BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780638|ref|YP_003065051.1| molecular chaperone protein
DnaJ [Candidatus Liberibacter asiaticus str. psy62]
         (384 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780638|ref|YP_003065051.1| molecular chaperone protein DnaJ [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040315|gb|ACT57111.1| molecular chaperone protein DnaJ [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 384

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/384 (100%), Positives = 384/384 (100%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP
Sbjct: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST
Sbjct: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV
Sbjct: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS
Sbjct: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH
Sbjct: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS
Sbjct: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360

Query: 361 SQDNNPQSTGFFARMKDFFDSLKN 384
           SQDNNPQSTGFFARMKDFFDSLKN
Sbjct: 361 SQDNNPQSTGFFARMKDFFDSLKN 384


>gi|315122170|ref|YP_004062659.1| molecular chaperone protein DnaJ [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495572|gb|ADR52171.1| molecular chaperone protein DnaJ [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 384

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/382 (84%), Positives = 358/382 (93%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFYQVLG++RNA D++LK+AFRSLAMKYHPD+N+NDP+AKE+F QISEAYEVLRDP
Sbjct: 1   MTKPDFYQVLGVERNANDKELKSAFRSLAMKYHPDRNQNDPKAKERFGQISEAYEVLRDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRALYDQGGH+ALE+G QS  AGGFG  M+G+S FSE+FE IFGG+MGSGRS+KRS++T
Sbjct: 61  QKRALYDQGGHDALEHGGQSYSAGGFGNNMHGSSVFSEIFEDIFGGMMGSGRSHKRSTAT 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           GEAGADLRYNL+ISLEEAFSGK +QI  PTAVKC++CSGSGAKPGTNP  CNICNGSGRV
Sbjct: 121 GEAGADLRYNLDISLEEAFSGKAIQINIPTAVKCNSCSGSGAKPGTNPKTCNICNGSGRV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           YTTAQ+FFSIERAC TC+GSG+II +PCSKCHGQGR++EEKLLSVN+PPGVDDGTRIRLS
Sbjct: 181 YTTAQNFFSIERACVTCQGSGKIISNPCSKCHGQGRIAEEKLLSVNIPPGVDDGTRIRLS 240

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++GG PGDLYIFISVKKHQFF+RDGADLYCTVPISIVT A+GGTFDVATLDATH
Sbjct: 241 GEGEAGIHGGPPGDLYIFISVKKHQFFQRDGADLYCTVPISIVTTAIGGTFDVATLDATH 300

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV IPEGTQTGKQFRLKGKGMPV+NS RKGDLYVQ+QVETPQKLNKRQRELL+EFEQIS
Sbjct: 301 SRVNIPEGTQTGKQFRLKGKGMPVVNSTRKGDLYVQLQVETPQKLNKRQRELLKEFEQIS 360

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S+DNNPQSTGFF RMKDFFDSL
Sbjct: 361 SKDNNPQSTGFFVRMKDFFDSL 382


>gi|325291563|ref|YP_004277427.1| DnaJ family molecular chaperone [Agrobacterium sp. H13-3]
 gi|325059416|gb|ADY63107.1| DnaJ family molecular chaperone [Agrobacterium sp. H13-3]
          Length = 377

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 304/380 (80%), Gaps = 4/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ + A +++LK+AFR LAMKYHPD+N +D +++ KF +I+EAYE L+DP
Sbjct: 1   MAKADFYETLGVSKTADEKELKSAFRKLAMKYHPDKNPDDADSERKFKEINEAYETLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G  G   G + N  FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRFGHAAFENGGMGGGGMG--GGGFANGGFSDIFEDIFGEMMGGGRA-RRSSGG 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAF+GKT QIR PT++ C  CSGSGAKPGT P  C  C GSGRV
Sbjct: 118 RERGADLRYNMEITLEEAFAGKTAQIRVPTSITCDVCSGSGAKPGTQPKTCGTCQGSGRV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFS+ER C TC G GQ I  PCSKCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 178 RA-AQGFFSVERTCPTCHGRGQTISDPCSKCHGQGRVTEERSLSVNIPSGIEDGTRIRLQ 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+SV+ H+FF+RDGADLYCTVPIS+ T A+GGTFDV TLD T 
Sbjct: 237 GEGEAGMRGGPAGDLYIFLSVRPHEFFQRDGADLYCTVPISMTTAALGGTFDVTTLDGTK 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL+KRQRELL+EFEQ+S
Sbjct: 297 SRVTVPEGTQPGKQFRLKGKGMPVLRSAQTGDLYIQIQIETPQKLSKRQRELLQEFEQLS 356

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           SQ+NNP+STGFFARMK+FFD
Sbjct: 357 SQENNPESTGFFARMKEFFD 376


>gi|62899970|sp|Q6RSN5|DNAJ_AGRTU RecName: Full=Chaperone protein dnaJ
 gi|40362978|gb|AAR84666.1| DnaJ [Agrobacterium tumefaciens]
          Length = 379

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/380 (66%), Positives = 305/380 (80%), Gaps = 2/380 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ + A +++LK+AFR LAMKYHPD+N +D +++ KF +I+EAYE L+DP
Sbjct: 1   MAKADFYETLGVSKTADEKELKSAFRKLAMKYHPDKNPDDADSERKFKEINEAYETLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G GGFG G + N  FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRFGHAAFENGGMGGGGGGFGGGGFANGGFSDIFEDIFGEMMGGGRA-RRSSGG 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAF+GKT QIR PT++ C  CSGSGAKPGT P  C  C GSGRV
Sbjct: 120 RERGADLRYNMEITLEEAFTGKTAQIRVPTSITCDVCSGSGAKPGTQPKTCATCQGSGRV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFS+ER C TC G GQ I  PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 180 RA-AQGFFSVERTCPTCHGRGQTISDPCGKCHGQGRVTEERSLSVNIPSGIEDGTRIRLQ 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+SV+ H+FF+RDGADLYCTVPIS+ T A+GGTFDV TLD T 
Sbjct: 239 GEGEAGMRGGPAGDLYIFLSVRPHEFFQRDGADLYCTVPISMTTAALGGTFDVTTLDGTK 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL+KRQRELL+EFEQ+S
Sbjct: 299 SRVTVPEGTQPGKQFRLKGKGMPVLRSAQTGDLYIQIQIETPQKLSKRQRELLQEFEQLS 358

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK FFD
Sbjct: 359 SKENNPESTGFFARMKKFFD 378


>gi|86355804|ref|YP_467696.1| DnaJ family molecular chaperone [Rhizobium etli CFN 42]
 gi|123513417|sp|Q2KDW7|DNAJ_RHIEC RecName: Full=Chaperone protein dnaJ
 gi|86279906|gb|ABC88969.1| molecular chaperone protein, DnaJ family [Rhizobium etli CFN 42]
          Length = 375

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 304/380 (80%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ ++A +++LK+AFR LAMKYHPD+N +D EA+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKEAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G G      +    FS++FE IFG +MG GR  +RS+  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGGG-----GFAGGGFSDIFEDIFGEMMGGGRGRQRSAGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAFSGKT QIR PT++ C  CSGSGAKPGT P +C  C G+GRV
Sbjct: 116 RERGADLRYNMEITLEEAFSGKTAQIRVPTSITCDVCSGSGAKPGTQPKNCGTCQGTGRV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQIIP PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 176 -RAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQ 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 235 GEGEAGTRGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV++PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQIS
Sbjct: 295 SRVSVPEGTQAGKQFRLKGKGMPVLRSAQTGDLYIQIQIETPQKLTKRQRELLQEFEQIS 354

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FF+
Sbjct: 355 SKENNPESTGFFARMKEFFE 374


>gi|15887475|ref|NP_353156.1| DnaJ family molecular chaperone [Agrobacterium tumefaciens str.
           C58]
 gi|20141396|sp|P50018|DNAJ_AGRT5 RecName: Full=Chaperone protein dnaJ
 gi|15154994|gb|AAK85941.1| molecular chaperone, DnaJ family [Agrobacterium tumefaciens str.
           C58]
          Length = 377

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 249/380 (65%), Positives = 303/380 (79%), Gaps = 4/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ + A +++LK+AFR LAMK+HPD+N +D +++ KF +I+EAYE L+DP
Sbjct: 1   MAKADFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPDDADSERKFKEINEAYETLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G  G   G + N  FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRFGHAAFENGGMGGGGMG--GGGFANGGFSDIFEDIFGEMMGGGRA-RRSSGG 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAF+GKT QIR PT++ C  CSGSGAKPGT P  C  C GSGRV
Sbjct: 118 RERGADLRYNMEITLEEAFAGKTAQIRVPTSITCDVCSGSGAKPGTQPKTCATCQGSGRV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFS+ER C TC G GQ I  PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 178 RA-AQGFFSVERTCPTCHGRGQTISDPCGKCHGQGRVTEERSLSVNIPSGIEDGTRIRLQ 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+SV+ H+FF+RDGADLYCTVPIS+ T A+GGTFDV TLD T 
Sbjct: 237 GEGEAGMRGGPAGDLYIFLSVRPHEFFQRDGADLYCTVPISMTTAALGGTFDVTTLDGTK 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL+KRQRELL+EFEQ+S
Sbjct: 297 SRVTVPEGTQPGKQFRLKGKGMPVLRSAQTGDLYIQIQIETPQKLSKRQRELLQEFEQLS 356

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FFD
Sbjct: 357 SKENNPESTGFFARMKEFFD 376


>gi|190889814|ref|YP_001976356.1| molecular chaperone protein DnaJ [Rhizobium etli CIAT 652]
 gi|226735592|sp|B3PXH2|DNAJ_RHIE6 RecName: Full=Chaperone protein dnaJ
 gi|190695093|gb|ACE89178.1| molecular chaperone protein DnaJ [Rhizobium etli CIAT 652]
 gi|327192778|gb|EGE59707.1| molecular chaperone protein DnaJ [Rhizobium etli CNPAF512]
          Length = 375

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 304/380 (80%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ ++A +++LK+AFR LAMKYHPD+N +D +A+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G G      +    FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGGG-----GFAGGGFSDIFEDIFGEMMGGGRARQRSSGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAFSGKT QIR PT++ C  CSGSGAKPGT P +C  C GSGRV
Sbjct: 116 RERGADLRYNMEITLEEAFSGKTAQIRVPTSITCDVCSGSGAKPGTQPKNCGTCQGSGRV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQIIP PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 176 -RAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQ 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 235 GEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLK KGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQIS
Sbjct: 295 SRVTVPEGTQAGKQFRLKSKGMPVLRSAQTGDLYIQIQIETPQKLTKRQRELLQEFEQIS 354

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FF+
Sbjct: 355 SKENNPESTGFFARMKEFFE 374


>gi|116249918|ref|YP_765756.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. viciae 3841]
 gi|189083354|sp|Q1MN12|DNAJ_RHIL3 RecName: Full=Chaperone protein dnaJ
 gi|115254566|emb|CAK05640.1| putative chaperone protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 375

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/380 (65%), Positives = 305/380 (80%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ ++A +++LK+AFR LAMKYHPD+N +D +A+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G G      +    FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGGG-----GFAGGGFSDIFEDIFGEMMGGGRARQRSSGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEE+FSGKT QIR PT++ C  CSGSGAKPGT P +C  C G+GRV
Sbjct: 116 RERGADLRYNMEITLEESFSGKTAQIRVPTSITCDVCSGSGAKPGTQPKNCGTCQGTGRV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQIIP PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 176 -RAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQ 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 235 GEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQ+S
Sbjct: 295 SRVTVPEGTQVGKQFRLKGKGMPVLRSVQTGDLYIQIQIETPQKLTKRQRELLQEFEQLS 354

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FF+
Sbjct: 355 SKENNPESTGFFARMKEFFE 374


>gi|222084354|ref|YP_002542883.1| molecular chaperone protein [Agrobacterium radiobacter K84]
 gi|254777931|sp|B9JGW2|DNAJ_AGRRK RecName: Full=Chaperone protein dnaJ
 gi|221721802|gb|ACM24958.1| molecular chaperone protein [Agrobacterium radiobacter K84]
          Length = 382

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/384 (65%), Positives = 299/384 (77%), Gaps = 2/384 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KAD+Y+ LG+ R A +++LK+AFR LAM++HPD+N +D +A+ KF +I+EAYE L+DP
Sbjct: 1   MAKADYYETLGVSRTADEKELKSAFRKLAMQFHPDKNPDDNDAERKFKEINEAYETLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A E+G    G  G G    G    S++FE IFG +MG GR   RSS  
Sbjct: 61  NKRAAYDRYGHAAFEHGGMGGGGFGGGGFGGGGGF-SDIFEDIFGEMMGGGRGRARSSGG 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EISLEEAF+GKT QIR PT++ C  CSGSGAKPGT P  C  C GSGRV
Sbjct: 120 RERGADLRYNMEISLEEAFTGKTAQIRVPTSITCDVCSGSGAKPGTQPKTCGTCQGSGRV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFS+ER C TC G GQ IP PC KCHGQGR++EE+ LSVN+P G++DGTRIRL 
Sbjct: 180 -RAAQGFFSVERTCPTCHGRGQTIPDPCGKCHGQGRITEERSLSVNIPSGIEDGTRIRLQ 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 239 GEGEAGTRGGPSGDLYIFLSVKPHEFFQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLK KGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQIS
Sbjct: 299 SRVTVPEGTQVGKQFRLKAKGMPVLRSSQVGDLYIQIQIETPQKLTKRQRELLQEFEQIS 358

Query: 361 SQDNNPQSTGFFARMKDFFDSLKN 384
           S+DNNP+STGFFARMKDFFD+  +
Sbjct: 359 SKDNNPESTGFFARMKDFFDTFSD 382


>gi|209551666|ref|YP_002283583.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226735593|sp|B5ZWQ1|DNAJ_RHILW RecName: Full=Chaperone protein dnaJ
 gi|209537422|gb|ACI57357.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 376

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 249/380 (65%), Positives = 303/380 (79%), Gaps = 5/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ + A +++LK+AFR LAMK+HPD+N +D +A+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKTADEKELKSAFRKLAMKFHPDKNPDDKDAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G      G +    FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGG----GGGFAGGGFSDIFEDIFGEMMGGGRARQRSSGG 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAFSGKT QIR PT++ C  CSGSGAKPGT P +C  C GSGRV
Sbjct: 117 RERGADLRYNMEITLEEAFSGKTAQIRVPTSITCDVCSGSGAKPGTQPKNCGTCQGSGRV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQIIP PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 177 -RAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQ 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 236 GEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV++PEGTQ GKQFRLK KGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQ+S
Sbjct: 296 SRVSVPEGTQAGKQFRLKSKGMPVLRSAQTGDLYIQIQIETPQKLTKRQRELLQEFEQLS 355

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FF+
Sbjct: 356 SKENNPESTGFFARMKEFFE 375


>gi|227824010|ref|YP_002827983.1| chaperone protein DnaJ [Sinorhizobium fredii NGR234]
 gi|254777972|sp|C3MC05|DNAJ_RHISN RecName: Full=Chaperone protein dnaJ
 gi|227343012|gb|ACP27230.1| chaperone protein DnaJ [Sinorhizobium fredii NGR234]
          Length = 379

 Score =  508 bits (1307), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/380 (65%), Positives = 300/380 (78%), Gaps = 4/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D Y+ LG+ +NA +++LK+AFR LAMKYHPD+N  D EA++ F +I+EAYE L+DPQK
Sbjct: 2   KRDLYETLGVKKNADEKELKSAFRKLAMKYHPDRNPGDQEAEKSFKEINEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G   AG       S++FE IFG +MG GR  +RSS   E
Sbjct: 62  RAAYDRYGHAAFEQGGMGAGFGNGFAGGSAGGF-SDIFEDIFGEMMG-GRQ-RRSSGGRE 118

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EI+LEEA+SGKT QIR PT+V C  C+GSGAKPGT+P  C  C GSGR+  
Sbjct: 119 RGADLRYNMEITLEEAYSGKTAQIRVPTSVTCDVCTGSGAKPGTSPKTCATCQGSGRIRA 178

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C TC G GQ I  PC+KCHGQGRV+EE+ LSVN+P G++DGTRIRLSGE
Sbjct: 179 -AQGFFSIERTCPTCGGRGQTITDPCTKCHGQGRVTEERTLSVNIPTGIEDGTRIRLSGE 237

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+F++RDGADLYC+VPIS+ T A+GG FDV TLD T SR
Sbjct: 238 GEAGLRGGPAGDLYIFLSVKPHEFYQRDGADLYCSVPISMTTAALGGKFDVTTLDGTKSR 297

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           VT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQISS+
Sbjct: 298 VTVPEGTQAGKQFRLKGKGMPVLRSNQTGDLYIQIQIETPQKLTKRQRELLQEFEQISSK 357

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +NNPQSTGFF+RMKDFFD+L
Sbjct: 358 ENNPQSTGFFSRMKDFFDTL 377


>gi|241207096|ref|YP_002978192.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860986|gb|ACS58653.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 375

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 303/380 (79%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ + A +++LK+AFR LAMK+HPD+N +D +A+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKTADEKELKSAFRKLAMKFHPDKNPDDKDAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G G      +    FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGGG-----GFAGGGFSDIFEDIFGEMMGGGRARQRSSGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEE+FSGKT QIR PT++ C  CSGSGAKPGT P +C  C G+GRV
Sbjct: 116 RERGADLRYNMEITLEESFSGKTAQIRVPTSITCDVCSGSGAKPGTQPKNCGTCQGTGRV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQIIP PC KCHGQGRV+EE+ LSVN+P G++DGTRIRL 
Sbjct: 176 -RAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQ 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFDVATLD T 
Sbjct: 235 GEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFDVATLDGTK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GKQFRLK KGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQ+S
Sbjct: 295 SRVTVPEGTQVGKQFRLKSKGMPVLRSVQTGDLYIQIQIETPQKLTKRQRELLQEFEQLS 354

Query: 361 SQDNNPQSTGFFARMKDFFD 380
           S++NNP+STGFFARMK+FF+
Sbjct: 355 SKENNPESTGFFARMKEFFE 374


>gi|15963936|ref|NP_384289.1| chaperone protein [Sinorhizobium meliloti 1021]
 gi|307306348|ref|ZP_07586092.1| chaperone protein DnaJ [Sinorhizobium meliloti BL225C]
 gi|307319235|ref|ZP_07598664.1| chaperone protein DnaJ [Sinorhizobium meliloti AK83]
 gi|62900038|sp|Q92T07|DNAJ_RHIME RecName: Full=Chaperone protein dnaJ
 gi|15073111|emb|CAC41570.1| Probable chaperone protein [Sinorhizobium meliloti 1021]
 gi|306895071|gb|EFN25828.1| chaperone protein DnaJ [Sinorhizobium meliloti AK83]
 gi|306902190|gb|EFN32787.1| chaperone protein DnaJ [Sinorhizobium meliloti BL225C]
          Length = 379

