BLAST/PSIBLAST alignment of GI: 254780638 and GI: 190889814 at iteration 1
>gi|190889814|ref|YP_001976356.1| molecular chaperone protein DnaJ [Rhizobium etli CIAT 652] Length = 375
>gi|226735592|sp|B3PXH2|DNAJ_RHIE6 RecName: Full=Chaperone protein dnaJ Length = 375
>gi|190695093|gb|ACE89178.1| molecular chaperone protein DnaJ [Rhizobium etli CIAT 652] Length = 375
>gi|327192778|gb|EGE59707.1| molecular chaperone protein DnaJ [Rhizobium etli CNPAF512] Length = 375
 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 304/380 (80%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ ++A +++LK+AFR LAMKYHPD+N +D +A+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G G      +    FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGGG-----GFAGGGFSDIFEDIFGEMMGGGRARQRSSGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAFSGKT QIR PT++ C  CSGSGAKPGT P +C  C GSGRV
Sbjct: 116 RERGADLRYNMEITLEEAFSGKTAQIRVPTSITCDVCSGSGAKPGTQPKNCGTCQGSGRV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQIIP PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 176 -RAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQ 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 235 GEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLK KGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQIS
Sbjct: 295 SRVTVPEGTQAGKQFRLKSKGMPVLRSAQTGDLYIQIQIETPQKLTKRQRELLQEFEQIS 354

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FF+
Sbjct: 355 SKENNPESTGFFARMKEFFE 374