 DD-DHVRLTKKGKFLGNEV 369


>gnl|CDD|129630 TIGR00539, hemN_rel, putative oxygen-independent coproporphyrinogen
           III oxidase.  Experimentally determined examples of
           oxygen-independent coproporphyrinogen III oxidase, an
           enzyme that replaces HemF function under anaerobic
           conditions, belong to a family of proteins described by
           the model hemN. This model, hemN_rel, models a closely
           related protein, shorter at the amino end and lacking
           the region containing the motif PYRT[SC]YP found in
           members of the hemN family. Several species, including
           E. coli, Helicobacter pylori, Aquifex aeolicus, and
           Chlamydia trachomatis, have members of both this family
           and the E. coli hemN family. The member of this family
           from Bacillus subtilis was shown to complement an
           hemF/hemN double mutant of Salmonella typimurium and to
           prevent accumulation of coproporphyrinogen III under
           anaerobic conditions, but the exact role of this protein
           is still uncertain. It is found in a number of species
           that do not synthesize heme de novo.
          Length = 360

 Score =  277 bits (711), Expect = 3e-75
 Identities = 110/359 (30%), Positives = 177/359 (49%), Gaps = 13/359 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGG 78
           + +Y+H PFC  KC YCDFNS+  +    +E + Q+   +++     T    + SIF GG
Sbjct: 1   MSLYIHIPFCENKCGYCDFNSYENKSGPKEE-YTQALCQDLKHALSQTDQEPLESIFIGG 59

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTP+ +  +    + + I ++ ++S + EIT EANP  +     +G + AG+NR+SLGVQ
Sbjct: 60  GTPNTLSVEAFERLFESIYQHASLSDDCEITTEANPELITAEWCKGLKGAGINRLSLGVQ 119

Query: 139 SLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSY 197
           S  +  L FLGR H+A     AI  A       +S DL+Y LP QT+   + EL+ A   
Sbjct: 120 SFRDDKLLFLGRQHSAKNIAPAIETALKSGIENISLDLMYGLPLQTLNSLKEELKLAKEL 179

Query: 198 AVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHS 257
            ++HLS Y L++E  T F K  K     LP ++       + + I    G   YE+SN++
Sbjct: 180 PINHLSAYALSVEPNTNFEKNAKK----LPDDDSCAHFDEVVREILEGFGFKQYEVSNYA 235

Query: 258 FLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVE 317
             G +  HNL YW   DY+G G GAH    V + R      K  ++++K   + G   + 
Sbjct: 236 KAGYQVKHNLAYWGAKDYLGCGAGAHG--CVANERFFAK--KLIKNYIKDPLQRGVETLN 291

Query: 318 KEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQGFIERVQF 373
           ++ +  + +  E L +GLR   G+    ++   G +     IE  +   +   +     
Sbjct: 292 EKNVPKQDKRLEKLFLGLRCVLGVEKSFFDENKGLSQVKFLIEENKAFIKNNRLINSDS 350


>gnl|CDD|180172 PRK05628, PRK05628, coproporphyrinogen III oxidase; Validated.
          Length = 375

 Score =  271 bits (696), Expect = 2e-73
 Identities = 137/385 (35%), Positives = 195/385 (50%), Gaps = 24/385 (6%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVR---RYKVGQENFIQSFLTEMQWMRQLTG--PRSISS 73
            GVYVH PFC  +C YCDFN++           + ++ +   E++    + G     +S+
Sbjct: 3   FGVYVHVPFCATRCGYCDFNTYTAAELGGGASPDGYLDALRAELELAAAVLGDPAPPVST 62

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +F GGGTPSL+  + +A +LD +   + ++   E+T EANP S     F   R AG  R+
Sbjct: 63  VFVGGGTPSLLGAEGLARVLDAVRDTFGLAPGAEVTTEANPESTSPEFFAALRAAGFTRV 122

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQ 192
           SLG+QS     L  L R H    A+AA   AR   F  ++ DLIY  P ++   W   L 
Sbjct: 123 SLGMQSAAPHVLAVLDRTHTPGRAVAAAREARAAGFEHVNLDLIYGTPGESDDDWRASLD 182

Query: 193 RALSYAVDHLSLYQLTIEKGT-LFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY 251
            AL   VDH+S Y L +E GT L  ++ + G+L  P ++V  D Y L  +  SA G   Y
Sbjct: 183 AALEAGVDHVSAYALIVEDGTALARRVRR-GELPAPDDDVLADRYELADARLSAAGFDWY 241

Query: 252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHR---VAISIEKHPESWLKMV 308
           E+SN +  G E  HNL YWR GD+ G GPGAHS   VG  R   V     KHP ++   +
Sbjct: 242 EVSNWARPGGECRHNLGYWRGGDWWGAGPGAHSH--VGGVRWWNV-----KHPAAYAARL 294

Query: 309 RKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFI 368
                 V  +E L +E +  E +M+GLRLREG+ +   +  A R       R +   G +
Sbjct: 295 AAGALPVAGREVLDAEDRHVERVMLGLRLREGLPLALLDA-AERA---RAAR-VVADGLL 349

Query: 369 ERVQFSRLRCTQRGMTMLDSVIANL 393
                 RL  T RG  + D+V+ +L
Sbjct: 350 AAEG-GRLVLTLRGRLLADAVVRDL 373


>gnl|CDD|180263 PRK05799, PRK05799, coproporphyrinogen III oxidase; Provisional.
          Length = 374

 Score =  269 bits (691), Expect = 7e-73
 Identities = 123/379 (32%), Positives = 205/379 (54%), Gaps = 18/379 (4%)

Query: 17  NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFF 76
             + +Y+H PFC +KC YCDF S+  +  +    +I++   E+   R  T  + I SIF 
Sbjct: 2   KEISLYIHIPFCKQKCLYCDFPSYSGKEDL-MMEYIKALSKEI---RNSTKNKKIKSIFI 57

