HHsearch results for GI: 254780638 and protein with PDBid: 1c3g_A

>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A
Probab=97.91  E-value=1.8e-05  Score=58.20  Aligned_cols=44  Identities=16%  Similarity=0.172  Sum_probs=35.2

Q ss_pred             CCCCCHHHHHCCCCCCCEEECCCCCCCC-CCCCCCCEEEEEECCC
Q ss_conf             1100000110011485012036776567-8841664157531034
Q gi|254780638|r  220 EKLLSVNVPPGVDDGTRIRLSGEGGAGV-YGGAPGDLYIFISVKK  263 (384)
Q Consensus       220 ~~~~~I~Ip~G~~~G~~i~~~g~G~~~~-~~~~~GDl~i~i~~~~  263 (384)
                      .+.+.|.||+++..|+.++++|+|=... ....+|||+|.+.++-
T Consensus       113 G~~i~i~i~~~~~~g~~~~i~g~Gmp~~~~~~~~GdL~I~~~V~~  157 (170)
T 1c3g_A          113 GRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDY  157 (170)
T ss_dssp             SCEEEEEESSCCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBC
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEEEEEC
T ss_conf             970323457876689789988877761899899688999999992