>cd05779 DNA_polB_epsilon_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon. DNA polymerase epsilon is a family-B DNA polymerase with a catalytic subunit that contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (alpha and delta are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase epsilon plays a role in elongating the leading strand during DNA replication. It is also involved in DNA repair. The catalytic subunit contains both polymerase and 3'-5' exonuclease activities. The N-terminal exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. DNA polymerase epsilon also carries a unique large C-terminal domain with an unknown function. Phylogenetic analyses indicate that it is ort

Probab=97.55 E-value=0.00056 Score=42.38 Aligned_cols=88 Identities=23% Similarity=0.234 Sum_probs=51.5 Q ss_pred HCCCCCEEECCC-CHHHHHHHHHH---HCCCCC-----------------H-HHHHHHHHHH-HH-H--CCCHHHHHHHH Q ss_conf 323640230100-00168886542---000000-----------------0-4578988652-11-0--00000887776 Q gi|254780636|r 71 VDEKREKIFHYG-RFDIAVLFYTF---GVRVRP-----------------V-FCTKIASRLT-RT-Y--TNQHGLKDNLK 124 (207) Q Consensus 71 ~d~~i~KV~Hn~-~~D~~~L~~~~---gi~~~~-----------------i-~DT~ias~l~-~~-~--~~~~~L~~L~~ 124 (207) T Consensus 87 ~~pdii-~gyN~~~FD~pyl~~Ra~~~~~~~~~~~~~~~~~~~~~~~~~~vhiDly---~~v~rd~~l~~~sy~Ln~Vs~ 162 (204) T cd05779 87 VKPHII-VTYNGDFFDWPFVEARAAIHGLSMEEEIGFRKDSEGEYKSRYIIHMDCF---RWVKRDSYLPQGSQGLKAVTK 162 (204) T ss_pred CCCCEE-EECCCCCCCHHHHHHHHHHHCCCHHHHCCCCCCCCCCEECCCCEEEECH---HHHHHHCCCCCCCCCHHHHHH T ss_conf 499999-8558767767999999999599825531800067772762672563007---765101217556877899999 Q ss_pred HHHCCCCCCC--CEECC-CCCCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 5420024675--20036-5654432368999986459999999 Q gi|254780636|r 125 ELLGINISKA--QQSSD-WSADDLSDEQLQYAASDVVHLHALR 164 (207) Q Consensus 125 ~~lg~~ldK~--~q~Sd-W~~rpLs~~Qi~YAA~Dv~~l~~L~ 164 (207) T Consensus 163 ~~Lg~~K~dv~~~~m~~l~~~~~--~~la~Y~~~Da~~Ty~l~ 203 (204) T cd05779 163 AKLGYDPVELDPEDMVPLAREDP--QTLASYSVSDAVATYYLY 203 (204) T ss_pred HHHCCCCCCCCHHHHHHHHCCCH--HHHHHCCHHHHHHHHHHH T ss_conf 99689975089999999982891--555524099999999976

HHsearch alignment for GI: 254780636 and conserved domain: cd05779