HHsearch results for GI: 254780638 and protein with PDBid: 1nlt_A

>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1
Probab=100.00  E-value=0  Score=399.65  Aligned_cols=236  Identities=31%  Similarity=0.647  Sum_probs=215.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---EEEEEEEEC
Q ss_conf             22212222211232221000001355444554431000234322578854210355310112100110---012468616
Q gi|254780638|r  118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ---SFFSIERAC  194 (384)
Q Consensus       118 ~~~~~~~~d~~~~~~islee~~~G~~~~i~~~~~~~C~~C~G~g~~~~~~~~~C~~C~G~G~~~~~~~---~~~~~~~~C  194 (384)
                      ++.+++++|+.+++.|||+|+|.|+++++.+.+.+.|+.|+|+|++++. ...|+.|+|+|.+....+   ++++++.+|
T Consensus         5 ~~~~~kg~di~~~l~isLee~~~G~~k~i~i~r~~~C~~C~G~G~~~~~-~~~C~~C~G~G~~~~~~~~g~~~~~~~~~C   83 (248)
T 1nlt_A            5 PRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA-VKKCTSCNGQGIKFVTRQMGPMIQRFQTEC   83 (248)
T ss_dssp             ---CCBCCCEEEEEEECTTHHHHCEEEEEEEEEEEECTTTTTCSBSTTT-CCCCTTSSSSSCEEEEEESSSEEEEEECSC
T ss_pred             CCCCCCCCCEEEEEEEEHHHHHCCCEEEEEEEEEEECCCCCCCCCCCCC-CCCCCCCCCCCCCCCEEECCCCCEEEEEEC
T ss_conf             8989899899999898999974797699997763576898563168998-873788799787814540245420446761


Q ss_pred             CCCCCCCEEE--ECCCCCCCCCCEECCCCCCCHHHHHCCCCCCCEEECCCCCCCCCCCCCCCEEEEEECCCCCCEEEECC
Q ss_conf             6656554698--35412001121000111000001100114850120367765678841664157531034684286414
Q gi|254780638|r  195 STCRGSGQII--PHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGA  272 (384)
Q Consensus       195 ~~C~G~g~i~--~~~c~~C~G~g~~~~~~~~~I~Ip~G~~~G~~i~~~g~G~~~~~~~~~GDl~i~i~~~~h~~f~r~g~  272 (384)
                      +.|+|+|+++  ++.|..|+|.|++.++++++|+||||+.+|++|+|+|+|++. ++..+|||+|+|.+++|+.|+|+|+
T Consensus        84 ~~c~g~G~~~~~~~~C~~C~G~g~~~~~~~i~v~Ip~G~~~G~~i~~~g~g~~~-~~~~~GDl~v~i~~~~h~~f~r~g~  162 (248)
T 1nlt_A           84 DVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQA-PDVIPGDVVFIVSERPHKSFKRDGD  162 (248)
T ss_dssp             TTCSSSSSCCCTTSBCSSSTTSCEEEEEEEEEEEECTTCCTTCEEEETTCSCCC-TTCBCCCEEEEEEECCCSSCEEETT
T ss_pred             CCCCCCCEEECCCCCCCCCCCCCEEEEEEEEEEEECCCCCCCCEEECCCCCCCC-CCCCCCCEEEEEEEECCCCEEEECC
T ss_conf             354787147614788711289778857899998969999899699766787731-1478886799999953876189667


Q ss_pred             CCEEEEEECHHHHCCCCEEEEECCCCCCCCEEECCC--CCCCCEEEECCEECCCCCCCCCCCEEEEEEEECCCCCCHHHH
Q ss_conf             846999846665135424885167888231011685--177887898881020068988652799999992989999999
Q gi|254780638|r  273 DLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEG--TQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQR  350 (384)
Q Consensus       273 dL~~~~~I~l~eal~G~~~~i~tldG~~i~i~i~~~--~~~~~~~~i~g~G~p~~~~~~rGdl~i~~~v~~P~~Ls~~qk  350 (384)
                      |||++++|+|+|||+|+++.|+||||+.+.|++|++  ++|+++++|+|+|||..+++.+|||||+|+|+||++||.+|+
T Consensus       163 dL~~~~~Isl~eal~G~~~~i~~ldG~~~~i~i~~g~~~~~g~~~~i~g~G~p~~~~~~~GdL~V~~~v~~P~~l~~~q~  242 (248)
T 1nlt_A          163 DLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKDPENHFTSEE  242 (248)
T ss_dssp             EEEEEEEEEHHHHHHCBCCEEECSSSCEEECCBCTTTTCSTTCEEEETTCSCBCSSSCSBCCEEEEEEEECCC-------
T ss_pred             EEEEEEECCHHHHCCCCEEEEEECCCCEEEECCCCCCEECCCEEEEEECCCCCCCCCCCCCCEEEEEEEECCCCCCHHHH
T ss_conf             78999944711204798899774289867750589998899989999389988789899557899999994999998699


Q ss_pred             HHHHHH
Q ss_conf             999999
Q gi|254780638|r  351 ELLEEF  356 (384)
Q Consensus       351 ~ll~~l  356 (384)
                      +| ++|
T Consensus       243 ~L-~~l  247 (248)
T 1nlt_A          243 NL-KKL  247 (248)
T ss_dssp             ------
T ss_pred             HH-HHC
T ss_conf             89-752