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+ +  + +  IL    K      ++E T+E NP +      +  +  GVNR+S+G
Sbjct: 58  GGGTPTYLSLEALE-ILKETIKKLNKKEDLEFTVEGNPGTFTEEKLKILKSMGVNRLSIG 116

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRAL 195
           +Q+ +   L++LGR H   E +    LAR + F  ++ DL++ LP QT+  W+  L++ +
Sbjct: 117 LQAWQNSLLKYLGRIHTFEEFLENYKLARKLGFNNINVDLMFGLPNQTLEDWKETLEKVV 176

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISN 255
               +H+S Y L IE+GT FY ++++G L LP E    ++Y+ T       G H YEISN
Sbjct: 177 ELNPEHISCYSLIIEEGTPFYNLYENGKLKLPDEEEEREMYHYTIEFLKEKGYHQYEISN 236

Query: 256 HSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAV 315
            +  G E  HNL YW   +YIG G GAHS V    +    +IEK    ++K + +N  AV
Sbjct: 237 FAKPGKECRHNLVYWDLEEYIGCGAGAHSYVNGKRYENISNIEK----YIKEINENNSAV 292

Query: 316 VEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNL-----DIECERNLQRQGFIER 370
            E    S +   +EF+ MGLR  +GI ++D++   G+N+     ++   + + + G +  
Sbjct: 293 EEIHKNSIKDNMEEFMFMGLRKIKGICIEDFKKRFGKNIYEVYGEV-INKYI-KLGLLIE 350

Query: 371 VQFSRLRCTQRGMTMLDSV 389
            +  R+  ++RG+ + +S+
Sbjct: 351 -KEGRIYLSERGIEVSNSI 368


>gnl|CDD|180953 PRK07379, PRK07379, coproporphyrinogen III oxidase; Provisional.
          Length = 400

 Score =  240 bits (614), Expect = 6e-64
 Identities = 127/388 (32%), Positives = 203/388 (52%), Gaps = 23/388 (5%)

Query: 21  VYVHWPFCVKKCPYCDFNSHV--RRYKVGQENFIQSFLTEMQWMRQ-----LTGPRSISS 73
            Y+H PFC ++C YCDF   V   R + G    I+ ++   + + Q      +  + + +
Sbjct: 13  AYIHIPFCRRRCFYCDFPISVVGDRTRGGTSGLIEEYV---EVLCQEIAITPSFGQPLQT 69

Query: 74  IFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRI 133
           +FFGGGTPSL+  + +  IL  + + + ++ + EI++E +P + ++   QGYR  GVNR+
Sbjct: 70  VFFGGGTPSLLSVEQLERILTTLDQRFGIAPDAEISLEIDPGTFDLEQLQGYRSLGVNRV 129

Query: 134 SLGVQSLEEQSLRFLGRNHNASEAIAAI-HLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           SLGVQ+ +++ L   GR+H   +  AA+  + +      S DLI  LP QT+  W+  L+
Sbjct: 130 SLGVQAFQDELLALCGRSHRVKDIFAAVDLIHQAGIENFSLDLISGLPHQTLEDWQASLE 189

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYE 252
            A++    HLS Y L +E GT F K ++ G   LPS+     +Y L Q I +  G   YE
Sbjct: 190 AAIALNPTHLSCYDLVLEPGTAFGKQYQPGKAPLPSDETTAAMYRLAQEILTQAGYEHYE 249

Query: 253 ISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRV---KVGSHRVAISIEKHPESWLKMVR 309
           ISN++  G +  HN  YW    Y G G GA S V   +    R      K    W++ + 
Sbjct: 250 ISNYAKPGYQCRHNRVYWENRPYYGFGMGAASYVNGQRFTRPRT----RKEYYQWVEALI 305

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLD---IECERNLQRQG 366
            NG  +++ E  S E +  E LM+GLRL EG+S+       G+ +    ++C +   +QG
Sbjct: 306 ANG-GLIDGEPSSPEDELLETLMLGLRLAEGVSLSALTERFGKEIVEQILQCLQPYFQQG 364

Query: 367 FIERVQFSRLRCTQ-RGMTMLDSVIANL 393
           ++E     RLR T   G    ++V+A+L
Sbjct: 365 WVELEGDRRLRLTDPEGFLFSNTVLASL 392


>gnl|CDD|180518 PRK06294, PRK06294, coproporphyrinogen III oxidase; Provisional.
          Length = 370

 Score =  222 bits (567), Expect = 1e-58
 Identities = 111/337 (32%), Positives = 180/337 (53%), Gaps = 17/337 (5%)

Query: 15  GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQE---NFIQSFLTE-MQWMRQLTGPRS 70
           G + L +Y+H PFC KKC YC F  +   YK  +E    +  + L E ++ +  L     
Sbjct: 3   GKSPLALYIHIPFCTKKCHYCSF--YTIPYK--EESVSLYCNAVLKEGLKKLAPLRCSHF 58

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGV 130
           I ++FFGGGTPSL+ P  I  IL  +          EIT+EANP ++  +  +     G+
Sbjct: 59  IDTVFFGGGTPSLVPPALIQDILKTLEAP----HATEITLEANPENLSESYIRALALTGI 114

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEM 189
           NRIS+GVQ+ ++  L+ LGR H++S+AI A+       F  +S DLIY LP Q+++ + +
Sbjct: 115 NRISIGVQTFDDPLLKLLGRTHSSSKAIDAVQECSEHGFSNLSIDLIYGLPTQSLSDFIV 174

Query: 190 ELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLH 249
           +L +A++  + H+SLY LTI+  T FYK  K     +  E +  ++    + + ++ G  
Sbjct: 175 DLHQAITLPITHISLYNLTIDPHTSFYKHRKRLLPSIADEEILAEMSLAAEELLTSQGFT 234

