HHsearch results for GI: 254780638 and protein with PDBid: 2yua_A

>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=99.88  E-value=6.3e-23  Score=183.57  Aligned_cols=71  Identities=38%  Similarity=0.649  Sum_probs=67.1

Q ss_pred             CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             98745248718799889999999999999997569988798799999999999876099899999877248
Q gi|254780638|r    1 MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGH   71 (384)
Q Consensus         1 ~~~~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~~A~ekFkeI~eAYevLsD~~kR~~YD~~G~   71 (384)
                      ++.+|||+||||+++||.+|||+|||+||++||||+|+++++++++|++|++||+||+|+++|+.||+++.
T Consensus        14 ~~~~~~Y~iLgv~~~as~~eIk~aY~~la~~~HPDk~~~~~~~~~~f~~i~~Ay~iL~d~~~R~~YD~~~~   84 (99)
T 2yua_A           14 YSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLL   84 (99)
T ss_dssp             SCSSHHHHHHTCCTTCCHHHHHHHHHHHHHHSCTTTCSSCSHHHHHHHHHHHHHHHTTSHHHHHHHHHTCC
T ss_pred             CCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCC
T ss_conf             76355998849999969999999999999997965356666899999999999999799999999977687