HHsearch results for GI: 254780638 and protein with PDBid: 2ctp_A

>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=99.83  E-value=5.4e-21  Score=169.68  Aligned_cols=68  Identities=50%  Similarity=0.918  Sum_probs=64.5

Q ss_pred             CCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             745248718799889999999999999997569988798799999999999876099899999877248
Q gi|254780638|r    3 KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGH   71 (384)
Q Consensus         3 ~~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~~A~ekFkeI~eAYevLsD~~kR~~YD~~G~   71 (384)
                      ..|||+||||+++||.+|||+|||+|+++||||+|. +++++++|++|++||+||+||.+|+.||+||.
T Consensus         6 ~~dyY~vLgv~~~as~~eIk~aY~~l~~~~hPDk~~-~~~~~~~f~~i~~Ay~iL~d~~~R~~YD~~g~   73 (78)
T 2ctp_A            6 SGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNH-APGATEAFKAIGTAYAVLSNPEKRKQYDQFGS   73 (78)
T ss_dssp             SCCHHHHHTCCTTCCHHHHHHHHHHHHTTSCTTTCS-SHHHHHHHHHHHHHHHHHTSHHHHHHHHHTCS
T ss_pred             CCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCC-CHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCC
T ss_conf             998488729899949999999999999750864579-86499999999999999089999999965699