RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str. psy62] (267 letters) >gnl|CDD|145669 pfam02633, Creatininase, Creatinine amidohydrolase. Creatinine amidohydrolase (EC:3.5.2.10), or creatininase, catalyses the hydrolysis of creatinine to creatine. Length = 235 Score = 237 bits (608), Expect = 2e-63 Identities = 91/236 (38%), Positives = 125/236 (52%), Gaps = 13/236 (5%) Query: 16 ADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYS 75 A ++ +LP+G+ EQHGPHLP+ TDT+IA +AER+ L V +P P GYS Sbjct: 11 ALLKRGDTAILPVGSTEQHGPHLPLGTDTLIAEAIAERVAERLGD---VLVLPTIPYGYS 67 Query: 76 IEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRF 135 EHM GT +L+ I I ++ + G R++VI+N HGGN L+ + E R + Sbjct: 68 PEHMGFPGTISLSPETLIALLRDIGRSLARHGFRRLVIVNGHGGNIALLQEAARELRAEY 127 Query: 136 -SMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQS 194 M VV SW R P+G+ E GIH GE ETS+MLAL P LV+MD Sbjct: 128 PDMAVVPCSWWRLGPPEGLAGAFEDAEGIHAGEAETSLMLALHPELVRMDR--------- 178 Query: 195 EFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLL 250 E L G W +DL+P GV+G+ A+ +KGE LL + ++LL Sbjct: 179 EGGEPDALLSLGGGALLAWDARDLSPDGVIGDPTLASAEKGERLLEAAVDGLVELL 234 >gnl|CDD|31592 COG1402, COG1402, Uncharacterized protein, putative amidase [General function prediction only]. Length = 250 Score = 186 bits (474), Expect = 4e-48 Identities = 85/239 (35%), Positives = 127/239 (53%), Gaps = 11/239 (4%) Query: 21 DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY 80 I++LP+G+ EQHGPHLP+ TD +IA +AE++ L +P G S+EHM Sbjct: 19 TTIIILPVGSTEQHGPHLPLGTDALIAEAIAEKVAERLGAE--ALVLPTIYYGVSLEHMG 76 Query: 81 VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVV 140 GT TL+ I + +++++ + G RK VI+N HGGNS + IV+ E R L V Sbjct: 77 FPGTITLSPETLIALLVELVESLARHGFRKFVIVNGHGGNSAALEIVARELRAELGDLAV 136 Query: 141 STSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLA-ENFSSRQSEFLRN 199 + + + P+GI GIH G+IETS+ML L P LV M+ A + F Q+ Sbjct: 137 AVFFP-WQRPEGIWGLLSGIYGIHAGDIETSLMLHLGPELVDMERAVDPFPIEQAPESPL 195 Query: 200 FKYLRAHGSHSFGWSMKDLNPKGVVG-NAMDATVKKGEGLLSYFANCFIQLLNDINSFD 257 G H F W + + GVVG + AT +KGE +L + ++L+ + +FD Sbjct: 196 V------GLHPFAWDARAFSKDGVVGSDPTLATAEKGEKILEAAVDGLVELIREFMAFD 248 >gnl|CDD|73366 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose phosphate pathway. In the Calvin cycle Ru5P is phosphorylated by phosphoribulose kinase to ribulose-1,5-bisphosphate, which in turn is used by RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) to incorporate CO2 as the central step in carbohydrate synthesis.. Length = 211 Score = 30.8 bits (70), Expect = 0.45 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query: 52 ERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLT-YAEAIEHWLAIIDAIRKMGIRK 110 + ++ L V M P Y IE G +T +AEA +H I I+++G++ Sbjct: 50 KALRKHTDLPLDVHLMVENPERY-IEAFAKAGADIITFHAEATDHLHRTIQLIKELGMKA 108 Query: 111 IVILN 115 V LN Sbjct: 109 GVALN 113 >gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain. The PPP (phosphoprotein phosphatase) family is one of two known protein phosphatase families specific for serine and threonine. This family includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 225 Score = 30.1 bits (68), Expect = 0.62 Identities = 18/94 (19%), Positives = 29/94 (30%), Gaps = 4/94 (4%) Query: 73 GYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIV----ILNAHGGNSPLVSIVS 128 G+ E ++ GT L + W D + + ++ +L HGG SP + + Sbjct: 75 GFYDEDEWIGGTLRLLKKLGEDLWEEFNDVFFYLPLAALIETKKVLCVHGGLSPGLPLEE 134 Query: 129 TEARMRFSMLVVSTSWSRFTIPQGIISFPETEIG 162 L WS G G Sbjct: 135 QIKEEPEDQLPEDLLWSDPLELPGGFGSSRRGGG 168 >gnl|CDD|36470 KOG1256, KOG1256, KOG1256, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism]. Length = 691 Score = 28.3 bits (63), Expect = 2.4 Identities = 20/84 (23%), Positives = 34/84 (40%), Gaps = 8/84 (9%) Query: 