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 299/380 (78%), Gaps = 4/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D Y+ LG+ +NA +++LK+AFR LAMKYHPD+N  D E+++ F +I+EAYE L+DPQK
Sbjct: 2   KRDLYETLGVQKNADEKELKSAFRKLAMKYHPDRNPGDQESEKSFKEINEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G   AG   +   S++FE IFG +MG GR  +RSS   E
Sbjct: 62  RAAYDRYGHAAFEQGGMGAGFGNGFAGGGAHGF-SDIFEDIFGEMMG-GRQ-RRSSGGRE 118

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EISLEEA+SGKT QIR PT++ C  C+G+GAKPGT+P  C  C G+GRV  
Sbjct: 119 RGADLRYNMEISLEEAYSGKTAQIRVPTSITCDVCTGTGAKPGTSPKTCGTCQGTGRV-R 177

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C TC G GQ I  PC+KCHGQGRV EE+ LSVN+P G++DGTRIRLSGE
Sbjct: 178 AAQGFFSIERTCPTCGGRGQTIADPCTKCHGQGRVVEERTLSVNIPAGIEDGTRIRLSGE 237

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GG FDV TLD T SR
Sbjct: 238 GEAGLRGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGKFDVTTLDGTKSR 297

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           VT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQISS+
Sbjct: 298 VTVPEGTQAGKQFRLKGKGMPVLRSSQTGDLYIQIQIETPQKLTKRQRELLQEFEQISSK 357

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +NNP+STGFF+RMKDFFD+L
Sbjct: 358 ENNPESTGFFSRMKDFFDTL 377


>gi|222147248|ref|YP_002548205.1| chaperone protein DnaJ [Agrobacterium vitis S4]
 gi|254777932|sp|B9JZ89|DNAJ_AGRVS RecName: Full=Chaperone protein dnaJ
 gi|221734238|gb|ACM35201.1| molecular chaperone DnaJ family [Agrobacterium vitis S4]
          Length = 380

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 248/383 (64%), Positives = 298/383 (77%), Gaps = 7/383 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ + A +++LK+AFR LAMK+HPD+N  D E++ KF +I+EAYE L+DP
Sbjct: 1   MAKADFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPGDAESERKFKEINEAYETLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS-S 119
           QKRA YD+ GH A E   Q       G G +    FS++FE IFG +MG GR       S
Sbjct: 61  QKRAAYDRFGHAAFE---QGGMGSAGGGGGFAGGGFSDIFEDIFGEMMGGGRGGNARGRS 117

Query: 120 TG--EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           TG  E GADLRYN+EISLEEAF+GKT QIR PT++ C  CSGSGAKPGT P  C  C GS
Sbjct: 118 TGGRERGADLRYNMEISLEEAFTGKTAQIRVPTSITCEVCSGSGAKPGTKPTTCATCQGS 177

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           GRV   AQ FFSIER C TC+G GQ I  PC KCHGQGRV+EE+ LSV++P G++DGTRI
Sbjct: 178 GRVRA-AQGFFSIERTCPTCQGRGQTISDPCGKCHGQGRVTEERQLSVSIPSGIEDGTRI 236

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL GEG AG+ GG  GDLYIF+SVK HQFF+R+GADLYC+VPIS+ T A+GGTFDV TLD
Sbjct: 237 RLQGEGEAGLRGGPSGDLYIFLSVKPHQFFQREGADLYCSVPISMTTAALGGTFDVTTLD 296

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
            T SRVT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EF+
Sbjct: 297 GTKSRVTVPEGTQPGKQFRLKGKGMPVLRSAQMGDLYIQIQIETPQKLTKRQRELLQEFD 356

Query: 358 QISSQDNNPQSTGFFARMKDFFD 380
           QISS++NNP+STGFFARMK+FF+
Sbjct: 357 QISSKENNPESTGFFARMKEFFE 379


>gi|150398579|ref|YP_001329046.1| chaperone protein DnaJ [Sinorhizobium medicae WSM419]
 gi|189083382|sp|A6UEY1|DNAJ_SINMW RecName: Full=Chaperone protein dnaJ
 gi|150030094|gb|ABR62211.1| chaperone protein DnaJ [Sinorhizobium medicae WSM419]
          Length = 375

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 296/380 (77%), Gaps = 8/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D Y+ LG+ ++A +++LK+AFR LAMKYHPD+N  D EA++ F +I+EAYE L+DPQK
Sbjct: 2   KRDLYETLGVQKSADEKELKSAFRKLAMKYHPDRNPGDNEAEKSFKEINEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E     QG  G G    G   FS++FE IFG +MG GR  +RSS   E
Sbjct: 62  RAAYDRYGHAAFE-----QGGMGNGFAGGGAHGFSDIFEDIFGEMMG-GRQ-RRSSGGRE 114

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EISLEEA+SGKT QIR PT++ C  C+G+GAKPGT+P  C  C G+GRV  
Sbjct: 115 RGADLRYNMEISLEEAYSGKTAQIRVPTSITCDVCTGTGAKPGTSPKTCGTCQGTGRV-R 173

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C TC G GQ I  PC+KCHGQGRV EE+ LSVN+P G++DGTRIRLSGE
Sbjct: 174 AAQGFFSIERTCPTCGGRGQTITDPCTKCHGQGRVVEERTLSVNIPAGIEDGTRIRLSGE 233

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T  +GG FDV TLD T SR
Sbjct: 234 GEAGLRGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTATLGGKFDVTTLDGTKSR 293

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           VT+PEGTQ GKQFRLKGKGMPV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EFEQISS+
Sbjct: 294 VTVPEGTQAGKQFRLKGKGMPVLRSSQMGDLYIQIQIETPQKLTKRQRELLQEFEQISSK 353

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +NNP+S GFF+RMK FFD+L
Sbjct: 354 ENNPESAGFFSRMKGFFDTL 373


>gi|110633037|ref|YP_673245.1| chaperone protein DnaJ [Mesorhizobium sp. BNC1]
 gi|123353885|sp|Q11KJ5|DNAJ_MESSB RecName: Full=Chaperone protein dnaJ
 gi|110284021|gb|ABG62080.1| chaperone protein DnaJ [Chelativorans sp. BNC1]
          Length = 374

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/380 (61%), Positives = 298/380 (78%), Gaps = 9/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           KADFY+ L + RNA +++LK+AFR LAM+YHPD+N  D EA++KF +I+EAYE LRDPQK
Sbjct: 2   KADFYETLCVSRNADEKELKSAFRKLAMQYHPDRNPGDMEAEKKFKEINEAYETLRDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G  ++G        +    F+++FE IFG IMG  R  +R S   E
Sbjct: 62  RAAYDRFGHAAFEQGMGARGG-------FNGGGFADIFEDIFGDIMGGAR--QRRSGGRE 112

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EI+LEE+F+GKT QIR PTAV C  C+GSGA+PG++P+ C +C+G+GRV  
Sbjct: 113 RGADLRYNMEITLEESFTGKTAQIRVPTAVTCDECAGSGARPGSSPVQCPMCHGAGRVRA 172

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
           +   FFSIER C  C+G GQII  PC KC GQGR++EE+ LSVN+P G++DGTRIRL+GE
Sbjct: 173 STGGFFSIERTCPQCQGRGQIIDDPCRKCSGQGRLTEERSLSVNIPAGIEDGTRIRLAGE 232

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG PGDLYIF+S+K H+FF+RDGADLYC VPIS+ T A+GG+F+V TLD T +R
Sbjct: 233 GEAGLRGGPPGDLYIFLSIKPHEFFQRDGADLYCKVPISMTTAALGGSFEVTTLDGTQTR 292

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ+G+QFRL+GKGMPV+   + GDLY+QV VETPQ L +RQRELLEEFE+ISS 
Sbjct: 293 VKVPEGTQSGRQFRLRGKGMPVLRQPQVGDLYIQVAVETPQNLTRRQRELLEEFEKISSG 352

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+PQSTGFFARMKDFF++ 
Sbjct: 353 ENSPQSTGFFARMKDFFETF 372


>gi|260463408|ref|ZP_05811608.1| chaperone protein DnaJ [Mesorhizobium opportunistum WSM2075]
 gi|259030733|gb|EEW32009.1| chaperone protein DnaJ [Mesorhizobium opportunistum WSM2075]
          Length = 376

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 294/380 (77%), Gaps = 8/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           KADFY+ LG+ + A +++LK+AFR LAM++HPD+N  D   + KF +I+EAYE L+DPQK
Sbjct: 2   KADFYETLGVQKGADEKELKSAFRKLAMQFHPDRNPGDHSCEHKFKEINEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E     QG    GA  +G   F+++FE IFG +MG GR  +RSS   E
Sbjct: 62  RAAYDRFGHAAFE-----QGGMNGGAQGFGAGGFADIFEDIFGDMMG-GRQ-RRSSGGRE 114

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EISLEEAF+GKT QIR P ++ CS CSGSGAKPGT P+ C++CNG G+V  
Sbjct: 115 RGADLRYNMEISLEEAFAGKTAQIRVPASISCSECSGSGAKPGTQPVTCSMCNGHGKVRA 174

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
           T Q FFSIER C  C+G GQ I  PC KC GQGRV+EE+ LSVN+P G++DGTRIRL+ E
Sbjct: 175 T-QGFFSIERTCPQCQGRGQTIKDPCPKCVGQGRVTEERSLSVNIPAGIEDGTRIRLANE 233

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF++VK H+FF+RDGADLYC VPIS+ T A+GG+F+V TLD T ++
Sbjct: 234 GEAGLRGGPSGDLYIFLAVKPHEFFQRDGADLYCKVPISMTTAALGGSFEVTTLDGTQTK 293

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G+QFRLKGKGMPV+     GDLY+Q  VETPQ L++RQRELLEEFEQ+SSQ
Sbjct: 294 VKVPEGTQNGRQFRLKGKGMPVLRQPNVGDLYIQTAVETPQNLSRRQRELLEEFEQLSSQ 353

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           DN+PQS+GFFARMKDFF+S 
Sbjct: 354 DNSPQSSGFFARMKDFFESF 373


>gi|13473985|ref|NP_105553.1| chaperone protein DnaJ [Mesorhizobium loti MAFF303099]
 gi|62900041|sp|Q98DD2|DNAJ_RHILO RecName: Full=Chaperone protein dnaJ
 gi|14024736|dbj|BAB51339.1| heat shock protein; DnaJ [Mesorhizobium loti MAFF303099]
          Length = 376

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/380 (61%), Positives = 294/380 (77%), Gaps = 8/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           KADFY+ LG+ + A +++LK+AFR LAM++HPD+N  D   + KF +I+EAYE L+DPQK
Sbjct: 2   KADFYETLGVQKGADEKELKSAFRKLAMQFHPDRNPGDHSCEHKFKEINEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E     QG    GA  +G   F+++FE IFG +MG GR  +RSS   E
Sbjct: 62  RAAYDRFGHAAFE-----QGGMNGGAQGFGAGGFADIFEDIFGDMMG-GRQ-RRSSGGRE 114

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EISLEEAF+GKT QIR P ++ C+ CSGSGAKPGT P+ C++C+G G+V  
Sbjct: 115 RGADLRYNMEISLEEAFAGKTAQIRVPASISCTECSGSGAKPGTQPVTCSMCHGHGKVRA 174

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
           T Q FFSIER C  C+G GQ I  PC KC GQGRV+EE+ LSVN+P G++DGTRIRL+ E
Sbjct: 175 T-QGFFSIERTCPQCQGRGQTIKDPCPKCAGQGRVTEERSLSVNIPAGIEDGTRIRLANE 233

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF++VK H+FF+RDGADLYC VPIS+ T A+GG+F+V TLD T ++
Sbjct: 234 GEAGLRGGPSGDLYIFLAVKPHEFFQRDGADLYCKVPISMTTAALGGSFEVTTLDGTQTK 293

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G+QFRLKGKGMPV+     GDLY+Q  VETPQ L++RQRELLEEFEQ+SSQ
Sbjct: 294 VKVPEGTQNGRQFRLKGKGMPVLRQPNVGDLYIQTAVETPQNLSRRQRELLEEFEQLSSQ 353

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           DN+PQS+GFFARMKDFF+S 
Sbjct: 354 DNSPQSSGFFARMKDFFESF 373


>gi|319780466|ref|YP_004139942.1| chaperone protein DnaJ [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166354|gb|ADV09892.1| chaperone protein DnaJ [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 376

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/380 (61%), Positives = 292/380 (76%), Gaps = 8/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           KADFY+ LG+ + A +++LK+AFR LAM++HPD+N  D   + KF +I+EAYE L+DPQK
Sbjct: 2   KADFYETLGVQKGADEKELKSAFRKLAMQFHPDRNPGDHSCEHKFKEINEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E     QG    GA  +G   F+++FE IFG +MG GR  +RSS   E
Sbjct: 62  RAAYDRFGHAAFE-----QGGMNGGAQGFGAGGFADIFEDIFGDMMG-GRQ-RRSSGGRE 114

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EI+LEEAF+GKT QIR P ++ CS CSGSGAKPGT P+ C++CNG G+V  
Sbjct: 115 RGADLRYNMEITLEEAFAGKTAQIRVPASISCSECSGSGAKPGTQPVTCSMCNGHGKVRA 174

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
           T Q FFSIER C  C+G GQ I  PC KC GQGRV+EE+ LSVN+P G++DGTRIRL+ E
Sbjct: 175 T-QGFFSIERTCPQCQGRGQTIKDPCPKCAGQGRVTEERSLSVNIPAGIEDGTRIRLANE 233

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF++VK H+FF+RDGADLYC VPIS+ T A+GG+F+V TLD T ++
Sbjct: 234 GEAGLRGGPSGDLYIFLAVKPHEFFQRDGADLYCKVPISMTTAALGGSFEVTTLDGTQTK 293

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V + EGTQ G+QFRLKGKGMPV+     GDLY+Q  VETPQ L +RQRELLEEFEQ+SSQ
Sbjct: 294 VKVTEGTQNGRQFRLKGKGMPVLRQPNVGDLYIQTAVETPQNLTRRQRELLEEFEQLSSQ 353

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           DN+PQS+GFFARMKDFF+S 
Sbjct: 354 DNSPQSSGFFARMKDFFESF 373


>gi|256254036|ref|ZP_05459572.1| chaperone protein DnaJ [Brucella ceti B1/94]
 gi|261221175|ref|ZP_05935456.1| chaperone protein dnaJ [Brucella ceti B1/94]
 gi|260919759|gb|EEX86412.1| chaperone protein dnaJ [Brucella ceti B1/94]
          Length = 377

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 291/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGSE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|254713470|ref|ZP_05175281.1| chaperone protein DnaJ [Brucella ceti M644/93/1]
 gi|254716174|ref|ZP_05177985.1| chaperone protein DnaJ [Brucella ceti M13/05/1]
 gi|261217946|ref|ZP_05932227.1| chaperone DnaJ [Brucella ceti M13/05/1]
 gi|261321204|ref|ZP_05960401.1| chaperone DnaJ [Brucella ceti M644/93/1]
 gi|260923035|gb|EEX89603.1| chaperone DnaJ [Brucella ceti M13/05/1]
 gi|261293894|gb|EEX97390.1| chaperone DnaJ [Brucella ceti M644/93/1]
          Length = 377

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/380 (61%), Positives = 292/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+LLSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERLLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|153008125|ref|YP_001369340.1| chaperone protein DnaJ [Ochrobactrum anthropi ATCC 49188]
 gi|189083341|sp|A6WX07|DNAJ_OCHA4 RecName: Full=Chaperone protein dnaJ
 gi|151560013|gb|ABS13511.1| chaperone protein DnaJ [Ochrobactrum anthropi ATCC 49188]
          Length = 377

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 293/380 (77%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG++R A D+ LKTAFR LAM+YHPD+N N+PEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVERTADDKVLKTAFRKLAMEYHPDRNPNNPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGSGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAK G+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKAGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C TC G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRLSGE
Sbjct: 176 AAQGFFSVERTCPTCNGRGQIIKDPCGKCHGQGRVTQERSLSVNIPAGIEDGTRIRLSGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDG+DLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGMRGGPSGDLYIFLSVKPHEFFQRDGSDLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +P+GTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPDGTQNGKQFRLKGKGMPVLRQAAVGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|62290966|ref|YP_222759.1| chaperone protein DnaJ [Brucella abortus bv. 1 str. 9-941]
 gi|82700877|ref|YP_415451.1| chaperone protein DnaJ [Brucella melitensis biovar Abortus 2308]
 gi|189025180|ref|YP_001935948.1| chaperone protein DnaJ [Brucella abortus S19]
 gi|237816471|ref|ZP_04595464.1| chaperone protein DnaJ [Brucella abortus str. 2308 A]
 gi|254690262|ref|ZP_05153516.1| DnaJ, chaperone protein DnaJ [Brucella abortus bv. 6 str. 870]
 gi|254696378|ref|ZP_05158206.1| DnaJ, chaperone protein DnaJ [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731292|ref|ZP_05189870.1| DnaJ, chaperone protein DnaJ [Brucella abortus bv. 4 str. 292]
 gi|256258515|ref|ZP_05464051.1| DnaJ, chaperone protein DnaJ [Brucella abortus bv. 9 str. C68]
 gi|260546231|ref|ZP_05821971.1| chaperone dnaJ [Brucella abortus NCTC 8038]
 gi|260755800|ref|ZP_05868148.1| chaperone protein dnaJ [Brucella abortus bv. 6 str. 870]
 gi|260759023|ref|ZP_05871371.1| chaperone protein dnaJ [Brucella abortus bv. 4 str. 292]
 gi|260760748|ref|ZP_05873091.1| chaperone protein dnaJ [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884825|ref|ZP_05896439.1| chaperone protein dnaJ [Brucella abortus bv. 9 str. C68]
 gi|297247353|ref|ZP_06931071.1| chaperone DnaJ [Brucella abortus bv. 5 str. B3196]
 gi|73919239|sp|Q57AD6|DNAJ_BRUAB RecName: Full=Chaperone protein dnaJ
 gi|123547284|sp|Q2YQV1|DNAJ_BRUA2 RecName: Full=Chaperone protein dnaJ
 gi|226735544|sp|B2S9C2|DNAJ_BRUA1 RecName: Full=Chaperone protein dnaJ
 gi|62197098|gb|AAX75398.1| DnaJ, chaperone protein DnaJ [Brucella abortus bv. 1 str. 9-941]
 gi|82616978|emb|CAJ12086.1| Cytochrome c heme-binding site:DnaJ central domain (CXXCXGXG):Heat
           shock protein DnaJ, N-terminal:Chaperone DnaJ,
           C-terminal [Brucella melitensis biovar Abortus 2308]
 gi|189020752|gb|ACD73474.1| DnaJ, chaperone protein DnaJ [Brucella abortus S19]
 gi|237788538|gb|EEP62753.1| chaperone protein DnaJ [Brucella abortus str. 2308 A]
 gi|260096338|gb|EEW80214.1| chaperone dnaJ [Brucella abortus NCTC 8038]
 gi|260669341|gb|EEX56281.1| chaperone protein dnaJ [Brucella abortus bv. 4 str. 292]
 gi|260671180|gb|EEX58001.1| chaperone protein dnaJ [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675908|gb|EEX62729.1| chaperone protein dnaJ [Brucella abortus bv. 6 str. 870]
 gi|260874353|gb|EEX81422.1| chaperone protein dnaJ [Brucella abortus bv. 9 str. C68]
 gi|297174522|gb|EFH33869.1| chaperone DnaJ [Brucella abortus bv. 5 str. B3196]
          Length = 377

