BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780631|ref|YP_003065044.1| hypothetical protein CLIBASIA_02590 [Candidatus Liberibacter asiaticus str. psy62] (62 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780631|ref|YP_003065044.1| hypothetical protein CLIBASIA_02590 [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Score = 128 bits (322), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 MSGCSDNIDREHKAGIEVEKNAITTKDNEKKRNPFQGRSSRNPCQGGDIKAPETVVEIKT 60 MSGCSDNIDREHKAGIEVEKNAITTKDNEKKRNPFQGRSSRNPCQGGDIKAPETVVEIKT Sbjct: 1 MSGCSDNIDREHKAGIEVEKNAITTKDNEKKRNPFQGRSSRNPCQGGDIKAPETVVEIKT 60 Query: 61 DL 62 DL Sbjct: 61 DL 62 >gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 20.8 bits (42), Expect = 4.9, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 24 TTKDNEKKRNPFQG 37 T + +K++NPFQG Sbjct: 248 TIEGMQKEQNPFQG 261 >gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 20.4 bits (41), Expect = 5.1, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Query: 1 MSGCSDNIDREHKAGIEVEKNAITTKDNEKKRNPFQG 37 MSGCS+ +D E+ GI E A ++ +K P G Sbjct: 18 MSGCSETLDPEN--GIR-ELGARMKQERKKADQPIGG 51 >gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 20.0 bits (40), Expect = 6.7, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 22 AITTKDNEKKRNPFQ 36 A+ TK EK+ NP + Sbjct: 256 ALMTKKEEKRLNPLE 270 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.308 0.129 0.366 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,596 Number of Sequences: 1233 Number of extensions: 1213 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 62 length of database: 328,796 effective HSP length: 34 effective length of query: 28 effective length of database: 286,874 effective search space: 8032472 effective search space used: 8032472 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.3 bits) S2: 31 (16.5 bits)