HHsearch results for GI: 254780638 and protein with PDBid: 1faf_A

>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1
Probab=99.65  E-value=4.1e-17  Score=141.83  Aligned_cols=62  Identities=11%  Similarity=0.299  Sum_probs=57.3

Q ss_pred             CCCHHHHCCCCCC--CHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             4524871879988--99999999999999975699887987999999999998760998999998772
Q gi|254780638|r    4 ADFYQVLGIDRNA--TDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQG   69 (384)
Q Consensus         4 ~DyY~iLGV~~~A--s~~eIKkAYrklA~k~HPDkn~~d~~A~ekFkeI~eAYevLsD~~kR~~YD~~   69 (384)
                      .|||+||||+++|  |.+|||+|||+||++||||+++ |+   ++|++|++||++|+|+.+|..||..
T Consensus        11 ~~~y~iLgl~~~~~~~~~~Ik~aYr~l~~~~HPDk~~-d~---e~~~~i~~Ay~~L~d~~~r~r~~~~   74 (79)
T 1faf_A           11 ERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGG-SH---ALMQELNSLWGTFKTEVYNLRMNLG   74 (79)
T ss_dssp             HHHHHHHTCCSSSTTCHHHHHHHHHHHHHHSSGGGSC-CH---HHHHHHHHHHHHHHHHHHHHTTCCS
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC-CH---HHHHHHHHHHHHHCCHHHHHHHCCC
T ss_conf             9999991989887899999999999999984987688-79---9999999999997589999986479