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 291/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPTGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|17988284|ref|NP_540918.1| chaperone protein DnaJ [Brucella melitensis bv. 1 str. 16M]
 gi|23502974|ref|NP_699101.1| chaperone protein DnaJ [Brucella suis 1330]
 gi|161620038|ref|YP_001593925.1| chaperone protein DnaJ [Brucella canis ATCC 23365]
 gi|163844142|ref|YP_001628547.1| chaperone protein DnaJ [Brucella suis ATCC 23445]
 gi|225626498|ref|ZP_03784537.1| chaperone protein DnaJ [Brucella ceti str. Cudo]
 gi|225853554|ref|YP_002733787.1| chaperone protein DnaJ [Brucella melitensis ATCC 23457]
 gi|254700759|ref|ZP_05162587.1| chaperone protein DnaJ [Brucella suis bv. 5 str. 513]
 gi|254705131|ref|ZP_05166959.1| chaperone protein DnaJ [Brucella suis bv. 3 str. 686]
 gi|254707354|ref|ZP_05169182.1| chaperone protein DnaJ [Brucella pinnipedialis M163/99/10]
 gi|254709104|ref|ZP_05170915.1| chaperone protein DnaJ [Brucella pinnipedialis B2/94]
 gi|254718169|ref|ZP_05179980.1| chaperone protein DnaJ [Brucella sp. 83/13]
 gi|256030630|ref|ZP_05444244.1| chaperone protein DnaJ [Brucella pinnipedialis M292/94/1]
 gi|256045733|ref|ZP_05448611.1| chaperone protein DnaJ [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060091|ref|ZP_05450273.1| chaperone protein DnaJ [Brucella neotomae 5K33]
 gi|256158627|ref|ZP_05456514.1| chaperone protein DnaJ [Brucella ceti M490/95/1]
 gi|256262961|ref|ZP_05465493.1| chaperone protein dnaJ [Brucella melitensis bv. 2 str. 63/9]
 gi|256370524|ref|YP_003108035.1| chaperone protein DnaJ [Brucella microti CCM 4915]
 gi|260169534|ref|ZP_05756345.1| chaperone protein DnaJ [Brucella sp. F5/99]
 gi|260563030|ref|ZP_05833516.1| chaperone dnaJ [Brucella melitensis bv. 1 str. 16M]
 gi|260567402|ref|ZP_05837872.1| chaperone dnaJ [Brucella suis bv. 4 str. 40]
 gi|261314838|ref|ZP_05954035.1| chaperone DnaJ [Brucella pinnipedialis M163/99/10]
 gi|261316603|ref|ZP_05955800.1| chaperone dnaJ [Brucella pinnipedialis B2/94]
 gi|261324066|ref|ZP_05963263.1| chaperone protein dnaJ [Brucella neotomae 5K33]
 gi|261751267|ref|ZP_05994976.1| chaperone protein dnaJ [Brucella suis bv. 5 str. 513]
 gi|261755832|ref|ZP_05999541.1| chaperone protein dnaJ [Brucella suis bv. 3 str. 686]
 gi|261759060|ref|ZP_06002769.1| chaperone protein dnaJ [Brucella sp. F5/99]
 gi|265983124|ref|ZP_06095859.1| chaperone DnaJ [Brucella sp. 83/13]
 gi|265987675|ref|ZP_06100232.1| chaperone protein dnaJ [Brucella pinnipedialis M292/94/1]
 gi|265992149|ref|ZP_06104706.1| chaperone protein dnaJ [Brucella melitensis bv. 1 str. Rev.1]
 gi|265997135|ref|ZP_06109692.1| chaperone protein dnaJ [Brucella ceti M490/95/1]
 gi|306837684|ref|ZP_07470553.1| chaperone protein DnaJ [Brucella sp. NF 2653]
 gi|38257627|sp|Q8FXX1|DNAJ_BRUSU RecName: Full=Chaperone protein dnaJ
 gi|38257709|sp|Q8YE77|DNAJ_BRUME RecName: Full=Chaperone protein dnaJ
 gi|189083298|sp|A9M9V9|DNAJ_BRUC2 RecName: Full=Chaperone protein dnaJ
 gi|189083299|sp|B0CJX5|DNAJ_BRUSI RecName: Full=Chaperone protein dnaJ
 gi|254777941|sp|C0RG11|DNAJ_BRUMB RecName: Full=Chaperone protein dnaJ
 gi|17984054|gb|AAL53182.1| chaperone protein dnaj [Brucella melitensis bv. 1 str. 16M]
 gi|23349012|gb|AAN31016.1| chaperone protein DnaJ [Brucella suis 1330]
 gi|161336849|gb|ABX63154.1| chaperone protein DnaJ [Brucella canis ATCC 23365]
 gi|163674865|gb|ABY38976.1| chaperone protein DnaJ [Brucella suis ATCC 23445]
 gi|225618155|gb|EEH15198.1| chaperone protein DnaJ [Brucella ceti str. Cudo]
 gi|225641919|gb|ACO01833.1| chaperone protein DnaJ [Brucella melitensis ATCC 23457]
 gi|256000687|gb|ACU49086.1| chaperone protein DnaJ [Brucella microti CCM 4915]
 gi|260153046|gb|EEW88138.1| chaperone dnaJ [Brucella melitensis bv. 1 str. 16M]
 gi|260156920|gb|EEW92000.1| chaperone dnaJ [Brucella suis bv. 4 str. 40]
 gi|261295826|gb|EEX99322.1| chaperone dnaJ [Brucella pinnipedialis B2/94]
 gi|261300046|gb|EEY03543.1| chaperone protein dnaJ [Brucella neotomae 5K33]
 gi|261303864|gb|EEY07361.1| chaperone DnaJ [Brucella pinnipedialis M163/99/10]
 gi|261739044|gb|EEY27040.1| chaperone protein dnaJ [Brucella sp. F5/99]
 gi|261741020|gb|EEY28946.1| chaperone protein dnaJ [Brucella suis bv. 5 str. 513]
 gi|261745585|gb|EEY33511.1| chaperone protein dnaJ [Brucella suis bv. 3 str. 686]
 gi|262551603|gb|EEZ07593.1| chaperone protein dnaJ [Brucella ceti M490/95/1]
 gi|263003215|gb|EEZ15508.1| chaperone protein dnaJ [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092836|gb|EEZ17011.1| chaperone protein dnaJ [Brucella melitensis bv. 2 str. 63/9]
 gi|264659872|gb|EEZ30133.1| chaperone protein dnaJ [Brucella pinnipedialis M292/94/1]
 gi|264661716|gb|EEZ31977.1| chaperone DnaJ [Brucella sp. 83/13]
 gi|306407242|gb|EFM63452.1| chaperone protein DnaJ [Brucella sp. NF 2653]
 gi|326410126|gb|ADZ67191.1| chaperone protein DnaJ [Brucella melitensis M28]
 gi|326539845|gb|ADZ88060.1| chaperone protein DnaJ [Brucella melitensis M5-90]
          Length = 377

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 291/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|239833173|ref|ZP_04681502.1| chaperone protein DnaJ [Ochrobactrum intermedium LMG 3301]
 gi|239825440|gb|EEQ97008.1| chaperone protein DnaJ [Ochrobactrum intermedium LMG 3301]
          Length = 377

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 294/380 (77%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG++R A D+ LKTAFR LAM+YHPD+N ++PEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVERTADDKTLKTAFRKLAMEYHPDRNPDNPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G   AG  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFAGGGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAK G+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKAGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C TC G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPTCNGRGQIIKDPCGKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDG+DLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGMRGGPSGDLYIFLSVKPHEFFQRDGSDLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQAAVGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|256112453|ref|ZP_05453374.1| chaperone protein DnaJ [Brucella melitensis bv. 3 str. Ether]
 gi|265993887|ref|ZP_06106444.1| chaperone protein dnaJ [Brucella melitensis bv. 3 str. Ether]
 gi|262764868|gb|EEZ10789.1| chaperone protein dnaJ [Brucella melitensis bv. 3 str. Ether]
          Length = 377

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 291/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNMPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|306842761|ref|ZP_07475403.1| chaperone protein DnaJ [Brucella sp. BO2]
 gi|306287105|gb|EFM58610.1| chaperone protein DnaJ [Brucella sp. BO2]
          Length = 377

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 290/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GK  QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKAAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|306843546|ref|ZP_07476147.1| chaperone protein DnaJ [Brucella sp. BO1]
 gi|306276237|gb|EFM57937.1| chaperone protein DnaJ [Brucella sp. BO1]
          Length = 377

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 291/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKG+PV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGVPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|294851352|ref|ZP_06792025.1| chaperone DnaJ [Brucella sp. NVSL 07-0026]
 gi|294819941|gb|EFG36940.1| chaperone DnaJ [Brucella sp. NVSL 07-0026]
          Length = 377

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 290/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ G  A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGRAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGQMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|254694749|ref|ZP_05156577.1| DnaJ, chaperone protein DnaJ [Brucella abortus bv. 3 str. Tulya]
 gi|261215075|ref|ZP_05929356.1| chaperone protein dnaJ [Brucella abortus bv. 3 str. Tulya]
 gi|260916682|gb|EEX83543.1| chaperone protein dnaJ [Brucella abortus bv. 3 str. Tulya]
          Length = 377

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 289/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG  P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGLQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ L VN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLLVNIPTGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++SSQ
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSSQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S GFF+RMK+FF+ +
Sbjct: 356 ENSPKSAGFFSRMKEFFEGI 375


>gi|148560749|ref|YP_001259925.1| chaperone protein DnaJ [Brucella ovis ATCC 25840]
 gi|158518558|sp|Q05980|DNAJ_BRUO2 RecName: Full=Chaperone protein dnaJ
 gi|148372006|gb|ABQ61985.1| chaperone protein DnaJ [Brucella ovis ATCC 25840]
          Length = 377

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/380 (60%), Positives = 289/380 (76%), Gaps = 6/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G    G  G +D   +FE IFG +MG     +RS+   E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFGGAGGFAD---IFEDIFGEMMGG--GRRRSNGGRE 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGRV  
Sbjct: 117 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRV-R 175

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV++E+ LSVN+P G++DGTRIRL+GE
Sbjct: 176 AAQGFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQERSLSVNIPAGIEDGTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 236 GEAGLRGGPAGDLYIFLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMPV+     GDLY+Q+ +ETPQ L+KRQRELLEEFE++S Q
Sbjct: 296 VKVPEGTQNGKQFRLKGKGMPVLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSWQ 355

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S G F+RMK+FF+ +
Sbjct: 356 ENSPKSAGLFSRMKEFFEGI 375


>gi|163757546|ref|ZP_02164635.1| molecular chaperone, DnaJ family protein [Hoeflea phototrophica
           DFL-43]
 gi|162285048|gb|EDQ35330.1| molecular chaperone, DnaJ family protein [Hoeflea phototrophica
           DFL-43]
          Length = 381

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/384 (60%), Positives = 295/384 (76%), Gaps = 3/384 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+ LG+ R A +++LK+AFR LAMKYHPD+N +D +A+ KF +I+EAYE L+DP
Sbjct: 1   MAKPDFYETLGVARGADEKELKSAFRKLAMKYHPDKNPDDADAERKFKEINEAYEFLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G      GG G G  G   FS++FE IFG +MG GR  + S   
Sbjct: 61  QKRAAYDRFGHAAFEQGGPGGMGGG-GFGAGGGGGFSDIFEDIFGEMMGGGRGRRSSGGR 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+EISLEEA++GKT QIR PT++ C TC+GSGAKPGT P  C+ C GSGRV
Sbjct: 120 ERG-ADLRYNMEISLEEAYAGKTAQIRVPTSITCDTCTGSGAKPGTQPSTCSTCGGSGRV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C TC G GQ I  PC+KC GQGRV+EE+ LSVN+P G++DGTRIRL+
Sbjct: 179 RA-AQGFFSIERTCPTCHGRGQTITDPCTKCSGQGRVTEERSLSVNIPAGIEDGTRIRLA 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+SV+ H  F+R+GADL+CTVPIS+ T A+GG FD+ T+D   
Sbjct: 238 GEGEAGMRGGPTGDLYIFLSVRPHAVFQREGADLFCTVPISMTTAALGGKFDITTMDGAR 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRVT+PEGTQ GK+ RL+GKGMPV+ S + GDLY+++ +ETPQKL+KRQRELLEEF+++S
Sbjct: 298 SRVTVPEGTQPGKELRLRGKGMPVLRSAQFGDLYIRITIETPQKLSKRQRELLEEFQELS 357

Query: 361 SQDNNPQSTGFFARMKDFFDSLKN 384
           S++N+P+S GFF+RMK FFD+L +
Sbjct: 358 SKENSPESAGFFSRMKGFFDTLTD 381


>gi|114705402|ref|ZP_01438310.1| probable chaperone protein [Fulvimarina pelagi HTCC2506]
 gi|114540187|gb|EAU43307.1| probable chaperone protein [Fulvimarina pelagi HTCC2506]
          Length = 381

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/384 (58%), Positives = 290/384 (75%), Gaps = 6/384 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           KAD+Y+ LG+ RN  DR+LK+AFR LAMKYHPD+N  D +A+ +F ++ EAYEVL+DPQK
Sbjct: 2   KADYYETLGVSRNVDDRELKSAFRKLAMKYHPDRNPGDTDAEARFKELGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGS-GRSYKRSSSTG 121
           R+ YD+ GH A + G      G        +S  +++F+ IFG +MG  GR+ +   ++G
Sbjct: 62  RSAYDRFGHAAFQNGGGGGAGG---FRGDFSSSMADIFDDIFGEMMGGRGRARQSGGTSG 118

Query: 122 -EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E G+DLRYN+EISL EAFSGKT +I  PT ++C  C+GSGAKPGT P  C  C G GRV
Sbjct: 119 RERGSDLRYNMEISLAEAFSGKTAEISVPTTIQCDVCTGSGAKPGTTPSSCPTCGGVGRV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIERAC TC+G G +I  PC+KC G GR+ EE+ L VN+P G++DGTRIRL+
Sbjct: 179 -RAAQGFFSIERACPTCQGRGSVITDPCNKCGGDGRLPEERTLQVNIPEGIEDGTRIRLA 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+S+  H+FF+R+GADLYC+VP+S+   A+GG F+V T+D   
Sbjct: 238 GEGEAGLRGGPAGDLYIFLSIAPHEFFQREGADLYCSVPVSMTKAALGGAFEVQTIDNGT 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +RV +PEGTQTGKQFRLKGKGMPV+ S + GDL++QV VETPQ L+KRQRELLEEF++I 
Sbjct: 298 ARVKLPEGTQTGKQFRLKGKGMPVLRSPQTGDLFIQVMVETPQNLSKRQRELLEEFDEIG 357

Query: 361 SQDNNPQSTGFFARMKDFFDSLKN 384
           S+DN+PQS GFF+RMKDFF++L +
Sbjct: 358 SKDNSPQSNGFFSRMKDFFENLSD 381


>gi|90420762|ref|ZP_01228668.1| chaperone protein DnaJ [Aurantimonas manganoxydans SI85-9A1]
 gi|90335053|gb|EAS48814.1| chaperone protein DnaJ [Aurantimonas manganoxydans SI85-9A1]
          Length = 380

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/381 (58%), Positives = 291/381 (76%), Gaps = 6/381 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           KAD+Y++LG+ R+  ++ LK+AFR LAM+YHPD+N  + +A+ KF ++ EAYEVL+D QK
Sbjct: 2   KADYYEMLGVPRDVDEKGLKSAFRKLAMQYHPDRNPGNADAEVKFKELGEAYEVLKDGQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGS-GRSYKRSSSTG 121
           RA YD+ GH A     Q+ G G  G     +S  +++F+ IFG +MG   R+ ++  +  
Sbjct: 62  RAAYDRFGHAAF----QNGGGGNAGFRGDFSSSMADIFDDIFGEMMGGRARAGRQPGNGR 117

Query: 122 EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVY 181
           E G+DLRYN+EISLEEA+ GKT +I  PT ++C  C+GSGAKPGT+P  C  C G GRV 
Sbjct: 118 ERGSDLRYNMEISLEEAYDGKTAEIGVPTTIQCDECTGSGAKPGTSPKTCPTCAGVGRV- 176

Query: 182 TTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSG 241
             AQ FFSIER C  C+G GQ+I  PC KC G GR+ EE+ LSVN+P G++DGTRIRL+G
Sbjct: 177 RAAQGFFSIERTCPNCQGRGQVIADPCGKCGGDGRLPEERSLSVNIPAGIEDGTRIRLAG 236

Query: 242 EGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS 301
           EG AG+ GG PGDLYIF+SVK H+F +RDGADL+C VP+S+VT A+GG FDV+TLD   +
Sbjct: 237 EGEAGLRGGPPGDLYIFLSVKPHEFMQRDGADLFCQVPLSMVTAALGGHFDVSTLDGNTT 296

Query: 302 RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISS 361
           RV +PEGTQTGKQFR+KGKGMPV+ S + GDL++QV VETPQ L++RQRELLEEFE+ISS
Sbjct: 297 RVKVPEGTQTGKQFRVKGKGMPVLRSPQVGDLFIQVSVETPQNLSRRQRELLEEFEEISS 356