Query: 250 AYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVR 309
            YE+++++   A+S HN  YW    ++G+G  A   +  G     +S   H   +L+ +R
Sbjct: 235 RYELASYAKPQAQSKHNTYYWTDRPFLGLGVSASQYLH-GIRSKNLSRISH---YLRALR 290

Query: 310 KNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDW 346
           KN       E L   ++  E L + LRL EGI + D+
Sbjct: 291 KNLPTQESSEELPPNERIKEALALRLRLCEGIPLADF 327


>gnl|CDD|181428 PRK08446, PRK08446, coproporphyrinogen III oxidase; Provisional.
          Length = 350

 Score =  220 bits (562), Expect = 6e-58
 Identities = 114/323 (35%), Positives = 163/323 (50%), Gaps = 23/323 (7%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y+H PFC  KC YC FNS+  ++ + ++ ++Q+   ++++  +      I S+F GGGTP
Sbjct: 4   YIHIPFCESKCGYCAFNSYENKHDL-KKEYMQALCLDLKFELEQFTDEKIESVFIGGGTP 62

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           S +  +    I + I+    +S + EIT EANP+S      +G +  GVNRIS GVQS  
Sbjct: 63  STVSAKFYEPIFEIISPY--LSKDCEITTEANPNSATKAWLKGMKNLGVNRISFGVQSFN 120

Query: 142 EQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVD 200
           E  L+FLGR H+  + I AI  A+   F  +S DLIY  P       + EL+ A    ++
Sbjct: 121 EDKLKFLGRIHSQKQIIKAIENAKKAGFENISIDLIYDTPLDNKKLLKEELKLAKELPIN 180

Query: 201 HLSLYQLTIEKGTLFY-KMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFL 259
           HLS Y LTIE+ T F+ K HK  D     EN+A       + +    G   YEISN    
Sbjct: 181 HLSAYSLTIEENTPFFEKNHKKKD----DENLA---KFFIEQL-EELGFKQYEISNFG-K 231

Query: 260 GAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKE 319
             +  HNL YW+  DY+G G GA   V         ++E + ++ LK          E E
Sbjct: 232 NYQCKHNLGYWQGKDYLGCGAGAVGFVANKRFYPKKNLENYIKNPLK---------REIE 282

Query: 320 FLSSEQQADEFLMMGLRLREGIS 342
            LS E    E L +GLR   G+ 
Sbjct: 283 TLSEEDLRLEKLFLGLRSIVGVD 305


>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM.
           This superfamily contains MoaA, NifB, PqqE,
           coproporphyrinogen III oxidase, biotin synthase and MiaB
           families, and includes a representative in the
           eukaryotic elongator subunit, Elp-3. Some members of the
           family are methyltransferases.
          Length = 216

 Score =  163 bits (415), Expect = 7e-41
 Identities = 61/221 (27%), Positives = 117/221 (52%), Gaps = 7/221 (3%)

Query: 18  SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWM-RQLTGPRSISSIFF 76
            L +Y+    C ++C +C F S   + +     ++++ + E++ +  +      + ++F 
Sbjct: 1   PLALYIITRGCPRRCTFCSFPSARGKLR---SRYLEALVREIELLAEKGEKEILVGTVFI 57

Query: 77  GGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           GGGTP+L+ P+ +  +L+ I +   ++ +VEITIE  P ++     +  ++AGVNR+SLG
Sbjct: 58  GGGTPTLLSPEQLEELLEAIREILGLADDVEITIETRPGTLTEELLEALKEAGVNRVSLG 117

Query: 137 VQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQTMTQWEMELQRAL 195
           VQS  ++ L+ + R H   + + A+   R   P ++S DLI  LP +T   +E  L+   
Sbjct: 118 VQSGSDEVLKAINRGHTVEDVLEAVEKLREAGPIKVSTDLIVGLPGETEEDFEETLKLLK 177

Query: 196 SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLY 236
               D +S++ L+   GT   K++K   L  P +   ++L 
Sbjct: 178 ELGPDRVSIFPLSPRPGTPLAKLYK--RLKPPDKEERLELL 216


>gnl|CDD|135651 PRK05904, PRK05904, coproporphyrinogen III oxidase; Provisional.
          Length = 353

 Score =  149 bits (379), Expect = 8e-37
 Identities = 92/327 (28%), Positives = 154/327 (47%), Gaps = 29/327 (8%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGT 80
           +Y+H PFC   C +CDF   ++  +   +   + FL  ++   +    +   +I+ GGGT
Sbjct: 9   LYIHIPFCQYICTFCDFKRILKTPQ--TKKIFKDFLKNIKMHIKNFKIKQFKTIYLGGGT 66

Query: 81  PSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSL 140
           P+ +  Q + ++L  I     V +N E TIE NP  +  +     +K  VNRISLGVQS+
Sbjct: 67  PNCLNDQLLDILLSTIKP--YVDNNCEFTIECNPELITQSQINLLKKNKVNRISLGVQSM 124

Query: 141 EEQSLRFLGRNHNASEAIAAIH-LARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAV 199
               L+ L R H   ++  AI+ L +N    +S D +Y LP   +   +      L + +
Sbjct: 125 NNNILKQLNRTHTIQDSKEAINLLHKNGIYNISCDFLYCLPILKLKDLDEVFNFILKHKI 184

Query: 200 DHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGL--HAYEISNHS 257
           +H+S Y L I++G++  K H        + +   +   L       + L    YE+SN +
Sbjct: 185 NHISFYSLEIKEGSILKKYHY-------TIDEDKEAEQLNYIKAKFNKLNYKRYEVSNWT 237

Query: 258 FLGA-ESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVV 316
                 S HNL YWR  D+  IG GAH              E + E +     +N   ++
Sbjct: 238 NNFKYISKHNLAYWRTKDWAAIGWGAH------------GFENNIEYFFDGSIQN--WIL 283

