HHsearch alignment for GI: 254780638 and conserved domain: KOG0712

>KOG0712 consensus.
Probab=100.00  E-value=0  Score=559.17  Aligned_cols=328  Identities=40%  Similarity=0.741  Sum_probs=291.2

Q ss_pred             CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             98745248718799889999999999999997569988798799999999999876099899999877248765314555
Q gi|254780638|r    1 MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQS   80 (384)
Q Consensus         1 ~~~~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~~A~ekFkeI~eAYevLsD~~kR~~YD~~G~~~~~~~~~~   80 (384)
T Consensus         1 ~~~~~~y~il~v~~~As~~eikkayrkla~k~HpDkn~~---~~ekfkei~~AyevLsd~ekr~~yD~~g~~~~~~g~~~   77 (337)
T KOG0712           1 VKNTKLYDILGVSPDASEEEIKKAYRKLALKYHPDKNPD---AGEKFKEISQAYEVLSDPEKREIYDQYGEEGLQGGGGG   77 (337)
T ss_pred             CCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCC---HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             966562124145877578999999999988728887865---77888888889988649888777776514442036777


Q ss_pred             CCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCEECCCCCC
Q ss_conf             66521001443222222334443561013760344422221222221123222100000135544455443100023432
Q gi|254780638|r   81 QGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGS  160 (384)
Q Consensus        81 ~~~~~~~~~~~~~~~~~d~f~~~f~~~~~~~~~~~~~~~~~~~~~d~~~~~~islee~~~G~~~~i~~~~~~~C~~C~G~  160 (384)
T Consensus        78 ~g~~~--------------f~~~F~--~g~~~~--~~---~~rg~~~~~~~~~~Le~~y~G~s~kl~l~~~~iCs~C~Gs  136 (337)
T KOG0712          78 GGFGG--------------FSQFFG--FGGNGG--RG---RQRGKDVVHQLKVTLEELYMGKSKKLFLSRNFICSKCSGS  136 (337)
T ss_pred             CCCCC--------------HHHHCC--CCCCCC--CC---CCCCCCCEEEEEEEHHHHHCCCCCCEECCCCCCCCCCCCC
T ss_conf             78740--------------777516--777676--55---4468872477888887865677553113567137767788


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEE----EEEEECCCCCCCCEEE--ECCCCCCCCCCEECCCCCCCHHHHHCCCCC
Q ss_conf             2578854210355310112100110012----4686166656554698--354120011210001110000011001148
Q gi|254780638|r  161 GAKPGTNPMDCNICNGSGRVYTTAQSFF----SIERACSTCRGSGQII--PHPCSKCHGQGRVSEEKLLSVNVPPGVDDG  234 (384)
Q Consensus       161 g~~~~~~~~~C~~C~G~G~~~~~~~~~~----~~~~~C~~C~G~g~i~--~~~c~~C~G~g~~~~~~~~~I~Ip~G~~~G  234 (384)
T Consensus       137 Ggksg~~~-~C~~C~GsGv~~~~~~~gPg~~qs~q~~C~~C~G~G~~~~~kd~C~~C~G~~~v~~kkil~v~V~~g~~~~  215 (337)
T KOG0712         137 GGKSGSAP-KCTTCRGSGVQTRTRQMGPGMVQSPQLVCDSCNGSGETISLKDRCKTCSGAKVVREKKILEVHVEPGMPHG  215 (337)
T ss_pred             CCCCCCCC-CCCCCCCCCCEEEEEECCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHEEECCCCCCCCCC
T ss_conf             99887787-78778998811477642565300224574067885103136665866556131201103412556887656


Q ss_pred             CCEEECCCCCCCCCCCCCCCEEEEEECCCCCCEEEECCCCEEEEEECHHHHCCCCEEEEECCCCCCCCEEECCC--CCCC
Q ss_conf             50120367765678841664157531034684286414846999846665135424885167888231011685--1778
Q gi|254780638|r  235 TRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEG--TQTG  312 (384)
Q Consensus       235 ~~i~~~g~G~~~~~~~~~GDl~i~i~~~~h~~f~r~g~dL~~~~~I~l~eal~G~~~~i~tldG~~i~i~i~~~--~~~~  312 (384)
T Consensus       216 ~ki~f~geadea~-g~~pgD~vl~i~~k~h~~F~Rrg~dL~~~~~i~l~eal~G~~~~~~~ldGr~l~~~~~pg~vi~~~  294 (337)
T KOG0712         216 QKITFKGEADEAP-GTKPGDVVLLIDQKEHPGFDRRGSDLYRKLTISLVEALCGFQRVWETLDGRLLKLSSKPGEVISPG  294 (337)
T ss_pred             CEEEEEEEEEECC-CCCCCCEEEEECCCCCCCCEECCCCCCEEEECCHHHCCCCCEEEEECCCCCEEEEECCCCCEECHH
T ss_conf             4123454331157-886764899965345664113366640123103323255651788746895179836898260756


Q ss_pred             CEEEECCEECCCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             87898881020068988652799999992989999999999999
Q gi|254780638|r  313 KQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF  356 (384)
Q Consensus       313 ~~~~i~g~G~p~~~~~~rGdl~i~~~v~~P~~Ls~~qk~ll~~l  356 (384)
T Consensus       295 ~~~~v~~~gmp~~~~~-~g~lyi~~~v~fp~-~~~~~~~~l~~~  336 (337)
T KOG0712         295 DTKRVEGEGMPIFRNP-KGDLYIKFEVKFPK-LSPSQLKMLEDL  336 (337)
T ss_pred             HEEEECCCCCCCCCCC-CCCEEEEEEEECCC-CCHHHHHHHHHH
T ss_conf             7776127886465689-98689999987688-886788888743