Query: 362 QDNNPQSTGFFARMKDFFDSL 382
            DN+PQSTGFF+RMK+FF+ L
Sbjct: 357 SDNSPQSTGFFSRMKEFFEGL 377


>gi|328545939|ref|YP_004306048.1| Chaperone protein dnaJ [polymorphum gilvum SL003B-26A1]
 gi|326415679|gb|ADZ72742.1| Chaperone protein dnaJ [Polymorphum gilvum SL003B-26A1]
          Length = 372

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 286/383 (74%), Gaps = 14/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A ++ LK+A+R LAM+YHPD+N +D  A+ +F +++EAY+ L+D 
Sbjct: 1   MAKRDFYEVLGVPRDADEKTLKSAYRKLAMQYHPDRNPDDAAAETQFKEVNEAYDTLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSSS 119
           QKRA YD+ GH A E G      GGFGA  +   S  S++FE  FG          R S 
Sbjct: 61  QKRAAYDRFGHAAFENG------GGFGAHSHDFASTMSDIFEEFFG------MGGGRRSG 108

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             E GADLRYNL+I+LEEAFSGKTV+I  PT+V C+ CSGSGAKPGT+P  C  C G+GR
Sbjct: 109 GRERGADLRYNLDITLEEAFSGKTVEIAVPTSVTCTACSGSGAKPGTSPTACRTCGGAGR 168

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V   AQ FF++ER C TC+G GQ+I  PC+ C G GR ++E+ LSVN+P G++DGTRIRL
Sbjct: 169 VRA-AQGFFTLERTCPTCQGRGQVISDPCTSCGGAGRTTQERTLSVNIPAGIEDGTRIRL 227

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG+ GG PGDLYIF+S+K H+FF+RDGADLYC VPIS+ T A+GG FDV T+D  
Sbjct: 228 AGEGEAGLRGGPPGDLYIFLSIKPHEFFQRDGADLYCRVPISMTTAALGGQFDVPTVDGA 287

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            +RV +PE TQTGKQFRLKGKGMPV+ S + GD+Y+QV VETP  L KRQRELL EFE+ 
Sbjct: 288 TTRVKVPESTQTGKQFRLKGKGMPVLRSSQFGDMYIQVTVETPTNLTKRQRELLAEFERE 347

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
           SS +NNP+STGFFAR+KDF D+L
Sbjct: 348 SSGENNPESTGFFARVKDFLDNL 370


>gi|319407934|emb|CBI81588.1| heat shock chaperone protein DnaJ [Bartonella schoenbuchensis R1]
          Length = 376

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 281/380 (73%), Gaps = 10/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA++KF +I EAYEVL+DPQK
Sbjct: 2   KVDYYEILGVTRGCDDKKLKSAFRKLAMQYHPDRNPGDKEAEQKFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G + +G   FG G      F+++FE  FG IMG G  +++ S   E
Sbjct: 62  RAAYDRFGHAAFENGGR-EGVSPFGGG------FADIFEDFFGEIMGGG--HRKRSDGRE 112

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAF+GKT QI  P+++ C  C GSGAK G+ P  C  C G+GRV  
Sbjct: 113 RGADLSYNMEVTLEEAFAGKTAQINIPSSIMCDVCEGSGAKKGSKPQTCGTCYGAGRV-R 171

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            +Q FFSIER C  C G G+II  PCSKCHG  RV   + L VN+P G++DGTR+RLSGE
Sbjct: 172 ASQGFFSIERTCPLCHGRGEIITDPCSKCHGTRRVEANRSLRVNIPAGIEDGTRVRLSGE 231

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG  GG  GDLYIF+S+K H+FF+RDGADL+C VPIS++T  +GG F+V+ L+   +R
Sbjct: 232 GDAGTRGGPAGDLYIFLSIKPHEFFQRDGADLHCRVPISMITAVLGGEFEVSDLNGVKAR 291

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G QFRLKGKGMP++    +GDLY+ + +ETPQKL ++QRELL+EF+++S+ 
Sbjct: 292 VKVPEGTQNGHQFRLKGKGMPILRQQTRGDLYIHITIETPQKLTQKQRELLQEFDKLSNH 351

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+PQS GFF+RMK+FF+++
Sbjct: 352 ENSPQSHGFFSRMKEFFENI 371


>gi|144116|gb|AAC36133.1| heat shock protein 40 [Brucella ovis]
          Length = 375

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/380 (58%), Positives = 277/380 (72%), Gaps = 8/380 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+ LG+ R A D+ LK AFR LAM+YHPD+N +DPEA+ KF +I EAYE L+DPQK
Sbjct: 2   KIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDPEAERKFKEIGEAYETLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E G    G G   AG  G +D   +FE IFG +MG     +R  +  E
Sbjct: 62  RAAYDRFGHAAFENGGMGGGFGNGFAGAGGFAD---IFEDIFGEMMGG----RRRRNGAE 114

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+E++LEEA++GKT QIR PT++ C  CSGSGAKPG+ P  C +C+GSGR   
Sbjct: 115 RGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSGAKPGSQPTTCTMCSGSGRC-R 173

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFS+ER C  C G GQII  PC KCHGQGRV   + LSVN+P       RIRL+GE
Sbjct: 174 AAQGFFSVERTCPGCNGRGQIIKDPCKKCHGQGRVDRGRSLSVNIPAVSRTEPRIRLAGE 233

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYI +SVK H+FF+RDGADLYC VPIS+ T A+GG F+V+TLD T +R
Sbjct: 234 GEAGLRGGPAGDLYILLSVKPHEFFQRDGADLYCKVPISMTTAALGGQFEVSTLDGTQTR 293

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ GKQFRLKGKGMP +     GDLY+Q+ +ETPQ L+KRQRELLEEFE++S Q
Sbjct: 294 VKVPEGTQNGKQFRLKGKGMPGLRQSVTGDLYIQIDIETPQNLSKRQRELLEEFEKLSWQ 353

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+P+S G F+RMK+FF+ +
Sbjct: 354 ENSPKSAGLFSRMKEFFEGI 373


>gi|49473744|ref|YP_031786.1| heat shock protein DnaJ [Bartonella quintana str. Toulouse]
 gi|62899954|sp|Q6G1F8|DNAJ_BARQU RecName: Full=Chaperone protein dnaJ
 gi|49239247|emb|CAF25567.1| Heat shock protein DnaJ [Bartonella quintana str. Toulouse]
          Length = 380

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/383 (56%), Positives = 285/383 (74%), Gaps = 11/383 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ +F +I EAYEVL+DPQK
Sbjct: 2   KVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAGDKEAERRFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGA--GGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           RA YD+ GH A E   Q  G   GGF AG      FS++FE  FG IMG G  +++ S  
Sbjct: 62  RAAYDRFGHAAFENNNQGGGNPFGGFAAG-----GFSDIFEDFFGEIMGGG--HRKRSDG 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADL YN+E++LEEAFSGKT QI  P+++ C +C GSGAK G+ P  C  C+G+GRV
Sbjct: 115 RERGADLSYNMEVTLEEAFSGKTAQINIPSSIVCDSCEGSGAKKGSKPQICGTCHGAGRV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C  C G G++I  PC KC G  RV + + LSVN+P G++DGTRIRLS
Sbjct: 175 -RAAQGFFSIERTCHACNGRGEVITDPCPKCQGTRRVEKNRSLSVNIPAGIEDGTRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+SVK H+FF+R+GADL+C +P+S+VT A+GG F+V+ LD   
Sbjct: 234 GEGDAGIRGGPNGDLYIFLSVKPHEFFQREGADLHCRIPLSMVTAALGGEFEVSDLDGIK 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGR-KGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
           +RV IPEGTQ G+QFRLKGKGMP++   + +GDLY+ + +ETPQKL + QRELL++FE++
Sbjct: 294 ARVKIPEGTQNGRQFRLKGKGMPMLRRQQVRGDLYIHITIETPQKLTQEQRELLQKFEKL 353

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
           S+ +N+PQS GFF+RMK+FF+++
Sbjct: 354 SNHENSPQSHGFFSRMKEFFENI 376


>gi|62900040|sp|Q93S23|DNAJ_RHITR RecName: Full=Chaperone protein dnaJ
 gi|14041678|emb|CAC38775.1| DnaJ protein [Rhizobium tropici]
          Length = 331

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 261/334 (78%), Gaps = 3/334 (0%)

Query: 23  TAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQG 82
           +AFR LAM++HPD+N +D  A+ KF +I+EAYE L+DPQKRA YD+ GH A E+G    G
Sbjct: 1   SAFRKLAMQFHPDKNPDDSNAERKFKEINEAYETLKDPQKRAAYDRYGHAAFEHGGMGGG 60

Query: 83  AGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGK 142
                   +G   FS++FE IFG +MG GR+  RSS   E GADLRYN+EISLEEAFSGK
Sbjct: 61  G--GFGAGFGGGGFSDIFEDIFGEMMGGGRARGRSSGGRERGADLRYNMEISLEEAFSGK 118

Query: 143 TVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQ 202
           T QIR PT++ C  CSGSGAKPGT P  C  C GSGRV   AQ FFS+ER C TC G GQ
Sbjct: 119 TAQIRVPTSITCDVCSGSGAKPGTQPKTCGTCQGSGRVRA-AQGFFSVERTCPTCHGRGQ 177

Query: 203 IIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVK 262
           IIP PC+KCHGQGRV+EE+ LSVN+P G++DGTRIRL GEG AG+ GG  GDLYIF+SVK
Sbjct: 178 IIPDPCTKCHGQGRVTEERSLSVNIPAGIEDGTRIRLQGEGEAGLRGGPSGDLYIFLSVK 237

Query: 263 KHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGM 322
            H+FF+RDGADLYC VPIS+ T A+GGTFDVATLD T SRV++PEGTQ GKQFRLKGKGM
Sbjct: 238 PHEFFQRDGADLYCAVPISMTTAALGGTFDVATLDGTKSRVSVPEGTQVGKQFRLKGKGM 297

Query: 323 PVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           PV+ S + GDLY+Q+Q+ETPQKL KRQRELL+EF
Sbjct: 298 PVLRSSQVGDLYIQIQIETPQKLTKRQRELLQEF 331


>gi|121601759|ref|YP_989575.1| chaperone protein DnaJ [Bartonella bacilliformis KC583]
 gi|120613936|gb|ABM44537.1| chaperone protein DnaJ [Bartonella bacilliformis KC583]
          Length = 381

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 279/380 (73%), Gaps = 4/380 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y VLG+ R   D++LK+AFR LAM+YHPD+N  D EA++KF +I EAYEVL+DPQK
Sbjct: 2   KVDYYAVLGVTRECDDKKLKSAFRKLAMQYHPDRNPGDKEAEQKFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A +  ++       G         +++FE  FG +MG G  Y++ S   E
Sbjct: 62  RAAYDKFGHAAFDNNSRGGAGPFGGGFSASGGF-ADIFEDFFGEVMGGG--YRKRSDGRE 118

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAF+GKTVQI  P+ + C  C GSGAK G+ P  C IC+GSGRV  
Sbjct: 119 RGADLSYNMEVTLEEAFAGKTVQINIPSLIMCDACEGSGAKKGSKPQTCGICHGSGRV-R 177

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER CS C G G+II  PCSKCHG  RV + + L VN+P G++DGTRIRLSGE
Sbjct: 178 AAQGFFSIERTCSKCHGRGEIITDPCSKCHGTRRVEKTRSLRVNIPVGIEDGTRIRLSGE 237

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG  GG  GDLYIF+S+K H+FF+R+GADL+C VPIS+ T A+GG F+VA L+   SR
Sbjct: 238 GDAGSRGGPAGDLYIFLSIKPHEFFQREGADLHCRVPISMTTAALGGEFEVADLEGIQSR 297

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V IPEGTQ G+QFRLKGKGMP++    +GDLY+ + +ETPQKL + QRELL++F+++S+ 
Sbjct: 298 VKIPEGTQNGRQFRLKGKGMPILRQQARGDLYIHITIETPQKLTQEQRELLQQFDKLSNH 357

Query: 363 DNNPQSTGFFARMKDFFDSL 382
           +N+PQS GFF+RMK+FF+++
Sbjct: 358 ENSPQSHGFFSRMKEFFENI 377


>gi|163867368|ref|YP_001608562.1| chaperone protein DnaJ [Bartonella tribocorum CIP 105476]
 gi|161017009|emb|CAK00567.1| heat shock chaperone protein DnaJ [Bartonella tribocorum CIP
           105476]
          Length = 380

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 284/381 (74%), Gaps = 5/381 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ +F +I EAYEVL+DPQK
Sbjct: 2   KVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAGDKEAERRFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E  +  QG G   +G    S F+++FE  FG IMG   ++++     E
Sbjct: 62  RAAYDRFGHAAFE-NSGGQGGGNPFSGFASGSGFADIFEDFFGEIMGG--AHRKRGDGRE 118

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAFSGKT +I  P+++ C  C GSGA+ G+ P  C  C+GSGRV  
Sbjct: 119 RGADLSYNMEVTLEEAFSGKTAEINIPSSLTCDVCEGSGARKGSKPQVCGTCHGSGRV-R 177

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C TC G G+ I  PC KC G  R+ +++ LSVN+P G++DGTRIRLSGE
Sbjct: 178 AAQGFFSIERTCPTCHGRGETITDPCPKCQGTRRIEKKRSLSVNIPAGIEDGTRIRLSGE 237

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+R+GADL+C VPIS+VT A+GG F+V+ LD   +R
Sbjct: 238 GDAGIRGGPNGDLYIFLSVKPHEFFQREGADLHCRVPISMVTAALGGEFEVSDLDGVKAR 297

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGR-KGDLYVQVQVETPQKLNKRQRELLEEFEQISS 361
           V IPEGTQ G+QFRLKGKGMP++   + +GDLY+ + +ETPQKL + QRELL++FE++S+
Sbjct: 298 VKIPEGTQNGRQFRLKGKGMPMLRRQQARGDLYIHITIETPQKLTQEQRELLQKFEKLSN 357

Query: 362 QDNNPQSTGFFARMKDFFDSL 382
            +N+PQS GFF+RMK+FF+++
Sbjct: 358 HENSPQSHGFFSRMKEFFENI 378


>gi|49474890|ref|YP_032931.1| heat shock protein DnaJ [Bartonella henselae str. Houston-1]
 gi|62899955|sp|Q6G553|DNAJ_BARHE RecName: Full=Chaperone protein dnaJ
 gi|49237695|emb|CAF26882.1| Heat shock protein DnaJ [Bartonella henselae str. Houston-1]
          Length = 381

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/383 (56%), Positives = 281/383 (73%), Gaps = 11/383 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ KF +I EAYEVL+DPQK
Sbjct: 2   KVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAGDKEAERKFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGA--GGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           RA YD+ GH A E      G+   GF AG      F+++FE  FG IMG G  +++ S  
Sbjct: 62  RAAYDRFGHAAFENNNNGGGSPFSGFSAG-----GFADIFEDFFGEIMGGG--HRKRSDG 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADL YN+E++LEEAFSGKT QI  P++V C  C GSGAK G+ P  C  C+G+GRV
Sbjct: 115 RERGADLSYNMEVTLEEAFSGKTAQINIPSSVVCDACEGSGAKKGSKPQTCGTCHGAGRV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FFSIER C  C G G+ I  PC KC G  RV + + LSVN+P G++D TRIRLS
Sbjct: 175 -RAAQGFFSIERTCPVCHGRGETIKDPCPKCQGTRRVEKNRSLSVNIPAGIEDSTRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+SVK H+FF+R+GADL+C VPIS+VT A+GG F+V+ LD   
Sbjct: 234 GEGDAGIRGGPSGDLYIFLSVKPHEFFQREGADLHCRVPISMVTAALGGEFEVSDLDGIK 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGR-KGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
           +RV IPEGTQ G+QFRLKGKGMP++   + +GDLY+ + +ETPQKL + QRELL++FE++
Sbjct: 294 ARVKIPEGTQNGRQFRLKGKGMPMLRRQQVRGDLYIHITIETPQKLTQEQRELLQKFEKL 353

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
           S+ +N+PQS GFF+RMK+FF+++
Sbjct: 354 SNHENSPQSHGFFSRMKEFFENI 376


>gi|319403544|emb|CBI77125.1| heat shock chaperone protein DnaJ [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 375

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/382 (56%), Positives = 284/382 (74%), Gaps = 10/382 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA++KF +I EAYE+L+DPQK
Sbjct: 2   KVDYYEILGVTRGCDDKKLKSAFRKLAMQYHPDRNAGDKEAEQKFKEIVEAYEILKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E  ++ +G+  FG G      F+++FE  FG IMG G   ++ S   E
Sbjct: 62  RAAYDRFGHAAFENNSR-EGSHPFGGG------FADIFEDFFGEIMGGGN--RKRSDGRE 112

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAF+GKT QI  P+++ C  C G G K G+ P  C  C+G+GRV  
Sbjct: 113 RGADLSYNMEVTLEEAFTGKTAQINIPSSIVCDACEGLGTKKGSKPTTCGTCHGAGRV-R 171

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C  C G G+II  PC KCHG  RV E + L VN+P G++DGTRIRLSGE
Sbjct: 172 AAQGFFSIERTCPVCHGRGEIITDPCLKCHGTRRVEENRSLHVNIPAGIEDGTRIRLSGE 231

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG+ GDLYIF+S+K H+FF+RDGADL+C VPIS+VT A+GG F+V++LD   +R
Sbjct: 232 GDAGIGGGSAGDLYIFLSIKAHEFFQRDGADLHCRVPISMVTAALGGEFEVSSLDGVKAR 291

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G+QFRLKGKGMP++    KGDLY+ + +ETPQKL + QR LL+EF+++S+ 
Sbjct: 292 VKVPEGTQNGRQFRLKGKGMPMLRQQAKGDLYIHITIETPQKLTQEQRALLQEFDKLSNH 351

Query: 363 DNNPQSTGFFARMKDFFDSLKN 384
           +N+PQS GFFARMK+FFD++ N
Sbjct: 352 ENSPQSHGFFARMKEFFDNIAN 373


>gi|319898252|ref|YP_004158345.1| heat shock chaperone protein DnaJ [Bartonella clarridgeiae 73]
 gi|319402216|emb|CBI75747.1| heat shock chaperone protein DnaJ [Bartonella clarridgeiae 73]
          Length = 375