Query: 317 EKEFLSSEQQADEFLMMGLRLREGISV 343
            K+ L+  +   + L+MGLRL++G+ +
Sbjct: 284 IKKVLTDHELYQQILIMGLRLKDGLDL 310


>gnl|CDD|181291 PRK08207, PRK08207, coproporphyrinogen III oxidase; Provisional.
          Length = 488

 Score =  131 bits (331), Expect = 4e-31
 Identities = 60/245 (24%), Positives = 127/245 (51%), Gaps = 14/245 (5%)

Query: 16  SNSLGVYVHWPFCVKKCPYCDFNSH-VRRYKVGQENFIQSFLTEM----QWMRQLTGPRS 70
            N + +Y+  PFC  +C YC F S+ ++ YK   E ++++   E+    +++++      
Sbjct: 161 KNEVSIYIGIPFCPTRCLYCSFPSYPIKGYKGLVEPYLEALHYEIEEIGKYLKEK--GLK 218

Query: 71  ISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNV-EITIEAN-PSSVEVNNFQGYRKA 128
           I++I+FGGGTP+ +  + +  +L+ I +N+    NV E T+EA  P ++     +  +K 
Sbjct: 219 ITTIYFGGGTPTSLTAEELERLLEEIYENFPDVKNVKEFTVEAGRPDTITEEKLEVLKKY 278

Query: 129 GVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQW 187
           GV+RIS+  Q++ +++L+ +GR+H   + I   HLAR + F  ++ DLI  LP + + + 
Sbjct: 279 GVDRISINPQTMNDETLKAIGRHHTVEDIIEKFHLAREMGFDNINMDLIIGLPGEGLEEV 338

Query: 188 EMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLV-LPSENVAVDLYNLTQSITSAH 246
           +  L+       + L+++ L I++ +   ++ ++ +   +        +    +      
Sbjct: 339 KHTLEEIEKLNPESLTVHTLAIKRAS---RLTENKEKYKVADREEIEKMMEEAEEWAKEL 395

Query: 247 GLHAY 251
           G   Y
Sbjct: 396 GYVPY 400


>gnl|CDD|181292 PRK08208, PRK08208, coproporphyrinogen III oxidase; Validated.
          Length = 430

 Score =  127 bits (320), Expect = 6e-30
 Identities = 94/404 (23%), Positives = 164/404 (40%), Gaps = 53/404 (13%)

Query: 13  GQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFL----TEMQWMRQLTGP 68
            +  ++L +Y+H PFC  +C +C+  +           FI S+L     + + + +   P
Sbjct: 34  REYEDALSLYIHIPFCEMRCGFCNLFT----RTGADAEFIDSYLDALIRQAEQVAEALAP 89

Query: 69  RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTV-SSNVEITIEANPSSVEVNNFQGYRK 127
              +S   GGGTP+L+    +  + D + +   V   N+  ++E +P++           
Sbjct: 90  ARFASFAVGGGTPTLLNAAELEKLFDSVERVLGVDLGNIPKSVETSPATTTAEKLALLAA 149

Query: 128 AGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQ 186
            GVNR+S+GVQS  +  L  L R    ++   A+   R   FP ++ DLIY +P QT   
Sbjct: 150 RGVNRLSIGVQSFHDSELHALHRPQKRADVHQALEWIRAAGFPILNIDLIYGIPGQTHAS 209

Query: 187 WEMELQRALSYAVDHLSLYQLTIEKGT-LFYKMHKDGDLVLPSENVAVDLYNLTQSITSA 245
           W   L +AL Y  + L LY L +   T L  +     D  L        LY L + +   
Sbjct: 210 WMESLDQALVYRPEELFLYPLYVRPLTGLGRRARAWDDQRL-------SLYRLARDLLLE 262

Query: 246 HGLHAYE-ISNHSFLGAESLHNLNYWRYGDY-------IGIGPGAHS---------RVKV 288
            G   Y   S   F   ++           Y       +G+G GA S            V
Sbjct: 263 AG---YTQTSMRMFRRNDA----PDKGAPAYSCQTDGMLGLGCGARSYTGNLHYSSPYAV 315

Query: 289 GSHRVAISIEKHPESWLKMVRKNGHAVVEKEF-LSSEQQADEFLMMGLRLREGISVKDWE 347
               +   I+ +       +      V E  + LS ++    F++  L   +G+ + D+ 
Sbjct: 316 NQQTIRSIIDDY-------IATPDFTVAEHGYLLSEDEMKRRFIIKSLLQAQGLDLADYR 368

Query: 348 MLAGRNLDIECE--RNLQRQGFIERVQFSRLRCTQRGMTMLDSV 389
              G +   +      L  +G++E+    RLR T+ G+ + D++
Sbjct: 369 QRFGSDPLRDFPELELLIDRGWLEQ-NGGRLRLTEEGLALSDAI 411


>gnl|CDD|181630 PRK09058, PRK09058, coproporphyrinogen III oxidase; Provisional.
          Length = 449

 Score =  118 bits (297), Expect = 3e-27
 Identities = 57/209 (27%), Positives = 95/209 (45%), Gaps = 18/209 (8%)

Query: 21  VYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQ--LTGPRSISSIFFGG 78
           +Y+H PFC   C +C F  +    +     +  + + E+       LT    I +++FGG
Sbjct: 64  LYIHIPFCRTHCTFCGFFQNAWNPEAVAR-YTDALIRELAMEADSPLTQSAPIHAVYFGG 122

Query: 79  GTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQ 138
           GTP+ +  +++A ++  + +   ++ + EIT+E   +  +         AG NR S+GVQ
Sbjct: 123 GTPTALSAEDLARLITALREYLPLAPDCEITLEGRINGFDDEKADAALDAGANRFSIGVQ 182

