RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780633|ref|YP_003065046.1| creatinine amidohydrolase [Candidatus Liberibacter asiaticus str. psy62] (267 letters) >gnl|CDD|151508 pfam11062, DUF2863, Protein of unknown function (DUF2863). This bacterial family of proteins have no known function. Length = 398 Score = 31.2 bits (71), Expect = 0.27 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Query: 144 WSRFTIPQGIISFP---ETEIGIHGGEIETSMMLALAPHLVKMD 184 W+R++IP G I + + + LALAP L +D Sbjct: 107 WTRYSIPSGPIPAAVLQALRVHLQAHVLADDARLALAPFLFSID 150 >gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase. This protein is a bifunctional enzyme, GlmU, which catalyzes last two reactions in the four-step pathway of UDP-N-acetylglucosamine biosynthesis from fructose-6-phosphate. Its reaction product is required from peptidoglycan biosynthesis, LPS biosynthesis in species with LPS, and certain other processes. Length = 451 Score = 30.3 bits (69), Expect = 0.52 Identities = 22/76 (28%), Positives = 31/76 (40%), Gaps = 25/76 (32%) Query: 45 IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIR 104 I+AAG R+KS LP L G + +EH +IDA R Sbjct: 5 ILAAGKGTRMKSDLPKVLHPLA------GKPM----------------LEH---VIDAAR 39 Query: 105 KMGIRKIVILNAHGGN 120 +G +KI ++ HG Sbjct: 40 ALGPQKIHVVYGHGAE 55 >gnl|CDD|181068 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated. Length = 513 Score = 29.9 bits (68), Expect = 0.78 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Query: 80 YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRK---IVILNAHGGNSP 122 YV G + LTYAE A+ +GI K + I NSP Sbjct: 24 YVFGDQRLTYAELNARVRRAAAALAALGIGKGDRVAIW---APNSP 66 >gnl|CDD|183342 PRK11860, PRK11860, bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional. Length = 661 Score = 29.6 bits (67), Expect = 0.78 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 134 RFSMLVVSTSWSRFTIPQG 152 RF + V W RFTIP G Sbjct: 213 RFGIAVQREGWQRFTIPAG 231 >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 458 Score = 28.6 bits (65), Expect = 1.7 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 25/74 (33%) Query: 45 IIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIR 104 I+AAG R+KS LP L C K + +EH ++D+++ Sbjct: 7 ILAAGKGTRMKSKLPKVLHKVC-----------------GKPM-----VEH---VVDSVK 41 Query: 105 KMGIRKIVILNAHG 118 K GI KIV + HG Sbjct: 42 KAGIDKIVTVVGHG 55 >gnl|CDD|183343 PRK11861, PRK11861, bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional. Length = 673 Score = 28.1 bits (62), Expect = 2.6 Identities = 14/49 (28%), Positives = 21/49 (42%) Query: 127 VSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLA 175 ++ + RF + V W RFT+P G+ I + G S LA Sbjct: 444 ITIKLMARFGVTVERDGWQRFTVPAGVRYRSPGTIMVEGDASSASYFLA 492 >gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 591 Score = 27.9 bits (62), Expect = 2.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 214 SMKDLNPKGVVGNAMDATVKKGEG 237 ++KDL P+ V +MD +K+G G Sbjct: 284 TLKDLAPRDFVSRSMDQEIKEGRG 307 >gnl|CDD|114722 pfam06016, Reovirus_L2, Reovirus core-spike protein lambda-2 (L2). This family consists of several Reovirus core-spike protein lambda-2 (L2) sequences. The reovirus L2 genome segment encodes the core spike protein lambda-2, which mediates enzymatic reactions in 5' capping of the viral plus-strand transcripts. Length = 1289 Score = 27.5 bits (61), Expect = 4.0 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Query: 53 RIKSILPPRLPVTCM----PVEPIG 73 RI S++PP LPVT EP G Sbjct: 836 RILSLIPPTLPVTMCDTRPFAEPSG 860 >gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional. Length = 433 Score = 26.9 bits (60), Expect = 6.2 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Query: 34 HGPHLPMNTDTIIAAGLAERIKSILPPRL 62 HGP + ++I+ LAE + I P L Sbjct: 77 HGPSGVIYYESILK--LAEELAEITPGGL 103 >gnl|CDD|184982 PRK15021, PRK15021, microcin C ABC transporter permease; Provisional. Length = 341 Score = 26.5 bits (58), Expect = 6.7 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Query: 193 