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/382 (56%), Positives = 282/382 (73%), Gaps = 10/382 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ KF +I EAYEVL+DPQK
Sbjct: 2   KVDYYEILGVTRGCDDKKLKSAFRRLAMQYHPDRNAGDKEAERKFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E   + +G+  FG G      F+++FE  FG IMGSG  +++ S   E
Sbjct: 62  RAAYDRFGHAAFENNGR-EGSSPFGGG------FADIFEDFFGEIMGSG--HRKRSDGRE 112

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAF+GKT QI  P+++ C  C G G K G+ P  C  C+G GRV  
Sbjct: 113 RGADLSYNMEVTLEEAFAGKTAQINIPSSIICDACEGLGTKKGSKPKTCGTCHGVGRV-R 171

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C  C G G+II  PC KCHG  RV E + L VN+P G++DGTRIRLSGE
Sbjct: 172 AAQGFFSIERTCPVCHGRGEIITDPCLKCHGTKRVEENRSLRVNIPAGIEDGTRIRLSGE 231

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+S+K H+FF+RDGADL+C VPIS+VT A+GG F+V++LD   +R
Sbjct: 232 GDAGIGGGPAGDLYIFLSIKAHEFFQRDGADLHCRVPISMVTAALGGEFEVSSLDGVKAR 291

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G+QFRLKGKGMP++    KGDLY+ + +ETPQKL + QR LL+EF+++S+ 
Sbjct: 292 VKVPEGTQNGRQFRLKGKGMPMLRQQAKGDLYIHITIETPQKLTQEQRTLLQEFDKLSNH 351

Query: 363 DNNPQSTGFFARMKDFFDSLKN 384
           +N+PQS GFFARMK+FFD++ N
Sbjct: 352 ENSPQSHGFFARMKEFFDNIAN 373


>gi|158422313|ref|YP_001523605.1| chaperone protein DnaJ [Azorhizobium caulinodans ORS 571]
 gi|189083293|sp|A8IPT0|DNAJ_AZOC5 RecName: Full=Chaperone protein dnaJ
 gi|158329202|dbj|BAF86687.1| chaperone protein [Azorhizobium caulinodans ORS 571]
          Length = 381

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/379 (57%), Positives = 273/379 (72%), Gaps = 6/379 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG DR A +  LK +FR LAMK+HPD+N  DPEA+ +F +ISEAYEVL+DP
Sbjct: 1   MAKRDYYEVLGCDRGADETVLKASFRKLAMKWHPDKNPGDPEAEIRFKEISEAYEVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YD+ GH A E      G  GF A     S F+++F+ +FGG MG  RS  RS+  
Sbjct: 61  QKRGAYDRYGHAAFE-NGGGPGGAGFNADF--ASTFADIFDDLFGGSMG--RSGARSAGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++I+LEEAFSGKT QI  PT++ C  CSGSGAK GT P  C  CNG+G++
Sbjct: 116 RARGADLRYNMDITLEEAFSGKTAQISIPTSISCEVCSGSGAKAGTQPKTCRTCNGAGKI 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C +C+G G +I  PC  C G GRV+ E+ L V +P GV+DGTRIRL 
Sbjct: 176 -RHAQGFFTLERTCPSCQGRGTVIEDPCPNCGGAGRVTRERTLQVQIPAGVEDGTRIRLG 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG PGDLYIF+S++ H FF+R+GADLYC  PIS+VT A+GGT +V T+    
Sbjct: 235 GEGEAGVRGGPPGDLYIFLSIEPHTFFQREGADLYCRAPISMVTAALGGTVEVPTIGGEK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V IPEGTQ+GK+ RL G GMPV+ S   GD+YVQV VETPQ L KRQ+ELL EFE +S
Sbjct: 295 TKVKIPEGTQSGKRLRLPGAGMPVLRSRSFGDMYVQVVVETPQNLTKRQKELLAEFEGLS 354

Query: 361 SQDNNPQSTGFFARMKDFF 379
           S D +P+S GFFA+MKDFF
Sbjct: 355 STDTHPESNGFFAKMKDFF 373


>gi|240849741|ref|YP_002971129.1| heat shock protein DnaJ [Bartonella grahamii as4aup]
 gi|240266864|gb|ACS50452.1| heat shock protein DnaJ [Bartonella grahamii as4aup]
          Length = 380

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/381 (55%), Positives = 281/381 (73%), Gaps = 5/381 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ KF +I EAYEVL+DPQK
Sbjct: 2   KVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAGDKEAERKFKEIGEAYEVLKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E  + SQG      G      F+++FE  FG IMG   ++++     E
Sbjct: 62  RAAYDRFGHAAFE-NSGSQGGANPFGGFAAGGGFADIFEDFFGEIMGG--AHRKRGDGRE 118

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+EI+LEE FSGKT +I  P++V C  C GSGA+ G+ P  C  C+GSGRV  
Sbjct: 119 RGADLSYNMEITLEEVFSGKTAEITIPSSVTCDVCEGSGARKGSKPQVCGTCHGSGRV-R 177

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C +C G G+ I  PC KC G  R+ +++ LSVNVP G++DGTRIRLSGE
Sbjct: 178 AAQGFFSIERTCPSCHGRGETITDPCPKCQGTRRIEKKRSLSVNVPAGIEDGTRIRLSGE 237

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+SVK H+FF+R+GADL+C VPIS+VT A+GG F+V+ LD   +R
Sbjct: 238 GDAGIRGGPNGDLYIFLSVKPHEFFQREGADLHCRVPISMVTAALGGEFEVSDLDGVKAR 297

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGR-KGDLYVQVQVETPQKLNKRQRELLEEFEQISS 361
           V IPEGTQ G+QFRLKGKGMP++   + +GDLY+ + +ETPQKL + QRELL++FE++S+
Sbjct: 298 VKIPEGTQNGRQFRLKGKGMPMLRRQQARGDLYIHITIETPQKLTQEQRELLQKFEKLSN 357

Query: 362 QDNNPQSTGFFARMKDFFDSL 382
            +N+PQS GFF+RMK+FF+++
Sbjct: 358 HENSPQSHGFFSRMKEFFENI 378


>gi|319406457|emb|CBI80097.1| heat shock chaperone protein DnaJ [Bartonella sp. 1-1C]
          Length = 375

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/382 (55%), Positives = 282/382 (73%), Gaps = 10/382 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ KF +I EAYE+L+DPQK
Sbjct: 2   KVDYYEILGVTRGCDDKKLKSAFRKLAMQYHPDRNAGDKEAERKFKEIVEAYEILKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E  ++ +G+  F  G      F+++FE  FG IMG G   ++ S   E
Sbjct: 62  RAAYDRFGHAAFENNSR-EGSHPFSGG------FADIFEDFFGEIMGGGN--RKRSDGRE 112

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAF+GKT QI  P+++ C  C G G K G+ P  C  C+G+GRV  
Sbjct: 113 RGADLSYNMEVTLEEAFTGKTAQINIPSSIVCDACEGLGTKKGSKPTTCGTCHGAGRV-R 171

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C  C G G+II  PC KCHG  RV E + L VN+P G++DGTRIRLSGE
Sbjct: 172 AAQGFFSIERTCPVCHGRGEIITDPCLKCHGTRRVEENRSLHVNIPAGIEDGTRIRLSGE 231

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG+ GDLYIF+S+K H+FF+RDGADL+C VPIS++T A+GG F+V++LD   +R
Sbjct: 232 GDAGIGGGSAGDLYIFLSIKAHEFFQRDGADLHCRVPISMITAALGGEFEVSSLDGVKAR 291

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G+QFRLKGKGMP++    KGDLY+ + +ETPQKL + QR LL+EF+++S+ 
Sbjct: 292 VKVPEGTQNGRQFRLKGKGMPMLRQQAKGDLYIHITIETPQKLTQEQRTLLQEFDKLSNH 351

Query: 363 DNNPQSTGFFARMKDFFDSLKN 384
           +N+PQS GFFARMK+FFD++ N
Sbjct: 352 ENSPQSHGFFARMKEFFDNIAN 373


>gi|319404971|emb|CBI78573.1| heat shock chaperone protein DnaJ [Bartonella sp. AR 15-3]
          Length = 375

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/382 (55%), Positives = 282/382 (73%), Gaps = 10/382 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG+ R   D++LK+AFR LAM+YHPD+N  D EA+ KF +I EAYE+L+DPQK
Sbjct: 2   KVDYYEILGVTRGCDDKKLKSAFRKLAMQYHPDRNAGDKEAERKFKEIGEAYEILKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E  ++ +G+  F  G      F+++FE  FG IMG G  +++ S   E
Sbjct: 62  RAAYDRFGHAAFENNSR-EGSNPFSGG------FADIFEDFFGEIMGGG--HRKRSDGRE 112

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADL YN+E++LEEAF+GKT QI  P++V C  C G G K G+ P  C  C+G+GRV  
Sbjct: 113 RGADLSYNMEVTLEEAFTGKTTQINIPSSVVCDACEGLGTKKGSKPTTCGTCHGAGRV-R 171

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FFSIER C  C G G+II  PC KCHG  +V E + L VN+P G++DGTRIRLSGE
Sbjct: 172 AAQGFFSIERTCPVCHGRGEIITDPCLKCHGTRKVEENRSLRVNIPAGIEDGTRIRLSGE 231

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG+ GDLYIF+S+K H+FF+RDGADL+C VPIS+VT A+GG F+V+ LD   +R
Sbjct: 232 GDAGIGGGSAGDLYIFLSIKAHEFFQRDGADLHCRVPISMVTAALGGEFEVSGLDGIKAR 291

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +PEGTQ G+QFRLKGKGMP++    KGDLY+ + +ETPQKL + QR LL+EF+++S+ 
Sbjct: 292 VKVPEGTQNGRQFRLKGKGMPMLRQQAKGDLYIHITIETPQKLTQEQRTLLQEFDKLSNH 351

Query: 363 DNNPQSTGFFARMKDFFDSLKN 384
           +N+PQS GFFARMK+FFD++ N
Sbjct: 352 ENSPQSHGFFARMKEFFDNIAN 373


>gi|307942723|ref|ZP_07658068.1| chaperone protein DnaJ [Roseibium sp. TrichSKD4]
 gi|307773519|gb|EFO32735.1| chaperone protein DnaJ [Roseibium sp. TrichSKD4]
          Length = 374

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/382 (56%), Positives = 275/382 (71%), Gaps = 8/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY VLG+ R+A ++ LK+A+R  AMKYHPD+N +D EA+ KF + +EAY+ L+DP
Sbjct: 1   MAKRDFYDVLGVARDADEKALKSAYRKQAMKYHPDRNPDDAEAEAKFKEANEAYDTLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G         G  DF      IF    G G    R S  
Sbjct: 61  QKRAAYDRFGHAAFESGGFGGGG-------TGAHDFGSTMSDIFEEFFGMGGGGGRRSGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYNL+++LEEAF+GKTV+I  PT+V C TCSGSGAKPGT+P  C  C G+GRV
Sbjct: 114 RERGADLRYNLDVTLEEAFNGKTVEIEVPTSVTCDTCSGSGAKPGTSPTTCRTCGGAGRV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C TC+G GQ+I  PC+ C G GR ++E+ LSVN+P G++DGTRIR++
Sbjct: 174 RA-AQGFFTLERTCPTCQGRGQVISDPCTSCSGTGRKTQERTLSVNIPAGIEDGTRIRIA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG  GDLYIF+S++ H+ F+RDGADLYC VPIS+ T A+GG FDV T+D   
Sbjct: 233 GEGEAGVRGGPSGDLYIFVSIRPHELFQRDGADLYCRVPISLTTAALGGQFDVPTVDGKT 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV +PEGTQTGKQFRL+ KGMP++ S + GD+Y+QV VETP  L +RQRELL EFE+ S
Sbjct: 293 SRVKVPEGTQTGKQFRLRSKGMPIMRSTQMGDMYIQVTVETPTNLTRRQRELLAEFEKES 352

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S + +P+S GFF+++KDF D+L
Sbjct: 353 SGETHPESAGFFSKVKDFIDNL 374


>gi|300024886|ref|YP_003757497.1| chaperone protein DnaJ [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526707|gb|ADJ25176.1| chaperone protein DnaJ [Hyphomicrobium denitrificans ATCC 51888]
          Length = 386

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/384 (54%), Positives = 284/384 (73%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R AT++++K+A+RSLA ++HPD+N  D EA+ +F +++EAYE L+DP
Sbjct: 1   MAKRDYYEVLGVKRGATEQEVKSAYRSLAKEFHPDRNAGDKEAERRFKEVNEAYEALKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G   +G  G     + +S  S++F+ +FG  MG  R+       
Sbjct: 61  QKRAAYDQFGHAAFEGGMGGRGGPGGFGPDFASS-MSDIFDDLFGEFMGGRRAGGGQGRG 119

Query: 121 GEAG----ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
           G +G    ADLRYNLEI+L EAF GKT QIR P +VKC TCSGSGAKPGT P  C  C G
Sbjct: 120 GRSGREAGADLRYNLEITLSEAFGGKTAQIRVPASVKCETCSGSGAKPGTKPRTCTTCGG 179

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
            G+V  + Q FF+IER+C  C+G G+ I  PC+ C G GRV +E+ LSVN+P GV+DGTR
Sbjct: 180 MGKVRAS-QGFFTIERSCPACQGRGETIDDPCADCGGAGRVQKERTLSVNIPAGVEDGTR 238

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRL+GEG AG+ GG PGDLYIF+S+K H+FF+RDGAD++C VPI++ T A+GG  +V TL
Sbjct: 239 IRLAGEGEAGLRGGTPGDLYIFLSIKPHEFFQRDGADIFCKVPIAMTTAALGGQIEVPTL 298

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           + T +RV IPEGT++ KQFRL+GKGMPV+ +   GD+Y++V VETP+ L +RQRELLEEF
Sbjct: 299 EGTTTRVKIPEGTESRKQFRLRGKGMPVLRAKVTGDMYIEVDVETPKNLTRRQRELLEEF 358

Query: 357 EQISSQDNNPQSTGFFARMKDFFD 380
           E+ S ++ +P+S GFF+R+K+FF+
Sbjct: 359 ERASHKETSPESAGFFSRVKEFFE 382


>gi|154244309|ref|YP_001415267.1| chaperone protein DnaJ [Xanthobacter autotrophicus Py2]
 gi|226735616|sp|A7IC67|DNAJ_XANP2 RecName: Full=Chaperone protein dnaJ
 gi|154158394|gb|ABS65610.1| chaperone protein DnaJ [Xanthobacter autotrophicus Py2]
          Length = 379

 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/381 (55%), Positives = 274/381 (71%), Gaps = 12/381 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG DR A D  LK ++R LAMK+HPD+++ + EA+  F +++EAYEVL+DP
Sbjct: 1   MAKRDYYETLGCDRGADDTVLKASYRKLAMKWHPDRSQGNGEAEVMFKEVNEAYEVLKDP 60

Query: 61  QKRALYDQGGHEALE--YGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           QKRA YD+ GH A E   G        F       S F+++F+ +FGG M      +   
Sbjct: 61  QKRAAYDRFGHAAFENGGGGGPGFGNDFA------SSFADIFDDLFGGAM---NRGRGGG 111

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYN+EI+LEEAFSGKT QI+ PT+V C TCSG+GAKPGT P  C +C G+G
Sbjct: 112 QQRGRGADLRYNMEITLEEAFSGKTAQIKIPTSVSCETCSGTGAKPGTQPKACRMCGGAG 171

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           ++   AQ FF++ER C  C+G G +I  PCS C G GRV+ E+ LSV +P GV+DGTRIR
Sbjct: 172 KI-RHAQGFFTLERTCPNCQGRGSVIEDPCSDCGGAGRVTRERNLSVQIPAGVEDGTRIR 230

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L GEG AGV GGA GDLYIF+S++ H FF+R+GADLYC VPIS+VT A+GGT +V T+D 
Sbjct: 231 LGGEGEAGVRGGAAGDLYIFLSIEPHTFFQREGADLYCRVPISMVTAALGGTVEVPTIDG 290

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             S+V IPEGTQ+ K+FRL GKGMP++ +   GD+YVQV VETPQKL KRQ+ELL EFE+
Sbjct: 291 DKSKVKIPEGTQSQKRFRLSGKGMPIMRARNHGDMYVQVVVETPQKLTKRQKELLAEFEK 350

Query: 359 ISSQDNNPQSTGFFARMKDFF 379
            SS + +P+STGFFA++K+FF
Sbjct: 351 DSSGETHPESTGFFAKVKEFF 371


>gi|154254004|ref|YP_001414828.1| chaperone protein DnaJ [Parvibaculum lavamentivorans DS-1]
 gi|189083344|sp|A7HZ38|DNAJ_PARL1 RecName: Full=Chaperone protein dnaJ
 gi|154157954|gb|ABS65171.1| chaperone protein DnaJ [Parvibaculum lavamentivorans DS-1]
          Length = 385

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/386 (54%), Positives = 272/386 (70%), Gaps = 3/386 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY VLG+ RNA+  +LK A+RSLA KYHPDQN+ D EA+++F +++EAY+ L+D 
Sbjct: 1   MSKRDFYDVLGVSRNASADELKKAYRSLAKKYHPDQNQGDKEAEQRFKELNEAYDALKDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           Q RA YDQ GH A + G  ++G  G   G    +  S++F+ +FG  MG           
Sbjct: 61  QSRAAYDQFGHAAFDGGMGARGGPGGMGGFGAGASMSDIFDDLFGEFMGGRGGRGGRRGD 120

Query: 121 GEAGA--DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           G      DLRYN+EISLEEAF GK  Q+R P +V C  C+G+GA PG++P+ C  C G G
Sbjct: 121 GGQTRGHDLRYNMEISLEEAFEGKKAQVRVPGSVACEVCTGTGAAPGSSPITCPTCQGHG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V  + Q FF+IER C TC G GQ I  PC+ CHG GRV +E+ LSVN+P GV+DGTRIR
Sbjct: 181 KVRAS-QGFFTIERTCPTCHGRGQTIDKPCTNCHGAGRVEKERTLSVNIPAGVEDGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG+ GG  GDLYIF+SVK H+ F+RDGADL+C VPI++VT  +GG  +V TL  
Sbjct: 240 LSGEGEAGMRGGPAGDLYIFLSVKPHRLFERDGADLFCRVPIAMVTATLGGEIEVPTLGG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              +V +PEG QTG+QFRL+GKGMPV+NS   GDLY+Q+ VETP  L K+Q+ELL+EFEQ
Sbjct: 300 KKVKVKVPEGAQTGRQFRLRGKGMPVVNSRETGDLYIQITVETPVNLTKKQKELLKEFEQ 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLKN 384
            S+  NNP+S GFFA++K+F+D  +N
Sbjct: 360 ASTPGNNPESAGFFAKVKEFWDGFQN 385