Query: 139 SLEEQSLRFLGRNHNASEAIAAIH-LARNIFPRMSF--DLIYALPKQTMTQWEMELQRAL 195
           S   Q  R  GR  +  E +A +  L      R +   DLI+ LP QT   W+ +L    
Sbjct: 183 SFNTQVRRRAGRKDDREEVLARLEELVAR--DRAAVVCDLIFGLPGQTPEIWQQDLAIVR 240

Query: 196 SYAVDHLSLYQL----------TIEKGTL 214
              +D + LY L           +EKG L
Sbjct: 241 DLGLDGVDLYALNLLPGTPLAKAVEKGKL 269


>gnl|CDD|181727 PRK09249, PRK09249, coproporphyrinogen III oxidase; Provisional.
          Length = 453

 Score =  117 bits (296), Expect = 5e-27
 Identities = 54/191 (28%), Positives = 99/191 (51%), Gaps = 6/191 (3%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHV-RRYKVGQENFIQSFLTEMQWMR--QLTGPRSISSIF 75
           L +YVH PFC   C YC  N  + R ++     ++ +   E+  +    L   R +S + 
Sbjct: 50  LSLYVHIPFCRSLCYYCGCNKIITRDHEKADP-YLDALEKEIA-LVAALLGPGRPVSQLH 107

Query: 76  FGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISL 135
           +GGGTP+ + P+ +  ++  + +++  + + EI+IE +P  +++      R+ G NR+SL
Sbjct: 108 WGGGTPTFLSPEQLRRLMALLREHFNFAPDAEISIEIDPRELDLEMLDALRELGFNRLSL 167

Query: 136 GVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRA 194
           GVQ  + +  + + R        A +  AR + F  ++ DLIY LPKQT   +   L++ 
Sbjct: 168 GVQDFDPEVQKAVNRIQPFEFTFALVEAARELGFTSINIDLIYGLPKQTPESFARTLEKV 227

Query: 195 LSYAVDHLSLY 205
           L    D L+++
Sbjct: 228 LELRPDRLAVF 238


>gnl|CDD|129629 TIGR00538, hemN, oxygen-independent coproporphyrinogen III oxidase.
            This model represents HemN, the oxygen-independent
           coproporphyrinogen III oxidase that replaces HemF
           function under anaerobic conditions. Several species,
           including E. coli, Helicobacter pylori, and Aquifex
           aeolicus, have both a member of this family and a member
           of another, closely related family for which there is no
           evidence of coproporphyrinogen III oxidase activity.
           Members of this family have a perfectly conserved motif
           PYRT[SC]YP in a region N-terminal to the region of
           homology with the related uncharacterized protein.
          Length = 455

 Score =  117 bits (294), Expect = 7e-27
 Identities = 60/212 (28%), Positives = 104/212 (49%), Gaps = 3/212 (1%)

Query: 19  LGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQL-TGPRSISSIFFG 77
           L +YVH PFC K C +C  N  + R K   + ++ +   E+  +  L  G R +S + +G
Sbjct: 50  LSLYVHIPFCHKACYFCGCNVIITRQKHKADPYLDALEKEIALVAPLFDGNRHVSQLHWG 109

Query: 78  GGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGV 137
           GGTP+ + P+ I+ ++  I +N+  +++ EI+IE +P  +  +     R  G NR+S GV
Sbjct: 110 GGTPTYLSPEQISRLMKLIRENFPFNADAEISIEIDPRYITKDVIDALRDEGFNRLSFGV 169

Query: 138 QSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQTMTQWEMELQRALS 196
           Q   ++  + + R          ++ AR   F  ++ DLIY LPKQT   +   L++   
Sbjct: 170 QDFNKEVQQAVNRIQPEEMIFELMNHAREAGFTSINIDLIYGLPKQTKESFAKTLEKVAE 229

Query: 197 YAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPS 228
              D L+++        +     K  +  LPS
Sbjct: 230 LNPDRLAVFNYA-HVPWVKPAQRKIPEAALPS 260


>gnl|CDD|148535 pfam06969, HemN_C, HemN C-terminal region.  Members of this family
           are all oxygen-independent coproporphyrinogen-III
           oxidases (HemN). This enzyme catalyses the
           oxygen-independent conversion of coproporphyrinogen-III
           to protoporphyrinogen-IX, one of the last steps in haem
           biosynthesis. The function of this domain is unclear,
           but comparison to other proteins containing a radical
           SAM domain (pfam04055) suggest it may be a substrate
           binding domain.
          Length = 118

 Score =  114 bits (287), Expect = 5e-26
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 6/120 (5%)

Query: 267 LNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQ 326
           L YWR GDY+G+GPGAHS +  G  R      K  +++LK V   G  +   E LS E +
Sbjct: 1   LGYWRGGDYLGLGPGAHSFIDGGGVRY--QNVKDLKAYLKAVEAGGLPIERGERLSPEDR 58

Query: 327 ADEFLMMGLRLREGISVKDWEMLAGRNLDIECE---RNLQRQGFIERVQFSRLRCTQRGM 383
             E L++GLRL EG+ +  +E   G + + E E     LQ  G +E +   RLR T RG 
Sbjct: 59  LRERLILGLRLTEGLDLAAFEQRFGLDFEEEYEPLLEKLQEDGLLE-LDDGRLRLTPRGR 117


>gnl|CDD|171993 PRK13347, PRK13347, coproporphyrinogen III oxidase; Provisional.
          Length = 453

 Score =  107 bits (269), Expect = 6e-24
 Identities = 49/207 (23%), Positives = 95/207 (45%), Gaps = 9/207 (4%)

Query: 5   SAYENNMTGQGSN-SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMR 63
             Y   +   G    + +Y+H PFC   C +C  N+ + +     E ++ + + E++ + 
Sbjct: 36  DTYREWLRQIGPEEPVSLYLHVPFCRSLCWFCGCNTIITQRDAPVEAYVAALIREIRLVA 95