QSEFLR--NFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATV 232 ++EFLR NF Y+RA + + G S + + + ++ NAM AT+ Sbjct: 223 RAEFLRTRNFDYIRA--AQALGVSDRSIILRHMLPNAMVATL 262 >gnl|CDD|163330 TIGR03568, NeuC_NnaA, UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing. This family of enzymes catalyzes the combined epimerization and UDP-hydrolysis of UDP-N-acetylglucosamine to N-acetylmannosamine. This is in contrast to the related enzyme WecB (TIGR00236) which retains the UDP moiety. NeuC acts in concert with NeuA and NeuB to synthesize CMP-N5-acetyl-neuraminate. Length = 365 Score = 26.3 bits (59), Expect = 7.4 Identities = 9/37 (24%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Query: 86 TLTYAEAIEHWLAIIDAIRKMGIRKIVIL-NAHGGNS 121 TL A E ++ A+ ++ I NA G+ Sbjct: 212 TLEKESAEEQIKELLKALDELNKNYIFTYPNADAGSR 248 >gnl|CDD|162324 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms. Length = 985 Score = 26.6 bits (59), Expect = 7.4 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 22/75 (29%) Query: 203 LRAHGSHSFGWSMKDLNPKGVVG------NAMDATVKKGE---------------GLLSY 241 L A+G H G S K P+G++ NA+ TV G GL++ Sbjct: 34 LLANGVHLVGRSFKYHRPRGILTAGVEEPNAL-VTVGSGAQREPNTRATTQELYDGLVAT 92 Query: 242 FANCFIQLLNDINSF 256 N + L DI +F Sbjct: 93 SQNRWPSLAFDIGAF 107 >gnl|CDD|180478 PRK06224, PRK06224, citrate synthase; Provisional. Length = 263 Score = 26.4 bits (59), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 30 AYEQHGPHLPMNTDTIIAAGLAE 52 G LP+N D IAA LA+ Sbjct: 186 LAAAKGKPLPLNVDGAIAAILAD 208 >gnl|CDD|131806 TIGR02759, TraD_Ftype, type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM). Length = 566 Score = 26.2 bits (58), Expect = 8.1 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Query: 68 PVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIV 112 P+ G +H+ + GT + AI ++ IR+ G R I+ Sbjct: 168 PLIKFGSETQHILIHGTTGSGKSVAIRK---LLRWIRQRGDRAII 209 >gnl|CDD|185548 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrogenase; Provisional. Length = 542 Score = 26.2 bits (58), Expect = 8.7 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 133 MRFSMLVVSTSWSRFTIPQGIISFPETEIGIHG 165 +RF+ V W+R I I+F E +IG G Sbjct: 244 LRFANRVFEPLWNRNNIACVQITFKE-DIGTEG 275 >gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase. This family consists of Ribulose-phosphate 3-epimerase, also known as pentose-5-phosphate 3-epimerase (PPE). PPE converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. It has been found in a wide range of bacteria, archebacteria, fungi and plants. Length = 210 Score = 26.1 bits (58), Expect = 8.8 Identities = 8/29 (27%), Positives = 16/29 (55%) Query: 89 YAEAIEHWLAIIDAIRKMGIRKIVILNAH 117 + EA EH ++ I+ +G + ++LN Sbjct: 86 HPEASEHIHRLLQLIKDLGAKAGIVLNPA 114 >gnl|CDD|162956 TIGR02635, RhaI_grampos, L-rhamnose isomerase, Streptomyces subtype. This clade of sequences is closely related to the L-rhamnose isomerases found in Pseudomonas stutzeri and in a number of the Rhizobiales (TIGR02629). The genes of the family represented here are found in similar genomic contexts which contain genes apparently involved in rhamnose catabolism such as rhamnulose-1-phosphate aldolase (TIGR02632), sugar kinases, and sugar transporters. Length = 378 Score = 26.3 bits (58), Expect = 9.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 91 EAIEHWLAIIDAIRKMGIRKIVILNAHGGNSP 122 +AI+H L +D +K G + I + A G N P Sbjct: 113 KAIDHLLECVDIAKKTGSKDISLWLADGTNYP 144 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.414 Gapped Lambda K H 0.267 0.0819 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,523,224 Number of extensions: 289410 Number of successful extensions: 620 Number of sequences better than 10.0: 1 Number of HSP's gapped: 618 Number of HSP's successfully gapped: 25 Length of query: 267 Length of database: 5,994,473 Length adjustment: 92 Effective length of query: 175 Effective length of database: 4,006,537 Effective search space: 701143975 Effective search space used: 701143975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.2 bits)