>gi|304392426|ref|ZP_07374367.1| chaperone protein DnaJ [Ahrensia sp. R2A130]
 gi|303295530|gb|EFL89889.1| chaperone protein DnaJ [Ahrensia sp. R2A130]
          Length = 376

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/382 (54%), Positives = 266/382 (69%), Gaps = 8/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KAD+Y  LG+ R A +++LK+AFR +AMKYHPD+N +D  A+ KF ++ EAYE L+DP
Sbjct: 1   MSKADYYDTLGVARGADEKELKSAFRKMAMKYHPDRNPDDASAEAKFKEVGEAYEALKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G           G  G     ++FE IFG +M            
Sbjct: 61  QKRAAYDRFGHAAFENGGGGGSP----FGGGGAGGMGDIFEDIFGEMM---GGRGGGGGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+EISLEEAF GKT +I  PT++ C TC GSGAKPGT+P  C  C G G+V
Sbjct: 114 RQRGADLRYNMEISLEEAFEGKTAEIEIPTSITCDTCDGSGAKPGTSPTTCGTCGGVGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             + Q FFSI+R C  C+G G++I   C  C G GR ++ K LSVNVP G++DGTRIRL+
Sbjct: 174 RAS-QGFFSIQRTCPACQGRGEVIKDACDDCGGSGRKTQTKTLSVNVPAGIEDGTRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AGV GG  GDLYIF+S++ H+FF+RDGAD+YC VPIS+ T A+GG F+V T++   
Sbjct: 233 SEGEAGVRGGPQGDLYIFLSIEPHEFFQRDGADIYCRVPISMTTAALGGQFEVGTVEGKK 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           + V +PEGTQ GKQFRL+GKGMPV+ S ++GD+Y+QV +ETP  L KRQRELL EFE  S
Sbjct: 293 ANVKVPEGTQNGKQFRLRGKGMPVMRSSQQGDMYIQVAIETPSNLTKRQRELLTEFESES 352

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S DN+P+ST FF RMK FFD L
Sbjct: 353 SADNSPESTSFFGRMKGFFDGL 374


>gi|218671739|ref|ZP_03521408.1| molecular chaperone protein DnaJ [Rhizobium etli GR56]
          Length = 373

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 224/389 (57%), Positives = 281/389 (72%), Gaps = 24/389 (6%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KADFY+ LG+ ++A +++LK+AFR LAMKYHPD+N +D +A+ KF +I+EAYE+L+DP
Sbjct: 1   MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAERKFKEINEAYEMLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G G      +    FS++FE IFG +MG GR+ +RSS  
Sbjct: 61  QKRAAYDRYGHAAFEHGGMGGGGG-----GFAGGGFSDIFEDIFGEMMGGGRARQRSSGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSG-AKPGTNPMDCNICNGSGR 179
            E GADLRYN+EI+LEEAFSGKT QIR PT++  ++  G   ++  T   +   C   G 
Sbjct: 116 RERGADLRYNMEITLEEAFSGKTAQIRVPTSITATSVRGRAPSRHATE--ELRHCRERGA 173

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHP-------CSKCHGQGRVSEEKLLSVNVPPGVD 232
                       R     R     +P P       C KCHGQGRV+EE+ LSVN+P G++
Sbjct: 174 C---------APRRALLYRADLPDLPRPRPDHSRSCQKCHGQGRVTEERSLSVNIPAGIE 224

Query: 233 DGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFD 292
           DGTRIRL GEG AG  GG  GDLYIF+SVK H+F++RDGADLYC VPIS+ T A+GGTFD
Sbjct: 225 DGTRIRLQGEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAALGGTFD 284

Query: 293 VATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQREL 352
           VATLD T SRVT+PEGTQ GKQFRLK KGMPV+ S + GDLY+Q+Q+ETPQKL KRQREL
Sbjct: 285 VATLDGTKSRVTVPEGTQAGKQFRLKSKGMPVLRSAQTGDLYIQIQIETPQKLTKRQREL 344

Query: 353 LEEFEQISSQDNNPQSTGFFARMKDFFDS 381
           L+EFEQISS++NNP+STGFFARMK+FF+S
Sbjct: 345 LQEFEQISSKENNPESTGFFARMKEFFES 373


>gi|118590476|ref|ZP_01547878.1| chaperone protein DnaJ [Stappia aggregata IAM 12614]
 gi|118436939|gb|EAV43578.1| chaperone protein DnaJ [Stappia aggregata IAM 12614]
          Length = 376

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/382 (55%), Positives = 275/382 (71%), Gaps = 8/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A ++ LK+A+R +AM++HPD+N  D  A+ KF +++EAY+ L+D 
Sbjct: 1   MSKRDFYEVLGVSRDADEKALKSAYRKMAMQFHPDRNPGDEAAEAKFKEVNEAYDTLKDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G         G  DFS     IF    G G    R S  
Sbjct: 61  QKRAAYDRFGHAAFENGGFGGGG-------AGAHDFSSTMSDIFEEFFGMGGGGGRRSGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYNL+I+LE+AF+GKTV+I  PT+V C  CSGSGAKPGT+P  C  C G+GRV
Sbjct: 114 RERGADLRYNLDITLEDAFTGKTVEIEVPTSVTCDDCSGSGAKPGTSPTTCRTCGGAGRV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C +C+G GQ+I  PC  C G GR ++E+ LSVN+P G++DGTRIRL+
Sbjct: 174 RA-AQGFFTLERTCPSCQGRGQVITDPCEGCGGSGRKTQERTLSVNIPAGIEDGTRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG  GDLYIF+S++ H+ F+RDGADLYC VPIS+ T  +GG FDV T++   
Sbjct: 233 GEGEAGVRGGPAGDLYIFLSIRPHELFQRDGADLYCRVPISMSTATLGGQFDVPTVEGAT 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV +PEGTQTGKQFRL+GKGMP++ S + GD+Y+QV VETP  L +RQRELL EFE+ S
Sbjct: 293 SRVKVPEGTQTGKQFRLRGKGMPIMRSSQHGDMYIQVTVETPTNLTRRQRELLAEFEKES 352

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S +N+P+S GFF+++KDF D+L
Sbjct: 353 SGENHPESAGFFSKVKDFIDNL 374


>gi|299133266|ref|ZP_07026461.1| chaperone protein DnaJ [Afipia sp. 1NLS2]
 gi|298593403|gb|EFI53603.1| chaperone protein DnaJ [Afipia sp. 1NLS2]
          Length = 376

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/379 (56%), Positives = 268/379 (70%), Gaps = 10/379 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K  +Y+ L +DR   +  LKTAFR LAMK+HPD+N  DP  + KF +ISEAYE+L+D 
Sbjct: 1   MAKTCYYETLEVDRTVDEAGLKTAFRKLAMKWHPDKNPGDPACEHKFKEISEAYEILKDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E   Q  G GG G G    S FS++FE +FG       + +     
Sbjct: 61  QKRAAYDRYGHAAFE---QGMGGGGHGFGAGFASSFSDIFEDLFG------MAGRGRGGG 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAF GKT QI  P AV C  CSGSGAKPGT P  C  C G+GRV
Sbjct: 112 RERGADLRYNMEITLEEAFLGKTAQINIPVAVACEACSGSGAKPGTKPKVCATCGGAGRV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C +C G GQ I  PC  C GQGRV +++ LSVN+P GV+DGTRIRLS
Sbjct: 172 -RQAQGFFTLERTCPSCHGRGQSIDTPCPSCSGQGRVQKDRSLSVNIPAGVEDGTRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG  GDLYIF+SV  HQ F+RDGADL+C VPIS+VT A+GG F+V  +D+T 
Sbjct: 231 GEGEAGVQGGPAGDLYIFLSVGSHQLFQRDGADLHCRVPISMVTAAIGGEFEVPAIDSTK 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +RV +P GTQ+G++FR+ GKGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++S
Sbjct: 291 ARVKVPSGTQSGRRFRIAGKGMPVLRSRQTGDMYVQVVVETPQNLTKKQKELLAEFEKLS 350

Query: 361 SQDNNPQSTGFFARMKDFF 379
           S +  P++ GFF  +KDFF
Sbjct: 351 SGETQPEAAGFFKMVKDFF 369


>gi|298293976|ref|YP_003695915.1| chaperone protein DnaJ [Starkeya novella DSM 506]
 gi|296930487|gb|ADH91296.1| chaperone protein DnaJ [Starkeya novella DSM 506]
          Length = 381

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 274/379 (72%), Gaps = 3/379 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++L + ++  D +LK+++R LAMK+HPD+N  + +A+ +F ++SEAYEVL+DP
Sbjct: 1   MSKRDYYEILEVTKSCEDGELKSSYRKLAMKWHPDRNPGNADAEVRFKEVSEAYEVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A + G    G  GFGA     S FS++F+ +FG   G           
Sbjct: 61  QKRAAYDRFGHAAFDGGMGGPGGPGFGADF--ASTFSDIFDDLFGMGGGRRGGGGGGRGG 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYN+EI+LEEAFSGK   IR PT++ C  C+G+GAKPGT P  C  C+GSGR+
Sbjct: 119 RERGADLRYNMEITLEEAFSGKDATIRLPTSITCEACTGTGAKPGTQPTTCRTCSGSGRI 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C TC+G GQ+I  PC  C G GR ++E+ L V +P GV+DGTRIRL 
Sbjct: 179 RQ-AQGFFTLERTCPTCQGRGQVIEDPCPACAGAGRTTKERTLQVAIPAGVEDGTRIRLG 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AGV GG PGDLYIF+S+  H FF+RDGADL+C  PIS+VT ++GG+F+V T+D   
Sbjct: 238 NEGEAGVRGGPPGDLYIFLSLAPHDFFQRDGADLFCRAPISMVTASLGGSFEVPTIDGET 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V +PEGTQ+GK+FRL GKGMPV+ +  +GD+YVQV VETPQ L +RQRELL EFE   
Sbjct: 298 TKVKVPEGTQSGKRFRLGGKGMPVLRTRNRGDMYVQVVVETPQNLTRRQRELLAEFETEC 357

Query: 361 SQDNNPQSTGFFARMKDFF 379
           S+D +P+++GFFA++KDFF
Sbjct: 358 SKDTHPEASGFFAKVKDFF 376


>gi|148251810|ref|YP_001236395.1| chaperone protein DnaJ [Bradyrhizobium sp. BTAi1]
 gi|146403983|gb|ABQ32489.1| Chaperone protein dnaJ, heat shock protein (Hsp40), co-chaperone
           with dnaK [Bradyrhizobium sp. BTAi1]
          Length = 375

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/374 (55%), Positives = 270/374 (72%), Gaps = 10/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++R+A + +LK AFR LAMK+HPD+N  D  ++ KF +I+EAYEVLRD  KRA 
Sbjct: 7   YYETLEVERDADETKLKAAFRKLAMKWHPDKNPGDASSEVKFKEINEAYEVLRDADKRAA 66

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E GA   G  GFGAG    S FS++FE +FG         +R  +  E GA
Sbjct: 67  YDRYGHAAFEQGAG--GPHGFGAGF--ASSFSDIFEDLFGMA-----GQRRGGTGRERGA 117

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LEEAF GKT QI  P +V C +CSG+GAK GT P  C +C G+GRV   AQ
Sbjct: 118 DLRYNMEITLEEAFQGKTAQIEIPVSVTCESCSGTGAKAGTKPKTCAMCGGAGRV-RQAQ 176

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C G GQ+I  PC  C G GRV+ ++ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 177 GFFTLERTCPGCHGRGQMIEDPCPSCSGSGRVTRDRTLSVNIPQGVEDGTRIRLAGEGEA 236

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+ +H+FF+RDGADL+C VPIS+VT A+GG F+V T+D   ++V I
Sbjct: 237 GLRGGPPGDLYIFLSLSQHEFFQRDGADLHCRVPISMVTAALGGEFEVPTIDKGKTKVKI 296

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P G Q+G++FR+  KGMPV+ S + GD+YVQ+ VETPQ L K+Q+ELL EFE++SS    
Sbjct: 297 PAGAQSGRRFRIASKGMPVLRSRQTGDMYVQIVVETPQNLTKKQQELLAEFEKLSSGATQ 356

Query: 366 PQSTGFFARMKDFF 379
           P++ GFF ++KDFF
Sbjct: 357 PEAAGFFTKVKDFF 370


>gi|312115042|ref|YP_004012638.1| chaperone protein DnaJ [Rhodomicrobium vannielii ATCC 17100]
 gi|311220171|gb|ADP71539.1| chaperone protein DnaJ [Rhodomicrobium vannielii ATCC 17100]
          Length = 378

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 274/378 (72%), Gaps = 6/378 (1%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+VLG+ + A D ++K+AFR LA + HPD+N     A+ +F +++EAYE L+DPQK
Sbjct: 2   KRDYYEVLGLKKGAADHEIKSAFRKLAKECHPDRNPGSATAEIQFKEVNEAYEALKDPQK 61

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YDQ GH A E GA + G  GFG+    ++  SE+F+ +FG  MG  R+  RS+   E
Sbjct: 62  RAAYDQFGHAAFE-GAGANGGYGFGSDF--SASMSEIFDDLFGEFMGGRRTRGRSAK--E 116

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            G+DL+YN+EISL EAF GKT QIR P +V C  C G+GA+ G++P+ C  C G G+V  
Sbjct: 117 RGSDLKYNMEISLAEAFYGKTAQIRVPASVTCEACGGAGAESGSSPVTCPTCQGFGKVRA 176

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
           + Q FF+IER C TC+G G+II  PC+ C G GRV+ E+ LSVN+P GV+D TRIRL+GE
Sbjct: 177 S-QGFFTIERTCMTCQGRGEIIQKPCTVCSGSGRVTRERTLSVNIPSGVEDSTRIRLAGE 235

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG+ GG  GDLYIF+S+     F+RDGADL+C VPI++VT A+GG  +V T+D   +R
Sbjct: 236 GEAGIRGGPAGDLYIFLSIMPDDIFQRDGADLFCRVPITMVTAALGGQVEVPTIDGGRAR 295

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V IPEGT+TGKQFRL+GKGMPV+ S   GDLYVQV+VETPQ L+++Q+ELL+EFE+ S+ 
Sbjct: 296 VKIPEGTETGKQFRLRGKGMPVLRSKLTGDLYVQVEVETPQNLSRKQKELLKEFEKASND 355

Query: 363 DNNPQSTGFFARMKDFFD 380
             +P + GF +++K F+D
Sbjct: 356 TTHPDTIGFLSKIKAFWD 373


>gi|316931686|ref|YP_004106668.1| chaperone protein DnaJ [Rhodopseudomonas palustris DX-1]
 gi|315599400|gb|ADU41935.1| chaperone protein DnaJ [Rhodopseudomonas palustris DX-1]
          Length = 379

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/376 (55%), Positives = 270/376 (71%), Gaps = 9/376 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++RNA D  LK+AFR LAMK+HPD+N  DP+ + KF +I+EAYEVL+D  KRA 
Sbjct: 8   YYETLEVERNADDSTLKSAFRKLAMKWHPDRNPGDPQCEIKFKEINEAYEVLKDGDKRAA 67

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E   Q    GG G G    S FS++FE +FG       S +   +  E GA
Sbjct: 68  YDRYGHAAFE---QGGFGGGAGFGTGFASSFSDIFEDLFGMA-----SQRGRGTGRERGA 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LE+AF GKT QI  P +V C  CSG+GAK GT P  C+ C G+GRV   AQ
Sbjct: 120 DLRYNMEITLEDAFKGKTAQIEIPVSVTCEACSGTGAKAGTKPKTCSTCGGAGRVRQ-AQ 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C +C+G GQ I  PC  C G GRV+ E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPSCQGRGQTIEDPCPSCTGSGRVTRERTLSVNIPQGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+  H  F+RDGADL+C VPIS+VT A+GG F+V T+D   ++V +
Sbjct: 239 GLRGGPPGDLYIFLSLANHAIFQRDGADLHCRVPISMVTAALGGEFEVPTIDRGKTKVKV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQTG++FR+ GKGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS +  
Sbjct: 299 PSGTQTGRRFRIGGKGMPVLRSRQVGDMYVQVVVETPQNLTKKQQELLAEFEKLSSGETQ 358

Query: 366 PQSTGFFARMKDFFDS 381
           P++ GFF+++K+FF S
Sbjct: 359 PEAVGFFSKVKEFFGS 374


>gi|209966126|ref|YP_002299041.1| chaperone protein DnaJ [Rhodospirillum centenum SW]
 gi|226735594|sp|B6IVA5|DNAJ_RHOCS RecName: Full=Chaperone protein dnaJ
 gi|209959592|gb|ACJ00229.1| chaperone protein DnaJ, putative [Rhodospirillum centenum SW]
          Length = 379

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 272/384 (70%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+   LK A+R LAM+YHPD+N+ D  A++KF +ISEAY+VL+D 
Sbjct: 1   MSKRDYYEVLGVQKGASADDLKKAYRKLAMQYHPDRNQGDKAAEQKFKEISEAYDVLKDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    GAG  G      S F+++F+ +FG  MG GR+      T
Sbjct: 61  QKRAAYDRFGHAAFENGRGGPGAGAAGFDFNFGSGFADIFDEMFGEFMGRGRA----GQT 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEI+LE+AF G T  +R PT+V C +C+G+GA+ G+ P+ C  CNG G+V
Sbjct: 117 SNRGADLRYNLEITLEDAFKGATTTVRVPTSVACESCNGTGAEGGSTPIACPTCNGHGKV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C  C G G++I  PC  C GQGRV +EK LSVN+P GV+DGTRIRL+
Sbjct: 177 RAQ-QGFFTIERTCPACHGVGRVIKDPCRTCGGQGRVRKEKTLSVNIPAGVEDGTRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG PGDLYIF+++  H+FF+RDGA+L C VPI + T A+GG+ +V T+D + 
Sbjct: 236 GEGEAGLRGGPPGDLYIFLAIAPHRFFQRDGANLQCRVPIPMTTAALGGSVEVPTIDGSR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP GTQTG QFRLKGKGM V+ S  +GDLY+QV VETP  L K+Q+ELL EFE+  
Sbjct: 296 AKIAIPAGTQTGHQFRLKGKGMSVLRSPARGDLYIQVVVETPVNLTKKQQELLREFEKAG 355