Query: 64  QLTGP-RSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNF 122
                 R +S + +GGGTP+++ P     ++  +   +  +   EI +E +P +V     
Sbjct: 96  ASLPQRRRVSQLHWGGGTPTILNPDQFERLMAALRDAFDFAPEAEIAVEIDPRTVTAEML 155

Query: 123 QGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI----FPRMSFDLIYA 178
           Q     G NR S GVQ  + Q  + + R     E + A      +    F  ++FDLIY 
Sbjct: 156 QALAALGFNRASFGVQDFDPQVQKAINRIQ--PEEMVA-RAVELLRAAGFESINFDLIYG 212

Query: 179 LPKQTMTQWEMELQRALSYAVDHLSLY 205
           LP QT+  +   L + ++ + D ++++
Sbjct: 213 LPHQTVESFRETLDKVIALSPDRIAVF 239


>gnl|CDD|181509 PRK08629, PRK08629, coproporphyrinogen III oxidase; Provisional.
          Length = 433

 Score = 94.0 bits (234), Expect = 7e-20
 Identities = 71/267 (26%), Positives = 124/267 (46%), Gaps = 19/267 (7%)

Query: 22  YVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTP 81
           Y H PFC   CPYC F+    +    +  FI S   EM+ +++L G     S++ GGGT 
Sbjct: 56  YAHVPFCHTLCPYCSFHRFYFKEDKARAYFI-SLRKEMEMVKEL-GYD-FESMYVGGGTT 112

Query: 82  SLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLE 141
           +++E + +A  L+ +AK   + S  E++ E++P+ ++    +   K  ++R+S+GVQS  
Sbjct: 113 TILEDE-LAKTLE-LAK--KLFSIKEVSCESDPNHLDPPKLKQL-KGLIDRLSIGVQSFN 167

Query: 142 EQSLRFLGRNH---NASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYA 198
           +  L+ + R     +  E    I  A+ +FP ++ DLI+  P QT    + +L  A    
Sbjct: 168 DDILKMVDRYEKFGSGQETFEKIMKAKGLFPIINVDLIFNFPGQTDEVLQHDLDIAKRLD 227

Query: 199 VDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSF 258
              ++ Y L     T   +    G L    ++     Y   Q I    G +  ++S  +F
Sbjct: 228 PRQITTYPLMKSHQT---RKSVKGSLGASQKDNERQYY---QIINELFGQY-NQLSAWAF 280

Query: 259 LGAESLHNLNY-WRYGDYIGIGPGAHS 284
                     Y   Y +Y+G+G G+ S
Sbjct: 281 SKKNDEGFDEYVIDYDEYLGVGSGSFS 307


>gnl|CDD|162253 TIGR01211, ELP3, histone acetyltransferase, ELP3 family.  The
           Saccharomyces cerevisiae member YPL086C has been
           characterized in vitro as an N-terminal
           acetyltransferase for all four core histones. It is a
           component of the RNA polymerase II holoenzyme,
           designated Elp3p for Elongator Protein 3. Members of
           this family are found in eukaryotes and archaea. These
           proteins are part of the larger set of GNAT
           acetyltransferases.
          Length = 522

 Score = 51.7 bits (124), Expect = 4e-07
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 16/161 (9%)

Query: 85  EPQNIALILDGIAKNWTVSS-NVEITIEANPS---SVEVNNFQGYRKAGVNRISLGVQSL 140
           E +  + + + I  N T     V +TIE  P       ++        G  R+ LGVQ++
Sbjct: 171 ELKGNSTLEEAIRINETSKHRCVGLTIETRPDYCREEHIDRMLKL---GATRVELGVQTI 227

Query: 141 EEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ--RAL--- 195
               L    R H   + + A  L R+   ++ + ++  LP  +    E +L+  R +   
Sbjct: 228 YNDILERTKRGHTVRDVVEATRLLRDAGLKVVYHIMPGLPGSSF---ERDLEMFREIFED 284

Query: 196 -SYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDL 235
             +  D L +Y   + +GT  Y++ K G+    +   AV+L
Sbjct: 285 PRFKPDMLKIYPTLVTRGTELYELWKRGEYKPYTTEEAVEL 325


>gnl|CDD|130279 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 family.  This
           uncharacterized protein family shows significant
           similarity to TIGR01211, a longer protein that is a
           histone acetyltransferase at its C-terminus and is a
           subunit of RNA polymerase II (in yeast). This family
           lacks the GNAT acetyltransferase domain.
          Length = 302

 Score = 49.8 bits (119), Expect = 1e-06
 Identities = 24/103 (23%), Positives = 50/103 (48%)

Query: 133 ISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQ 192
           + LG+Q+  +++L+ + R H+ +  + A+  AR    ++   +I  LP +   +     +
Sbjct: 141 VELGLQTAHDKTLKKINRGHDFACYVDAVKRARKRGIKVCSHVILGLPGEDREEMMETAK 200

Query: 193 RALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDL 235
                 VD + ++ L + KGT   KM++ G+L   S    + L
Sbjct: 201 IVSLLDVDGIKIHPLHVVKGTKMAKMYEKGELKTLSLEEYISL 243


>gnl|CDD|131081 TIGR02026, BchE, magnesium-protoporphyrin IX monomethyl ester
           anaerobic oxidative cyclase.  This model respresents the
           cobalamin-dependent oxidative cyclase responsible for
           forming the distinctive E-ring of the chlorin ring
           system under anaerobic conditions. This step is
           essential in the biosynthesis of both
           bacteriochlorophyll and chlorophyll under anaerobic
           conditions (a separate enzyme, AcsF, acts under aerobic
           conditions). This model identifies two clades of
           sequences, one from photosynthetic, non-cyanobacterial
           bacteria and another including Synechocystis and several
           non-photosynthetic bacteria. The function of the
           Synechocystis gene is supported by gene clustering with
           other photosynthetic genes, so the purpose of the gene
           in the non-photosynthetic bacteria is uncertain. Note
           that homologs of this gene are not found in plants which
           rely solely on the aerobic cyclase.
          Length = 497

