HHsearch results for GI: 254780638 and protein with PDBid: 2ej7_A

>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=99.82  E-value=8.9e-21  Score=168.12  Aligned_cols=68  Identities=47%  Similarity=0.887  Sum_probs=64.0

Q ss_pred             CCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCH-HHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             45248718799889999999999999997569988798-799999999999876099899999877248
Q gi|254780638|r    4 ADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP-EAKEKFAQISEAYEVLRDPQKRALYDQGGH   71 (384)
Q Consensus         4 ~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~-~A~ekFkeI~eAYevLsD~~kR~~YD~~G~   71 (384)
                      .|||+||||+++||.+|||+|||+|+++||||+|+.+. +++++|++|++||+||+||.+|+.||+||.
T Consensus         9 ~dyY~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~~~I~~Ay~iL~d~~~R~~YD~~g~   77 (82)
T 2ej7_A            9 VDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGS   77 (82)
T ss_dssp             CCHHHHTTCCTTCCHHHHHHHHHHHHTTSCTTTCSTTHHHHHHHHHHHHHHHHHHSSTTHHHHHHHTCC
T ss_pred             CCHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCC
T ss_conf             538998299999699999999999998768576845799999999999999999798999999976799