HHsearch results for GI: 254780638 and protein with PDBid: 2ys8_A

>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=98.23  E-value=2.5e-06  Score=64.43  Aligned_cols=54  Identities=28%  Similarity=0.549  Sum_probs=46.9

Q ss_pred             CCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             7452487187998899999999999999975699887987999999999998760
Q gi|254780638|r    3 KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVL   57 (384)
Q Consensus         3 ~~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~~A~ekFkeI~eAYevL   57 (384)
                      -+|-|+.|||.+.||.+|+-+||||||.-.||||-. -|.+|.-||.+-+|-..|
T Consensus        26 skdswdmlgvkpgasrdevnkayrklavllhpdkcv-apgsedafkavvnartal   79 (90)
T 2ys8_A           26 SKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCV-APGSEDAFKAVVNARTAL   79 (90)
T ss_dssp             CSSHHHHHTCCTTCCHHHHHHHHHHHHHHHCTTTCC-CTTHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCC-CCCCHHHHHHHHHHHHHH
T ss_conf             541188747788856889999999888750664345-889588999999999999