 Score = 37.6 bits (87), Expect = 0.006
 Identities = 48/213 (22%), Positives = 83/213 (38%), Gaps = 23/213 (10%)

Query: 19  LGVYVHWPFCVKKCPY-CDFNSHV---RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSI 74
           LGV V  P   + CP+ C+F S     RRY+       + F+ E++W+ +  G   +   
Sbjct: 190 LGVRVAVPNFARGCPFTCNFCSQWKFWRRYRHRDP---KKFVDEIEWLVRTHG---VGFF 243

Query: 75  FFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEV----NNFQGYRKAGV 130
                 P++   +      + IA+N      + +T   N    ++    +    YR+AG+
Sbjct: 244 ILADEEPTINRKKFQEFCEEIIARN-----PISVTWGINTRVTDIVRDADILHLYRRAGL 298

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR--NIFPRMSFDLIYALPKQTMTQWE 188
             ISLG ++  + +L    +    S    AI L R  NI     F  I     +T   +E
Sbjct: 299 VHISLGTEAAAQATLDHFRKGTTTSTNKEAIRLLRQHNILSEAQF--ITGFENETDETFE 356

Query: 189 MELQRALSYAVDHLSLYQLTIEKGTLFYKMHKD 221
              ++ L +  D  +    T    T  +    D
Sbjct: 357 ETYRQLLDWDPDQANWLMYTPWPFTSLFGELSD 389


>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional.
          Length = 668

 Score = 32.7 bits (75), Expect = 0.19
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 96  IAKNWTV---SSNVEITIEANPSSVEVNNFQGYRKAGVNRISLG 136
           I +N T+    S+V  T E N SSVE++ +QG R+   +  SLG
Sbjct: 407 IPRNTTIPVRRSDVFSTSENNQSSVEIHVWQGEREMASDNKSLG 450


>gnl|CDD|162433 TIGR01579, MiaB-like-C, MiaB-like tRNA modifying enzyme.  This
           clade is a member of a subfamily (TIGR00089) and spans
           low GC Gram positive bacteria, alpha and epsilon
           proteobacteria, Campylobacter, Porphyromonas, Aquifex,
           Thermotoga, Chlamydia, Treponema and Fusobacterium.
          Length = 414

 Score = 31.6 bits (72), Expect = 0.33
 Identities = 11/56 (19%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 135 LGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSF--DLIYALPKQTMTQWE 188
           L +QS  ++ L+ + R +   + +  ++  R++ P  +F  D+I   P ++   ++
Sbjct: 253 LSLQSGSDRVLKRMRRKYTRDDFLKLVNKLRSVRPDYAFGTDIIVGFPGESEEDFQ 308


>gnl|CDD|162252 TIGR01210, TIGR01210, conserved hypothetical protein TIGR01210.
           This family of exclusively archaeal proteins has no
           characterized close homologs. Several rounds of
           PSI-BLAST with a stringent cutoff of 1e-8 shows apparent
           similarity of the central region of this family to the
           central regions of the oxygen-independent
           coproporphyrinogen III dehydrogenase HemN and to other
           enzymes.
          Length = 313

 Score = 29.8 bits (67), Expect = 1.2
 Identities = 40/202 (19%), Positives = 85/202 (42%), Gaps = 16/202 (7%)

Query: 30  KKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGG--TPSLIEPQ 87
             C  C + +     +V +EN I  F   ++  ++      I  IF  G       +  +
Sbjct: 31  GGCYMCGYLADSSP-EVTEENLINQFDEAIEKYKEKIKDFVIK-IFTSGSFLDDREVPKE 88

Query: 88  NIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVN-RISLGVQSLEEQSLR 146
               I + IA+     +  E+ +E+ P  ++    +  RK GVN  +++G+++  ++ +R
Sbjct: 89  TRNYIFEKIAQ---RDNLKEVVVESRPEFIDEEKLEELRKIGVNVEVAVGLETANDR-IR 144

Query: 147 FLGRNHNAS--EAIAAIHLARNIFPRMSFDLIYALP----KQTMTQWEMELQRALSYAVD 200
               N  ++  + I A  LAR     +   L++  P    K+ +      +++ +    D
Sbjct: 145 EKSINKGSTFEDFIRAAELARKYGAGVKAYLLFKPPFLSEKEAIADMISSIRKCIPVT-D 203

Query: 201 HLSLYQLTIEKGTLFYKMHKDG 222
            +S+    ++KGTL   +   G
Sbjct: 204 TVSINPTNVQKGTLVEFLWNRG 225


>gnl|CDD|162888 TIGR02495, NrdG2, anaerobic ribonucleoside-triphosphate reductase
           activating protein.  This enzyme is a member of the
           radical-SAM family (pfam04055). It is often gene
           clustered with the class III (anaerobic) ribonucleotide
           triphosphate reductase (NrdD, TIGR02487) and presumably
           fulfills the identical function as NrdG which utilizes
           S-adenosyl methionine, an iron-sulfur cluster and a
           reductant (dihydroflavodoxin) to produce a
           glycine-centered radical in NrdD.
          Length = 191

 Score = 29.7 bits (67), Expect = 1.5
 Identities = 30/135 (22%), Positives = 52/135 (38%), Gaps = 20/135 (14%)

Query: 28  CVKKCPYCDFNSHVRRYKVGQ--ENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIE 85
           C  KCPYC     + R   G+    F+  FL   Q +        I  +   GG P+L  
Sbjct: 26  CNLKCPYCHNPELIDREGSGEIEVEFLLEFLRSRQGL--------IDGVVITGGEPTLQA 77

