HHsearch alignment for GI: 254780634 and conserved domain: PRK05785

>PRK05785 hypothetical protein; Provisional.
Probab=96.95  E-value=0.0014  Score=44.00  Aligned_cols=77  Identities=19%  Similarity=0.229  Sum_probs=50.1

Q ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHHCCCCEEHHHHCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCEEEECC
Q ss_conf             66666258601346882799999986168810055249899999999987502886088215543445723246789627
Q gi|254780634|r  228 AITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDA  307 (429)
Q Consensus       228 ~~~~g~~vLD~CAapGGKt~~la~~~~~~g~i~A~D~~~~Rl~~l~~~~~r~g~~~v~~~~~~~~~~~~~~~fd~vl~Da  307 (429)
T Consensus        48 ~~~~~~~vLDva~GTGd~a~~l----~~~~~v~~~D~s~~ML~~a~~~~~~-------v~~~ae~LPf~d~sFD~vt~--  114 (225)
T PRK05785         48 DGKSPLKVLDAGAGPGNMAYHL----RKIRYVVALDYTEEMLRLNLVADDK-------VVGSFEAMPFRDKSFDLVMS--  114 (225)
T ss_pred             CCCCCCEEEEECCCCHHHHHHH----HCCCEEEEEECCHHHHHHHHHCCCC-------EEEHHHHCCCCCCCEEEEEE--
T ss_conf             6788882899568843999996----3478699998899999987643211-------37318539999882527763--


Q ss_pred             CCCCCHHHHHHHHH
Q ss_conf             54450444442236
Q gi|254780634|r  308 PCSGTGTWRRRPDI  321 (429)
Q Consensus       308 PCSg~G~~rr~Pe~  321 (429)
T Consensus       115 ---~Fgl-RN~~d~  124 (225)
T PRK05785        115 ---GYAL-HASDDI  124 (225)
T ss_pred             ---EEEE-ECCCCH
T ss_conf             ---4430-048889