Query: 361 SQDNNPQSTGFFARMKDFFDSLKN 384
               +P+S GFFA++K+ +  LK+
Sbjct: 356 QDGLHPESEGFFAKVKELWADLKD 379


>gi|182677130|ref|YP_001831276.1| chaperone protein DnaJ [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|254777939|sp|B2IBR5|DNAJ_BEII9 RecName: Full=Chaperone protein dnaJ
 gi|182633013|gb|ACB93787.1| chaperone protein DnaJ [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 372

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 262/383 (68%), Gaps = 15/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ +  T+ ++K AFR  AM++HPD+N  + EA+ +F +I+EAY+ L D 
Sbjct: 1   MAKRDFYEVLGVTKTCTEAEMKVAFRKAAMQWHPDRNPGNEEAEIQFKEINEAYQTLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E+G    G  GF + M      +++F+ +FG +MG     +R    
Sbjct: 61  QKRAAYDRYGHAAFEHGGG--GNDGFASSM------ADIFDDLFGDVMG-----RRGGRN 107

Query: 121 GEA-GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           G A G+DLRYN+EI+LEEAF GK   +  PT++ C  C G+GAK G  P  C  C G GR
Sbjct: 108 GPARGSDLRYNMEITLEEAFQGKLASLTLPTSITCEACDGTGAKAGAKPRICPTCGGQGR 167

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF+IER C  C G G+II  PC  C G GRV+ E+ LSVN+PPGV+DGTRIRL
Sbjct: 168 VRAQ-QGFFAIERTCPQCHGRGEIIDDPCQACGGAGRVTRERTLSVNIPPGVEDGTRIRL 226

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG  GG  GDLYIF+S K H FF+RDGADL+C VPIS+   A+GG   V T+D  
Sbjct: 227 AGEGEAGTRGGPAGDLYIFVSTKPHPFFQRDGADLFCRVPISMTQAALGGEVTVHTIDGK 286

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            ++V I EGTQ+GKQF+LK KGMPV+ S   GDLY+Q  VETPQ L KRQRELL EF+  
Sbjct: 287 EAKVKISEGTQSGKQFKLKNKGMPVLRSREVGDLYIQATVETPQNLTKRQRELLAEFDAE 346

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
           SS   +P+++GFFARMKDFF++L
Sbjct: 347 SSNKTHPEASGFFARMKDFFENL 369


>gi|209883572|ref|YP_002287429.1| chaperone protein DnaJ [Oligotropha carboxidovorans OM5]
 gi|209871768|gb|ACI91564.1| chaperone protein DnaJ [Oligotropha carboxidovorans OM5]
          Length = 377

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 262/377 (69%), Gaps = 10/377 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K  +Y+ L + R   +  LK+AFR LAMK+HPD+N  +P  + KF +ISEAYEVL+D QK
Sbjct: 4   KTCYYETLEVSREVDEAGLKSAFRKLAMKWHPDKNPGNPACEHKFKEISEAYEVLKDSQK 63

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A E   Q    GG G G    S FS++FEGIFG       + +      E
Sbjct: 64  RAAYDRFGHAAFE---QGGMGGGPGFGADFGSAFSDIFEGIFG------MAGRGRGGGRE 114

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EI+LEEAF GKT QI  P AV C  CSG+GAKPGT P  C  C G+GRV  
Sbjct: 115 RGADLRYNMEITLEEAFHGKTAQINIPVAVACEACSGTGAKPGTKPKVCATCGGAGRV-R 173

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
            AQ FF++ER C +C G GQ I  PC  C GQGRV +E+ LSVN+P GV+DGTRIRL GE
Sbjct: 174 QAQGFFTLERTCPSCHGRGQSIDTPCPACSGQGRVQKERSLSVNIPAGVEDGTRIRLGGE 233

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AGV GG  GDLYIF+SV  H  F+RDGADL+C VPIS+VT A+GG F+V  +D   SR
Sbjct: 234 GEAGVQGGPSGDLYIFLSVGSHPLFQRDGADLHCRVPISMVTAAIGGEFEVPVIDGGKSR 293

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V +P GTQ+G++FR+ GKGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS 
Sbjct: 294 VKVPSGTQSGRRFRIAGKGMPVLRSRQTGDMYVQVVVETPQNLTKKQKELLAEFEKLSSG 353

Query: 363 DNNPQSTGFFARMKDFF 379
           +  P++ GFF  +KDFF
Sbjct: 354 ETQPEAAGFFKAVKDFF 370


>gi|296446332|ref|ZP_06888277.1| chaperone protein DnaJ [Methylosinus trichosporium OB3b]
 gi|296256105|gb|EFH03187.1| chaperone protein DnaJ [Methylosinus trichosporium OB3b]
          Length = 372

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/379 (54%), Positives = 264/379 (69%), Gaps = 9/379 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG+ + +TD +LK AFR  AM+YHPD+N  D EA+ +F +I+EAY+ L D 
Sbjct: 1   MSKRDFYEILGVAKTSTDVELKIAFRKAAMQYHPDRNPGDAEAEARFKEINEAYQCLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G       GF A M      +++F+ +FG +MG         S 
Sbjct: 61  QKRAAYDRFGHAAFEQGGGFGAGDGFAASM------ADIFDDLFGEVMGR--RSGGRGSG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E G+DLRYN+EI+LEEAF GK   ++ PT++ C+ C G+GAK G+ P  C  C G GRV
Sbjct: 113 RERGSDLRYNMEITLEEAFHGKAATLKLPTSISCTACEGTGAKKGSKPKTCPTCAGHGRV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C TC+G G+II +PCS C G GR + E+ LSVNVP GV+DGTRIRL+
Sbjct: 173 RAQ-QGFFAIERTCPTCQGRGEIIDNPCSVCSGTGRTTIERTLSVNVPAGVEDGTRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG PGDLYIF+SVK H FF+RDGADLYC VPIS+V  A+GG   V T+D   
Sbjct: 232 GEGEAGMRGGPPGDLYIFLSVKPHSFFQRDGADLYCRVPISMVRAALGGKITVHTIDGGE 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           + + IPEG QTGKQ ++K KGMPV+     GDLYVQ+ VETPQ LNKRQRELL EFE+ S
Sbjct: 292 TDIKIPEGAQTGKQIKVKAKGMPVLRGRESGDLYVQISVETPQSLNKRQRELLTEFEEES 351

Query: 361 SQDNNPQSTGFFARMKDFF 379
           S   +P++TGFFA+MK+ F
Sbjct: 352 SHHTHPEATGFFAKMKELF 370


>gi|170744316|ref|YP_001772971.1| chaperone protein DnaJ [Methylobacterium sp. 4-46]
 gi|254777970|sp|B0U833|DNAJ_METS4 RecName: Full=Chaperone protein dnaJ
 gi|168198590|gb|ACA20537.1| chaperone protein DnaJ [Methylobacterium sp. 4-46]
          Length = 387

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 269/387 (69%), Gaps = 11/387 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A + +LK+AFR LAM YHPD+N  D EA+ KF +++EAY+ L D 
Sbjct: 1   MSKRDYYEVLGVAKTAGEAELKSAFRKLAMAYHPDRNPGDKEAEIKFKEVNEAYQTLSDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF-SELFEGIFG---GIMGSGRSYKR 116
           QKRA YD+ GH A      SQG  G         DF S++F+  FG         R    
Sbjct: 61  QKRAAYDRFGHAAF-----SQGGPGGPGFGADFGDFMSDIFDTFFGDARAGGAGPRGGGG 115

Query: 117 SSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
            +   E GADLRYNLEISLEEAF+GKT  IR PT+V C  C+GSGAK G+ P  C  C G
Sbjct: 116 RAGGRERGADLRYNLEISLEEAFTGKTETIRLPTSVTCEVCAGSGAKAGSKPRVCPTCGG 175

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
            GRV   AQ FF+IER C  C+G G+II  PC+ C G GRV+ E+ LSVNVP GVDDG R
Sbjct: 176 YGRV-RAAQGFFAIERTCPNCQGRGEIIDDPCAACGGAGRVTRERTLSVNVPAGVDDGLR 234

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRL+GEG +G+ GG  GDLYIF+S+K H FF+RDGADL+C VPIS+VT A+ G   V  +
Sbjct: 235 IRLAGEGESGLRGGPAGDLYIFLSIKPHPFFQRDGADLFCRVPISMVTAALSGEITVPVI 294

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           D +H+ V +P GTQT KQFRLKGKGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF
Sbjct: 295 DGSHTTVRVPGGTQTNKQFRLKGKGMPVLRSRDVGDLYIQVFVETPQNLTKRQRELLQEF 354

Query: 357 EQISSQ-DNNPQSTGFFARMKDFFDSL 382
           +Q+ SQ DN+P+S GFF+R+K+FFD L
Sbjct: 355 DQLGSQADNHPESAGFFSRVKEFFDGL 381


>gi|220926676|ref|YP_002501978.1| chaperone protein DnaJ [Methylobacterium nodulans ORS 2060]
 gi|254777967|sp|B8IHL2|DNAJ_METNO RecName: Full=Chaperone protein dnaJ
 gi|219951283|gb|ACL61675.1| chaperone protein DnaJ [Methylobacterium nodulans ORS 2060]
          Length = 388

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 269/386 (69%), Gaps = 8/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A + +LK+AFR LAM YHPD+N  D EA+ KF +++EAY+ L D 
Sbjct: 1   MSKRDYYEVLGVARTAGEGELKSAFRKLAMAYHPDRNPGDKEAEIKFKEVNEAYQTLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF-SELFEGIFG--GIMGSGRSYKRS 117
           QKRA YD+ GH A    +Q  G  G         DF S++F+  FG     G+  +    
Sbjct: 61  QKRAAYDRFGHAAF---SQGAGGPGGPGFGADFGDFMSDIFDTFFGDARAGGAAGARGGR 117

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           +   E GADLRYNLEI+LEEAF+GKT  IR PT+V C  C+GSGAK G+ P  C  C G 
Sbjct: 118 AGGRERGADLRYNLEITLEEAFTGKTETIRLPTSVTCEVCAGSGAKAGSKPRTCPTCGGY 177

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           GRV   AQ FF+IER C  C G G+II  PC+ C G GRV+ E+ LSVNVP GVDDG RI
Sbjct: 178 GRV-RAAQGFFAIERTCPNCHGRGEIIDDPCTACGGAGRVTRERTLSVNVPAGVDDGLRI 236

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG +G+ GG  GDLYIF+S+K H FF+RDGADL+C VPIS+VT A+ G   V  +D
Sbjct: 237 RLAGEGESGLRGGPAGDLYIFLSIKPHPFFQRDGADLFCRVPISMVTAALSGEITVPVID 296

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
            +H+ V IP GTQT KQFRLKGKGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF+
Sbjct: 297 GSHTTVRIPAGTQTNKQFRLKGKGMPVLRSRDVGDLYIQVFVETPQNLTKRQRELLQEFD 356

Query: 358 QISSQ-DNNPQSTGFFARMKDFFDSL 382
           Q  SQ DN+P+S GFF+R+K+FFD L
Sbjct: 357 QHGSQADNHPESAGFFSRVKEFFDGL 382


>gi|254470729|ref|ZP_05084132.1| chaperone protein DnaJ [Pseudovibrio sp. JE062]
 gi|211959871|gb|EEA95068.1| chaperone protein DnaJ [Pseudovibrio sp. JE062]
          Length = 375

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 269/383 (70%), Gaps = 9/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R   ++ LK+A+R LAMKYHPD+N  D EA+  F ++SEAYE L+DP
Sbjct: 1   MSKRDYYEVLGVAREVDEKALKSAYRKLAMKYHPDRNPGDDEAEANFKEVSEAYETLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G         G  DF+     IF    G      R  S 
Sbjct: 61  QKRAAYDRFGHAAFENGGFGGGG------GAGPGDFASSMADIFDEFFGG--GGGRRGSG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYNLEISLEEA+ GK+V+I  PT+V C  CSGSGAK GT P  C  C G+GRV
Sbjct: 113 RERGADLRYNLEISLEEAYEGKSVEIEVPTSVTCEPCSGSGAKSGTRPSTCPTCGGAGRV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C TC+G G+II  PC  C G GR ++E+ LSVN+P G++DGTRIRLS
Sbjct: 173 -RAAQGFFTMERTCPTCQGRGEIITDPCDSCGGTGRTTKERTLSVNIPSGIEDGTRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+S++ H+FF+RDGAD++C VPIS+ T A+GG F+V  LD   
Sbjct: 232 GEGEAGARGGPAGDLYIFLSIRPHEFFQRDGADIFCRVPISMTTAALGGQFEVPALDGNT 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +RV +PE TQTGKQFRL+GKGMPV+ S +KGD+Y+QV VETP  L KRQ+ELL EFE  S
Sbjct: 292 ARVKVPESTQTGKQFRLRGKGMPVMRSSQKGDMYIQVAVETPTNLTKRQKELLSEFEGES 351

Query: 361 SQDNNPQSTGFFARMKDFFDSLK 383
           S +N+P+STGFFA+ KDF ++ K
Sbjct: 352 SGENHPESTGFFAKAKDFLENFK 374


>gi|217979082|ref|YP_002363229.1| chaperone protein DnaJ [Methylocella silvestris BL2]
 gi|217504458|gb|ACK51867.1| chaperone protein DnaJ [Methylocella silvestris BL2]
          Length = 382

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/382 (54%), Positives = 259/382 (67%), Gaps = 10/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+ T+  LK AFR  AM++HPD+N  D  A+ KF +++EAY+ L D 
Sbjct: 8   MAKRDYYEVLGVSRSCTEIDLKAAFRKAAMEHHPDRNPGDHTAELKFKEVNEAYQTLSDQ 67

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E        GGFG+G    +  S++F+ +FG +M          S 
Sbjct: 68  QKRASYDRYGHAAFE-------QGGFGSGDGFAASMSDIFDDLFGDVMNR--RGGGGRSG 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+EI+LEEAF GK   +  P +V C  CSGSGAK G  P  C  C G GRV
Sbjct: 119 AVRGSDLRYNMEITLEEAFQGKVATLTLPASVTCDVCSGSGAKSGAKPRGCPTCGGHGRV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C  C G G+II  PC  C G GRV+ E+ LSVNVPPGV+DGTRIRLS
Sbjct: 179 RAQ-QGFFAIERTCPNCHGRGEIIDDPCQPCGGTGRVTRERSLSVNVPPGVEDGTRIRLS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIFIS + H FFKRDGADL+C VPIS+V   +GG  +V TL    
Sbjct: 238 GEGEAGQRGGPAGDLYIFISTQPHPFFKRDGADLFCRVPISMVQATVGGDVEVHTLGGGS 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V IPEGTQ+G+QF+L+ KGMPV+ S   GDLY+QV VETPQ L KRQRELL EFE  S
Sbjct: 298 AKVKIPEGTQSGRQFKLRHKGMPVLRSRDMGDLYIQVDVETPQNLTKRQRELLAEFEAES 357

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S   +P+++GFFA+MKDFF++L
Sbjct: 358 SNKTHPEASGFFAKMKDFFENL 379


>gi|86747556|ref|YP_484052.1| chaperone DnaJ [Rhodopseudomonas palustris HaA2]
 gi|123293268|sp|Q2J319|DNAJ_RHOP2 RecName: Full=Chaperone protein dnaJ
 gi|86570584|gb|ABD05141.1| Chaperone DnaJ [Rhodopseudomonas palustris HaA2]
          Length = 379

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 272/379 (71%), Gaps = 9/379 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++R+A +  LK+AFR LAMK+HPD+N  D  ++ KF +I+EAYEVL+D  KRA 
Sbjct: 8   YYETLEVERSADESTLKSAFRKLAMKWHPDRNPGDASSEIKFKEINEAYEVLKDGDKRAA 67

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E   Q  G GG G G    S FS++FE +FG         +   +  E GA
Sbjct: 68  YDRYGHAAFE---QGMGGGGPGFGAGFASSFSDIFEDLFGMA-----GQRGRGTGRERGA 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LE+A+ GKT QI  P +V C +CSG+GAK GT P  C+ C G+GRV   AQ
Sbjct: 120 DLRYNMEITLEDAYKGKTAQIEIPVSVTCESCSGTGAKAGTKPKTCSTCGGAGRVRQ-AQ 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C +C+G GQII  PC  C G GRV++E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPSCQGRGQIIEDPCPSCTGSGRVTKERTLSVNIPQGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           GV GG PGDLYIF+S+  H  F+RDGADL+C VPIS+VT A+GG F+V T++   ++V +
Sbjct: 239 GVRGGPPGDLYIFLSLASHAIFQRDGADLHCRVPISMVTAALGGEFEVPTIERGKTKVKV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQTG++FR+ GKGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS    
Sbjct: 299 PSGTQTGRRFRIAGKGMPVLRSRQVGDMYVQVAVETPQNLTKKQQELLAEFEKLSSGATQ 358

Query: 366 PQSTGFFARMKDFFDSLKN 384
           P++ GFF+++KDFF S  N
Sbjct: 359 PEAAGFFSKVKDFFGSRAN 377


>gi|92115788|ref|YP_575517.1| chaperone DnaJ [Nitrobacter hamburgensis X14]
 gi|91798682|gb|ABE61057.1| Chaperone DnaJ [Nitrobacter hamburgensis X14]
          Length = 377

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 267/374 (71%), Gaps = 9/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L +DRNA D +LK AFR LAMK+HPD+N  D  ++ +F +I+EAYEVL+D  KRA 
Sbjct: 7   YYETLEVDRNADDSKLKAAFRKLAMKWHPDRNPGDATSEMRFKEINEAYEVLKDGDKRAA 66

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E+G    G G    G    S FS++FE +F          +      E GA
Sbjct: 67  YDRFGHAAFEHGGMGGGPG---FGAGFASSFSDIFEDLF-----GMAGQRGRGGGRERGA 118

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EISL+EAF GKT Q+  P +V C +CSG+GAK GT P +C +C G+GR+   AQ
Sbjct: 119 DLRYNMEISLDEAFQGKTAQVEIPVSVTCESCSGTGAKAGTKPKNCAMCGGAGRI-RQAQ 177

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C+G GQ+I  PC  C G GRV+ E+ LSVNVP GV+DGTRIRL+GEG A
Sbjct: 178 GFFTLERTCPGCQGRGQMIEDPCPSCGGTGRVNRERSLSVNVPAGVEDGTRIRLAGEGEA 237

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+  H+FF+RDGADL+C VPIS+VT A+GG F+V T+D + ++V +
Sbjct: 238 GIRGGPPGDLYIFLSLAPHEFFQRDGADLHCRVPISMVTAALGGEFEVPTIDKSKTKVRV 297