Query: 86  PQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAG-VNRISLGVQSLEEQS 144
              +   L  + +        E+ ++ N S+  V   +   + G V+ +++ V++  E+ 
Sbjct: 78  --GLPDFLRKVRE-----LGFEVKLDTNGSNPRV--LEELLEEGLVDYVAMDVKAPPEKY 128

Query: 145 LRFLGRNHNASEAIA 159
               G   N S  I 
Sbjct: 129 PELYGLEKNGSNNIL 143


>gnl|CDD|172816 PRK14340, PRK14340, (dimethylallyl)adenosine tRNA
           methylthiotransferase; Provisional.
          Length = 445

 Score = 28.2 bits (63), Expect = 3.7
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP--RMSFDLI 176
           N I L VQS   + LR + R H   E +  I L R+  P   +S DLI
Sbjct: 259 NHIHLPVQSGSSRMLRRMNRGHTIEEYLEKIALIRSAIPGVTLSTDLI 306


>gnl|CDD|179359 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase; Provisional.
          Length = 498

 Score = 28.1 bits (63), Expect = 4.2
 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%)

Query: 145 LRFLGRNHNASEAIAAIHLARNI 167
           LR  G  HNA+ A+AA+ LAR I
Sbjct: 314 LRIRGL-HNAANALAALALARAI 335


>gnl|CDD|184628 PRK14331, PRK14331, (dimethylallyl)adenosine tRNA
           methylthiotransferase; Provisional.
          Length = 437

 Score = 27.8 bits (62), Expect = 4.4
 Identities = 22/117 (18%), Positives = 46/117 (39%), Gaps = 3/117 (2%)

Query: 130 VNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSF--DLIYALPKQTMTQW 187
              + L  Q+  ++ L+ + R +   E +  I L +   P ++F  D+I   P +T   +
Sbjct: 255 CEHLHLPFQAGSDRILKLMDRGYTKEEYLEKIELLKEYIPDITFSTDIIVGFPTETEEDF 314

Query: 188 EMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS 244
           E  L        + +  ++ +   GT    M       + ++ +   L  L + IT 
Sbjct: 315 EETLDVLKKVEFEQVFSFKYSPRPGTPAAYMEGQEPDEVKTKRMN-RLLELQKEITF 370


>gnl|CDD|162748 TIGR02180, GRX_euk, Glutaredoxin.  This model represents
          eukaryotic glutaredoxins and includes sequences from
          fungi, plants and metazoans as well as viruses.
          Length = 84

 Score = 28.0 bits (63), Expect = 4.5
 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 19/60 (31%)

Query: 32 CPYCDFNSHVRRYK--VGQENFIQSFLT----------EMQ-WMRQLTGPRSISSIFFGG 78
          CPYC      ++ K  + + N   ++            E+Q ++ ++TG R++ +IF  G
Sbjct: 9  CPYC------KKAKEILAKLNVKPAYEVVELDQLSNGSEIQDYLEEITGQRTVPNIFING 62


>gnl|CDD|165343 PHA03050, PHA03050, glutaredoxin; Provisional.
          Length = 108

 Score = 28.1 bits (62), Expect = 4.6
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 61 WMRQLTGPRSISSIFFG----GGTPSLIEPQNIALILD 94
          +  Q+TG R++  IFFG    GG   L+E  N+  + D
Sbjct: 60 YFEQITGGRTVPRIFFGKTSIGGYSDLLEIDNMDALGD 97


>gnl|CDD|184626 PRK14329, PRK14329, (dimethylallyl)adenosine tRNA
           methylthiotransferase; Provisional.
          Length = 467

 Score = 27.3 bits (61), Expect = 7.4
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 6/68 (8%)

Query: 131 NRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR--MSFDLIYALPKQTMTQWE 188
             I L VQS  ++ L+ + R +     +  I   R I P   +S D+I   P +T    E
Sbjct: 284 KHIHLPVQSGSDRILKLMNRKYTREWYLDRIDAIRRIIPDCGISTDMIAGFPTET----E 339

Query: 189 MELQRALS 196
            + Q  LS
Sbjct: 340 EDHQDTLS 347


>gnl|CDD|148834 pfam07455, Psu, Phage polarity suppression protein (Psu).  This
           family contains a number of phage polarity suppression
           proteins (Psu) (approximately 190 residues long). The
           Psu protein of bacteriophage P4 causes suppression of
           transcriptional polarity in Escherichia coli by
           overcoming Rho termination factor activity.
          Length = 188

 Score = 27.2 bits (60), Expect = 8.2
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 13/67 (19%)

Query: 304 WLKMVRKNGHAVVEKEF----LSSEQQADEFLMMGLRLREGISVKDWEM--LAGRNLDIE 357
           WL   RK   A  E+E+    L+ E+ A   L +   LRE I VK WE+   AGR   I 
Sbjct: 20  WLG--RKEELAAAEQEYRELLLAGEKSAARRLQL---LREIIDVKKWEINQAAGRY--IR 72

Query: 358 CERNLQR 364
               +Q 
Sbjct: 73  SHEEVQH 79


>gnl|CDD|181277 PRK08187, PRK08187, pyruvate kinase; Validated.
          Length = 493

 Score = 26.9 bits (60), Expect = 9.7
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 349 LAGRNLDIECERNLQRQGFIERVQFSRL-RCTQRGMTMLDSVIANLA 394
           LA R  D+   R LQR   +  +  S L R   R +  LD+VIA LA
Sbjct: 53  LALRRHDL---RPLQRA--LMPLGLSSLGRLESRVLPTLDAVIAALA 94


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.320    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0696    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 6,400,560
Number of extensions: 407440
Number of successful extensions: 821
Number of sequences better than 10.0: 1
Number of HSP's gapped: 755
Number of HSP's successfully gapped: 42
Length of query: 395
Length of database: 5,994,473
Length adjustment: 95
Effective length of query: 300
Effective length of database: 3,941,713
Effective search space: 1182513900
Effective search space used: 1182513900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.2 bits)