>TIGR02065 ECX1 exosome complex exonuclease 1; InterPro: IPR011807 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function. An active PH domain uses inorganic phosphate as a nucleophile, adding it across the phosphodiester bond between the end two nucleotides in order to release ribonucleoside 5'-diphosphate (rNDP) from the 3' end of the RNA substrate. PH domains can be found in bacterial/organelle RNases and PNPases (polynucleotide phosphorylases) , as well as in archaeal and eukaryotic RNA exosomes , , the later acting as nano-compartments for the degradation or processing of RNA (including mRNA, rRNA, snRNA and snoRNA). Bacterial/organelle PNPases share a common barrel structure with RNA exosomes, consisting of a hexameric ring of PH domains that act as a degradation chamber, and an S1-domain/KH-domain containing cap that binds the RNA substrate (and sometimes accessory proteins) in order to regulate and restrict entry into the degradation chamber . Unstructured RNA substrates feed in through the pore made by the S1 domains, are degraded by the PH domain ring, and exit as nucleotides via the PH pore at the opposite end of the barrel , . This entry represents a family of archaeal proteins that are orthologous to the eukaryotic exosome protein Rrp41. It is somewhat more distantly related to the bacterial protein ribonuclease PH. An exosome-like complex has been demonstrated experimentally for the Archaea in Sulfolobus solfataricus, so members of this family are designated exosome complex exonuclease 1, after usage in SwissProt .; GO: 0016896 exoribonuclease activity producing 5'-phosphomonoesters, 0000178 exosome (RNase complex).

Probab=100.00 E-value=0 Score=336.14 Aligned_cols=220 Identities=27% Similarity=0.400 Sum_probs=206.8 Q ss_pred CCCCCCCCCCEEEEEEEECCCCCCCCEEEEEECCCEEEEEEEECCCCCC-CCCCCCCCCCCEEEEECCCCC-CCCCCCCC Q ss_conf 9678998011787999976632688289999689489999993332453-101554342110010055565-32223334 Q gi|254780630|r 1 MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPM-WIRNTKHGWITAEYGMLPRST-GNRVKREA 78 (242) Q Consensus 1 iR~DGR~~~e~R~i~i~~g~~~~a~GSa~v~~G~T~Vl~~V~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~-~~r~~~~~ 78 (242) T Consensus 8 ~R~DGR~pdeLRp~KI~~GvL~rADGSA~~E~G~tki~aAVYGPrE~hpRh~~~PDRAV~R~RY~MAPFSvkDERK~PgP 87 (231) T TIGR02065 8 LRLDGRKPDELRPVKIEAGVLKRADGSAYLEFGATKIVAAVYGPREAHPRHLQLPDRAVLRVRYNMAPFSVKDERKRPGP 87 (231) T ss_pred CCCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCC T ss_conf 54587784201201001311112760010113797999986377667775457888357760013898874346787222 Q ss_pred CCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCCHHHHCCCCCCCHHHCCCCCCCCCCCCEECCCC Q ss_conf 44477731023444432242100022004880222344203555763101000122210110010000014631011243 Q gi|254780630|r 79 VSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLK 158 (242) Q Consensus 79 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~i~i~v~v~~~dg~~~~a~~~a~~~Al~~a~i~~~~~~~~~~~~~~~~ 158 (242) T Consensus 88 d-----RR~iEiSKv~~EALepai~~E~fPRt~IDVF~EvLQADaGTR~AgltAASlALADAGIpMRDL----------- 151 (231) T TIGR02065 88 D-----RREIEISKVIREALEPAILLEQFPRTAIDVFVEVLQADAGTRCAGLTAASLALADAGIPMRDL----------- 151 (231) T ss_pred C-----CCEEHHHHHHHHHCCCEEEEECCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHCCCHHHHH----------- T ss_conf 9-----441215668888513101322388950105789985276504788999999998479402422----------- Q ss_pred CCCCEEECCCCCCCCEECCCCCCCCCCCEEEEEE-ECCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 7831020045455410033431012343036888-759986899992186368689999999999999999999999999 Q gi|254780630|r 159 GHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFV-MTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDV 237 (242) Q Consensus 159 ~~~~~~~~~~~~~~~~~d~~~~ee~~~~~~l~v~-~~~~~~i~~i~~~g~~~~~~~~~l~~~l~~a~~~~~~i~~~i~~~ 237 (242) T Consensus 152 --V~gvavGKv~G~vVLDl~~~ED~yGEAD~P~A~mP~~~~iTLLQldG---~~T~dEF~~A~~lA~~g~~~v~~~~r~A 226 (231) T TIGR02065 152 --VVGVAVGKVDGVVVLDLSELEDMYGEADVPLAIMPKLGEITLLQLDG---DLTPDEFRQALDLAVKGIKRVYEIQREA 226 (231) T ss_pred --HHEEEEEEECCEEEECCCCCCCCCCCCCCHHHHCCCCCCEEEEEECC---CCCHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf --00003455678889836612467576565665158998268997479---8686789999999999988999999998 Q ss_pred HHHC Q ss_conf 7720 Q gi|254780630|r 238 ISNE 241 (242) Q Consensus 238 L~~~ 241 (242) T Consensus 227 Lk~k 230 (231) T TIGR02065 227 LKKK 230 (231) T ss_pred HHCC T ss_conf 6405

HHsearch alignment for GI: 254780630 and conserved domain: TIGR02065