HHsearch results for GI: 254780638 and protein with PDBid: 2q2g_A

>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II}
Probab=97.95  E-value=1.4e-05  Score=59.00  Aligned_cols=43  Identities=23%  Similarity=0.221  Sum_probs=31.3

Q ss_pred             CCCCHHHHHCCCCCCCEEECCCCCCCCC-CCCCCCEEEEEECCC
Q ss_conf             1000001100114850120367765678-841664157531034
Q gi|254780638|r  221 KLLSVNVPPGVDDGTRIRLSGEGGAGVY-GGAPGDLYIFISVKK  263 (384)
Q Consensus       221 ~~~~I~Ip~G~~~G~~i~~~g~G~~~~~-~~~~GDl~i~i~~~~  263 (384)
                      +.+.|+||+++..|+.++++|+|=.-.. ....|||+|.+++.-
T Consensus       120 ~~i~i~i~~~~~~~~~~~i~g~G~P~~~~~~~~GDL~I~~~v~~  163 (180)
T 2q2g_A          120 RNLQIPIKEIVNPKTRKIVPNEGMPIKNQPGQKGDLILEFDICF  163 (180)
T ss_dssp             CEEEEEECSCCCTTCEEEETTCSCBCSSSTTCBCCEEEEEEEEC
T ss_pred             CCEEEECCCCCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEEEE
T ss_conf             53066229825898599993998843898999748999999991