HHsearch results for GI: 254780638 and protein with PDBid: 2qwo_B

>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A
Probab=99.44  E-value=1.1e-14  Score=124.54  Aligned_cols=56  Identities=21%  Similarity=0.416  Sum_probs=51.8

Q ss_pred             CCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHH---HHHHHHHHHHHHHHHCC
Q ss_conf             452487187998899999999999999975699887987---99999999999876099
Q gi|254780638|r    4 ADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE---AKEKFAQISEAYEVLRD   59 (384)
Q Consensus         4 ~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~~---A~ekFkeI~eAYevLsD   59 (384)
                      .++|++|||+..||.+|||+|||+++++||||+|++++.   |+++|+.|++||++|++
T Consensus        33 ~~~~~~Lg~~~~~t~~eIKkaYrk~~~~~HPDk~~~~~~~~~A~~~f~~i~~Aye~~~~   91 (92)
T 2qwo_B           33 ETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFEN   91 (92)
T ss_dssp             CCSCCCCCGGGSSSHHHHHHHHHHHHHHTCHHHHTTSTTHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             67883578666699999999999999987977689977899999999999999999855