61 RLPVTCMPVEP-IGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIR---KIVILNA 116 R V P +G + + LTY + E + +RK+G++ K+ I Sbjct: 82 RRSVEKSGNGPMLGTRVIVDGKGPYEWLTYKQVYERAENLGSGLRKLGVKEDSKVGIY-- 139 Query: 117 HGGNSPLVSIVSTEARMRFSMLVV 140 N P I+S A +S++ V Sbjct: 140 -AFNRP-EWIISEMACYAYSLVNV 161 >gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars. Nucleotidyltransferases transfer nucleotides onto phosphosugars. The enzyme family includes Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase. The products are activated sugars that are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Length = 217 Score = 27.9 bits (63), Expect = 2.7 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 30/80 (37%) Query: 45 IIAAGLAERIKSI---LP-PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAII 100 I+AAG R++ + P P LP+ P+ +E+ II Sbjct: 3 ILAAGKGTRLRPLTDTRPKPLLPIAGKPI-----------------------LEY---II 36 Query: 101 DAIRKMGIRKIVILNAHGGN 120 + + + GI +I+++ + G Sbjct: 37 ERLARAGIDEIILVVGYLGE 56 >gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]. Length = 460 Score = 27.4 bits (61), Expect = 4.2 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 25/76 (32%) Query: 45 IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIR 104 I+AAG R+KS LP L G + +EH +IDA R Sbjct: 7 ILAAGKGTRMKSDLPKVLHPVA------GKPM----------------LEH---VIDAAR 41 Query: 105 KMGIRKIVILNAHGGN 120 +G IV++ HG Sbjct: 42 ALGPDDIVVVVGHGAE 57 >gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase. Length = 221 Score = 27.2 bits (61), Expect = 4.7 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 31/77 (40%) Query: 45 IIAAGLAERIKSI---LP-PRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAII 100 I+AAGL R++ + P P +PV K L I+H L Sbjct: 4 ILAAGLGTRMRPLTDTRPKPLVPV------------------AGKPL-----IDHAL--- 37 Query: 101 DAIRKMGIRKIVILNAH 117 D + GIR+IV+ N H Sbjct: 38 DRLAAAGIRRIVV-NTH 53 >gnl|CDD|32275 COG2092, EFB1, Translation elongation factor EF-1beta [Translation, ribosomal structure and biogenesis]. Length = 88 Score = 27.1 bits (60), Expect = 5.0 Identities = 15/68 (22%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Query: 38 LPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE--HMYVDGTKTLTYAEAIEH 95 +P + + + L E+IK LP + + EPI + ++ +YV +A+E Sbjct: 11 MPDDPEVDLE-ELEEKIKEKLPEGYELIKIEEEPIAFGLKALKLYVVVEDKEGGTDALEE 69 Query: 96 WLAIIDAI 103 L ++ + Sbjct: 70 ALEEVEGV 77 >gnl|CDD|153312 cd07628, BAR_Atg24p, The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. Atg24p is involved in membrane fusion events at the vacuolar surface during pexophagy. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 185 Score = 26.8 bits (60), Expect = 5.7 Identities = 11/43 (25%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Query: 179 HLVKMDLAEN---FSSRQSEFLRNFKYLRAHGSHSFGWSMKDL 218 L ++ E FS S+F + + L + ++ S+KDL Sbjct: 53 SLESGEITEPFKIFSESLSQFSTSLRVLNKYTDENYLTSLKDL 95 >gnl|CDD|147394 pfam05185, PRMT5, PRMT5 arginine-N-methyltransferase. The human homologue of yeast Skb1 (Shk1 kinase-binding protein 1) is PRMT5, an arginine-N-methyltransferase. These proteins appear to be key mitotic regulators. They play a role in Jak signalling in higher eukaryotes. Length = 447 Score = 26.8 bits (60), Expect = 5.7 Identities = 14/55 (25%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Query: 89 YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIV---STEARMRFSMLVV 140 Y AI L +K +VIL G PLV + E + + V Sbjct: 166 YERAIRKALLDWVPEKKKTSGTLVILVVGAGRGPLVDRALRAAEETGRKVKIYAV 220 >gnl|CDD|144433 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family. This enzyme catalyses the conversion of D-ribulose 5-phosphate into D-xylulose 5-phosphate. Length = 201 Score = 26.9 bits (60), Expect = 6.8 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Query: 89 YAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSI 126 +AEA +H I I++ G + ++LN +PL +I Sbjct: 87 HAEASDHPHRTIQLIKEAGAKAGLVLNPA---TPLDAI 121 >gnl|CDD|133075 cd03864, M14_CPN, Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3.4.17.3) is an extracellular glycoprotein synthesized in the liver and released into the blood, where it is present in high concentrations. CPN belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPN plays an important role in protecting the body from excessive buildup of potentially deleterious peptides that normally act as local autocrine or paracrine hormones. It specifically removes C-terminal basic residues. As CPN can cleave lysine more avidly than arginine residues it is also called lysine carboxypeptidase. CPN substrates include peptides found in the bloodstream, such as kinins (e.g. bradykinin, kalinin, met-lys-bradykinin), complement anaphylatoxins and creatine kinase MM (CK-MM). By removing just one amino acid, CPN can alter peptide activity and receptor binding. For example Bradykinin, a nine-residue peptide released from kiningen in response to tissue injury which is inactivated by CPN, anaphylatoxins which are regulated by CPN by the cleaving and removal of their C-terminal arginines resulting in a reduction in their biological activities of 10-100-fold, and creatine kinase MM, a cytosolic enzyme that catalyzes the reversible transfer of a phosphate group from ATP to creatine, and is regulated by CPN by the cleavage of C-terminal lysines. Like the other N/E subfamily members, two surface loops surrounding the active-site groove restrict access to the catalytic center, thus restricting larger protein carboxypeptidase inhibitors from inhibiting CPN. Length = 392 Score = 26.4 bits (58), Expect = 7.9 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 202 YLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY-FANCF 246 Y AHG GW+ D +G+ A ++ KG +Y NCF Sbjct: 234 YSYAHGWMHKGWNCGDYFDEGITNGASWYSLSKGMQDFNYLHTNCF 279 >gnl|CDD|37132 KOG1921, KOG1921, KOG1921, Endonuclease III [Replication, recombination and repair]. Length = 286 Score = 26.5 bits (58), Expect = 8.9 Identities = 19/89 (21%), Positives = 34/89 (38%), Gaps = 14/89 (15%) Query: 51 AERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRK 110 R + +P P EP+G + + E+WL + + IRKM + Sbjct: 9 IVRRRVNVPNTWSTPADPSEPMGSA-------------SGKPPENWLEVYERIRKMRSKI 55 Query: 111 IVILNAHGGNSPLVSIVSTEARMRFSMLV 139 + ++ G + + R RF +LV Sbjct: 56 VAPVDTMGCSRIPSLKADPKER-RFQVLV 83 >gnl|CDD|35094 COG5535, RAD4, DNA repair protein RAD4 [DNA replication, recombination, and repair]. Length = 650 Score = 26.2 bits (57), Expect = 9.2 Identities = 7/38 (18%), Positives = 15/38 (39%) Query: 186 AENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGV 223 +++S R+S + + L G W + G+ Sbjct: 127 FKDWSVRKSAHIMDSTCLLLLGFIRNLWFRSKMLSNGL 164 >gnl|CDD|35123 COG5564, COG5564, Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only]. Length = 276 Score = 26.1 bits (57), Expect = 9.3 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 81 VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVS 125 + L+ A+ +E +A R G+RK VI HGG P+ Sbjct: 192 IGARSALSLADCVELIELAAEAAR--GVRKDVIPLCHGG--PISM 232 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.137 0.414 Gapped Lambda K H 0.267 0.0758 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,362,280 Number of extensions: 177961 Number of successful extensions: 498 Number of sequences better than 10.0: 1 Number of HSP's gapped: 490 Number of HSP's successfully gapped: 28 Length of query: 267 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 175 Effective length of database: 4,275,709 Effective search space: 748249075 Effective search space used: 748249075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.3 bits)