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQ+G++FR+  KGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS    
Sbjct: 298 PSGTQSGRRFRIASKGMPVLRSRQTGDMYVQVVVETPQNLTKKQQELLAEFEKLSSGATQ 357

Query: 366 PQSTGFFARMKDFF 379
           P++ GFF ++KDFF
Sbjct: 358 PEAAGFFTKVKDFF 371


>gi|218531137|ref|YP_002421953.1| chaperone protein DnaJ [Methylobacterium chloromethanicum CM4]
 gi|254777965|sp|B7KSZ5|DNAJ_METC4 RecName: Full=Chaperone protein dnaJ
 gi|218523440|gb|ACK84025.1| chaperone protein DnaJ [Methylobacterium chloromethanicum CM4]
          Length = 385

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 263/381 (69%), Gaps = 1/381 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A++ +LK AFR LAM +HPD+N  D EA+ KF +++EAY+ L D 
Sbjct: 1   MSKRDYYEVLGVAKTASESELKVAFRKLAMVHHPDRNPGDKEAEIKFKEVNEAYQCLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A   G       G   G + +  F   F        G     +  +  
Sbjct: 61  QKRAAYDRFGHAAFSQGGAGGPGFGNEFGDFMSDIFENFFGDGRAAPGGGAGRGRGGAPG 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E G+DLRYNLEISLEEAF+GKT  IR PT++ C TCSG+GAK G+ P  C+ C G GRV
Sbjct: 121 RERGSDLRYNLEISLEEAFAGKTETIRIPTSIACETCSGTGAKAGSKPRTCSTCGGYGRV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF+IER C  C G G+++  PC+ C G GRV+ E+ LS+NVP GVDDG RIRL+
Sbjct: 181 -RAAQGFFAIERTCPNCHGRGEVVDDPCTACSGAGRVNRERTLSINVPAGVDDGLRIRLA 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG +G+ GG  GDLY+F+S+K H FF+RDGADL+C VPIS+VT A+ G   V  +D + 
Sbjct: 240 GEGESGMRGGTAGDLYVFLSIKPHPFFQRDGADLFCRVPISMVTAALSGEITVPVIDGSQ 299

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V IP GTQTGKQFR+K KGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF+Q +
Sbjct: 300 TQVRIPAGTQTGKQFRIKSKGMPVLRSREVGDLYIQVSVETPQNLTKRQRELLQEFDQSA 359

Query: 361 SQDNNPQSTGFFARMKDFFDS 381
           S +N+P+S GFF++++DFF S
Sbjct: 360 SDENHPESAGFFSKVRDFFVS 380


>gi|254562125|ref|YP_003069220.1| heat shock protein [Methylobacterium extorquens DM4]
 gi|254269403|emb|CAX25369.1| heat shock protein (Hsp40), co-chaperone with DnaK
           [Methylobacterium extorquens DM4]
          Length = 403

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 263/381 (69%), Gaps = 1/381 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A++ +LK AFR LAM +HPD+N  D EA+ KF +++EAY+ L D 
Sbjct: 19  MSKRDYYEVLGVAKTASESELKVAFRKLAMVHHPDRNPGDKEAEIKFKEVNEAYQCLSDG 78

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A   G       G   G + +  F   F        G     +  +  
Sbjct: 79  QKRAAYDRFGHAAFSQGGAGGPGFGNEFGDFMSDIFENFFGDGRAAPGGGAGRGRGGAPG 138

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E G+DLRYNLEISLEEAF+GKT  IR PT++ C TCSG+GAK G+ P  C+ C G GRV
Sbjct: 139 RERGSDLRYNLEISLEEAFAGKTETIRIPTSIACETCSGTGAKAGSKPRTCSTCGGYGRV 198

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF+IER C  C G G+++  PC+ C G GRV+ E+ LS+NVP GVDDG RIRL+
Sbjct: 199 -RAAQGFFAIERTCPNCHGRGEVVDDPCTACSGAGRVNRERTLSINVPAGVDDGLRIRLA 257

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG +G+ GG  GDLY+F+S+K H FF+RDGADL+C VPIS+VT A+ G   V  +D + 
Sbjct: 258 GEGESGMRGGPAGDLYVFLSIKPHPFFQRDGADLFCRVPISMVTAALSGEITVPVIDGSQ 317

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V IP GTQTGKQFR+K KGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF+Q +
Sbjct: 318 TQVRIPAGTQTGKQFRIKSKGMPVLRSREVGDLYIQVSVETPQNLTKRQRELLQEFDQSA 377

Query: 361 SQDNNPQSTGFFARMKDFFDS 381
           S +N+P+S GFF++++DFF S
Sbjct: 378 SDENHPESAGFFSKVRDFFVS 398


>gi|163852378|ref|YP_001640421.1| chaperone protein DnaJ [Methylobacterium extorquens PA1]
 gi|240139713|ref|YP_002964190.1| heat shock protein (Hsp40), co-chaperone with DnaK
           [Methylobacterium extorquens AM1]
 gi|254777966|sp|A9W6R8|DNAJ_METEP RecName: Full=Chaperone protein dnaJ
 gi|163663983|gb|ABY31350.1| chaperone protein DnaJ [Methylobacterium extorquens PA1]
 gi|240009687|gb|ACS40913.1| heat shock protein (Hsp40), co-chaperone with DnaK
           [Methylobacterium extorquens AM1]
          Length = 385

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 263/381 (69%), Gaps = 1/381 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A++ +LK AFR LAM +HPD+N  D EA+ KF +++EAY+ L D 
Sbjct: 1   MSKRDYYEVLGVAKTASESELKVAFRKLAMVHHPDRNPGDKEAEIKFKEVNEAYQCLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A   G       G   G + +  F   F        G     +  +  
Sbjct: 61  QKRAAYDRFGHAAFSQGGAGGPGFGNEFGDFMSDIFENFFGDGRAAPGGGAGRGRGGAPG 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E G+DLRYNLEISLEEAF+GKT  IR PT++ C TCSG+GAK G+ P  C+ C G GRV
Sbjct: 121 RERGSDLRYNLEISLEEAFAGKTETIRIPTSIACETCSGTGAKAGSKPRTCSTCGGYGRV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF+IER C  C G G+++  PC+ C G GRV+ E+ LS+NVP GVDDG RIRL+
Sbjct: 181 -RAAQGFFAIERTCPNCHGRGEVVDDPCTACSGAGRVNRERTLSINVPAGVDDGLRIRLA 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG +G+ GG  GDLY+F+S+K H FF+RDGADL+C VPIS+VT A+ G   V  +D + 
Sbjct: 240 GEGESGMRGGPAGDLYVFLSIKPHPFFQRDGADLFCRVPISMVTAALSGEITVPVIDGSQ 299

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V IP GTQTGKQFR+K KGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF+Q +
Sbjct: 300 TQVRIPAGTQTGKQFRIKSKGMPVLRSREVGDLYIQVSVETPQNLTKRQRELLQEFDQSA 359

Query: 361 SQDNNPQSTGFFARMKDFFDS 381
           S +N+P+S GFF++++DFF S
Sbjct: 360 SDENHPESAGFFSKVRDFFVS 380


>gi|254500772|ref|ZP_05112923.1| chaperone protein DnaJ [Labrenzia alexandrii DFL-11]
 gi|222436843|gb|EEE43522.1| chaperone protein DnaJ [Labrenzia alexandrii DFL-11]
          Length = 376

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/382 (55%), Positives = 271/382 (70%), Gaps = 8/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A D+ LK+A+R +AM++HPD+N  D EA+ KF +++EAY+ L+D 
Sbjct: 1   MSKRDFYEVLGVARDADDKALKSAYRKMAMQFHPDRNPGDAEAEAKFKEVNEAYDTLKDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G         G  DFS     I            R S  
Sbjct: 61  QKRAAYDRFGHAAFENGGFGGGG------GAGAHDFSSTMSDI-FEEFFGMGGGGRRSGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            E GADLRYNL++SLE+AF+GKTV+I  PT++ C  CSGSGAKPGT+P  C  C G+GRV
Sbjct: 114 RERGADLRYNLDVSLEDAFTGKTVEIEVPTSITCDICSGSGAKPGTSPTTCRTCGGAGRV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              AQ FF++ER C +C+G GQ+I  PC+ C G GR ++E+ LSVN+P G++DGTRIRL+
Sbjct: 174 RA-AQGFFTLERTCPSCQGKGQVISDPCTGCGGSGRKTQERTLSVNIPAGIEDGTRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIF+S++ H  F+RDGADLYC VPIS+ T  +GG FDV T+D   
Sbjct: 233 GEGEAGARGGPSGDLYIFLSIRLHDLFQRDGADLYCRVPISMSTATLGGQFDVPTVDGAT 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV +PEGTQTGKQFRL+GKGMP++ S + GD+Y+QV VETP  L KRQRELL EFEQ +
Sbjct: 293 SRVKVPEGTQTGKQFRLRGKGMPIMRSSQHGDMYIQVTVETPTNLTKRQRELLAEFEQEA 352

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S +N+P S GFF+++KDF D+L
Sbjct: 353 SGENHPASAGFFSKVKDFIDNL 374


>gi|39933411|ref|NP_945687.1| chaperone protein DnaJ [Rhodopseudomonas palustris CGA009]
 gi|192288768|ref|YP_001989373.1| chaperone protein DnaJ [Rhodopseudomonas palustris TIE-1]
 gi|11132035|sp|O08356|DNAJ_RHOS7 RecName: Full=Chaperone protein dnaJ
 gi|50400330|sp|Q6NCY3|DNAJ_RHOPA RecName: Full=Chaperone protein dnaJ
 gi|226735595|sp|B3Q973|DNAJ_RHOPT RecName: Full=Chaperone protein dnaJ
 gi|2058266|dbj|BAA19797.1| DnaJ protein [Rhodopseudomonas sp. No.7]
 gi|39647257|emb|CAE25778.1| heat shock protein DnaJ (40) [Rhodopseudomonas palustris CGA009]
 gi|192282517|gb|ACE98897.1| chaperone protein DnaJ [Rhodopseudomonas palustris TIE-1]
          Length = 379

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/376 (54%), Positives = 271/376 (72%), Gaps = 9/376 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++RNA D  LK+AFR LAMK+HPD+N  DP+ + KF +I+EAYEVL+D  KRA 
Sbjct: 8   YYETLEVERNADDSTLKSAFRKLAMKWHPDRNPGDPQCEIKFKEINEAYEVLKDGDKRAA 67

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E   Q    GG G G    S FS++FE +FG       + +   +  E GA
Sbjct: 68  YDRYGHAAFE---QGGFGGGAGFGAGFASSFSDIFEDLFGMA-----AQRGRGTGRERGA 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LE+AF GKT QI  P +V C  CSG+GAK GT P  C+ C G+GRV   AQ
Sbjct: 120 DLRYNMEITLEDAFKGKTAQIEIPVSVTCEACSGTGAKAGTKPKTCSTCGGAGRVRQ-AQ 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C +C+G GQ I  PC  C G GRV++E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPSCQGRGQTIEDPCPSCTGSGRVTKERTLSVNIPQGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+  H  F+RDGADL+C VPIS+VT A+GG F+V T+D   ++V +
Sbjct: 239 GLRGGPPGDLYIFLSLANHAIFQRDGADLHCRVPISMVTAALGGEFEVPTIDRGKTKVKV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQTG++FR+ GKGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS +  
Sbjct: 299 PSGTQTGRRFRIAGKGMPVLRSRQVGDMYVQVVVETPQNLTKKQQELLAEFEKLSSGETQ 358

Query: 366 PQSTGFFARMKDFFDS 381
           P++ GFF+++K+FF S
Sbjct: 359 PEAVGFFSKVKEFFGS 374


>gi|188582385|ref|YP_001925830.1| chaperone protein DnaJ [Methylobacterium populi BJ001]
 gi|254777968|sp|B1ZGR2|DNAJ_METPB RecName: Full=Chaperone protein dnaJ
 gi|179345883|gb|ACB81295.1| chaperone protein DnaJ [Methylobacterium populi BJ001]
          Length = 383

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 267/384 (69%), Gaps = 9/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A++ +LK AFR LAM +HPD+N  D EA+ KF +++EAY+ L D 
Sbjct: 1   MSKRDYYEVLGVAKTASESELKVAFRKLAMVHHPDRNPGDKEAEIKFKEVNEAYQCLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF-SELFEGIFGGIMGSGRSYKRSSS 119
           +KRA YD+ GH A    +Q    G      +G  DF S++FE  FG   G+    +    
Sbjct: 61  EKRAAYDRFGHAAF---SQGGAGGPGFGNEFG--DFMSDIFENFFGDGRGAPGGGRGRGG 115

Query: 120 TGEAG--ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                  ADLRYNLEISLEEAFSGKT  IR PT++ C  CSG+GAK G+ P  C+ C G 
Sbjct: 116 APGRERGADLRYNLEISLEEAFSGKTETIRIPTSIACEACSGTGAKAGSKPRTCSTCGGY 175

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           GRV   AQ FF+IER C  C G G+++  PC+ C G GRV+ E+ LS+NVP GVDDG RI
Sbjct: 176 GRV-RAAQGFFAIERTCPNCHGRGEVVDDPCTACSGAGRVNRERTLSINVPAGVDDGLRI 234

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG +G+ GG  GDLY+F+S+K H FF+RDGADL+C VPIS+VT A+ G   V  +D
Sbjct: 235 RLAGEGESGLRGGPSGDLYVFLSIKPHPFFQRDGADLFCRVPISMVTAALSGEITVPVID 294

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
            + ++V IP GTQT KQFR+KGKGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF+
Sbjct: 295 GSQTQVRIPAGTQTAKQFRIKGKGMPVLRSREVGDLYIQVSVETPQNLTKRQRELLQEFD 354

Query: 358 QISSQDNNPQSTGFFARMKDFFDS 381
           Q +S +N+P+S GFF++++DFF S
Sbjct: 355 QSASDENHPESAGFFSKVRDFFVS 378


>gi|91974870|ref|YP_567529.1| chaperone DnaJ [Rhodopseudomonas palustris BisB5]
 gi|91681326|gb|ABE37628.1| Chaperone DnaJ [Rhodopseudomonas palustris BisB5]
          Length = 386

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/379 (53%), Positives = 261/379 (68%), Gaps = 9/379 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++R+A +  LK+AFR LAMK+HPD+N  D  ++ KF +I+EAYEVL+D  KRA 
Sbjct: 15  YYETLEVERSADESTLKSAFRKLAMKWHPDRNPGDASSEVKFKEINEAYEVLKDGDKRAA 74

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E G       G G     +  F +LF        G         +  E GA
Sbjct: 75  YDRYGHAAFEQGMGGGAGFGAGFASSFSDIFEDLF--------GMAGQRGGRGTGRERGA 126

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EISLE+AF GKT QI  P +V C +CSG GAK GT P  C+ C G+GRV   AQ
Sbjct: 127 DLRYNMEISLEDAFKGKTAQIEIPVSVTCESCSGIGAKAGTKPKTCSTCGGAGRVRQ-AQ 185

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C +C+G GQII  PC  C G GRV+ E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 186 GFFTLERTCPSCQGRGQIIEDPCPSCTGSGRVTRERTLSVNIPQGVEDGTRIRLAGEGEA 245

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           GV GG PGDLYIF+S+  H  F+RDGADL+C VPIS+VT A+GG F+V T++   ++V +
Sbjct: 246 GVRGGPPGDLYIFLSLASHAIFQRDGADLHCRVPISMVTAALGGEFEVPTIERGKTKVKV 305

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQTG++FR+ GKGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS    
Sbjct: 306 PSGTQTGRRFRITGKGMPVLRSRQVGDMYVQVAVETPQNLTKKQQELLAEFEKLSSGATQ 365

Query: 366 PQSTGFFARMKDFFDSLKN 384
           P++ GFF ++KDFF S  N
Sbjct: 366 PEAAGFFTKVKDFFGSRAN 384


>gi|146337332|ref|YP_001202380.1| chaperone protein DnaJ [Bradyrhizobium sp. ORS278]
 gi|146190138|emb|CAL74130.1| Chaperone protein dnaJ, heat shock protein (Hsp40), co-chaperone
           with dnaK [Bradyrhizobium sp. ORS278]
          Length = 376

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 266/374 (71%), Gaps = 9/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++R+A + +LK+AFR LAMK+HPD+N  D  ++ KF +I+EAYEVLRD  KRA 
Sbjct: 7   YYETLEVERDADETKLKSAFRKLAMKWHPDKNPGDASSEVKFKEINEAYEVLRDADKRAA 66

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E   Q  G G  G G    S FS++FE +FG         +R  +  E GA
Sbjct: 67  YDRYGHAAFE---QGAGGGPHGFGAGFASSFSDIFEDLFGMA-----GQRRGGTGRERGA 118

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LEEAF GKT QI  P +V C  CSG+GAK GT P  C +C G+GRV   AQ
Sbjct: 119 DLRYNMEITLEEAFLGKTAQIEIPVSVTCEPCSGTGAKAGTKPKTCAMCGGAGRV-RQAQ 177

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C G GQ+I  PC  C G GRV+ ++ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 178 GFFTLERTCPGCHGRGQMIEDPCPSCSGSGRVTRDRTLSVNIPQGVEDGTRIRLAGEGEA 237

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+  H+FF+RDGADL+C VPIS+VT A+GG F+V T+D   ++V I
Sbjct: 238 GLRGGPPGDLYIFLSLTPHEFFQRDGADLHCRVPISMVTAALGGEFEVPTIDNGKTKVKI 297

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P G Q+G++FR+  KGMPV+ S + GD+YVQ+ VETPQ L K+Q+ELL EFE++SS    
Sbjct: 298 PAGAQSGRRFRIAAKGMPVLRSRQTGDMYVQIVVETPQNLTKKQQELLAEFEKLSSGATQ 357

Query: 366 PQSTGFFARMKDFF 379
           P++ GFF ++KDFF
Sbjct: 358 PEAAGFFTKVKDFF 371


>gi|90421854|ref|YP_530224.1| chaperone DnaJ [Rhodopseudomonas palustris BisB18]
 gi|122477600|sp|Q21CI1|DNAJ_RHOPB RecName: Full=Chaperone protein dnaJ
 gi|90103868|gb|ABD85905.1| Chaperone DnaJ [Rhodopseudomonas palustris BisB18]
          Length = 379

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 259/374 (69%), Gaps = 9/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L +DR+A D  LK AFR LAMK+HPD+N  D  ++ +F +I+EAYEVL+D  KRA 
Sbjct: 8   YYETLEVDRSADDSSLKAAFRKLAMKWHPDRNPGDASSESRFKEINEAYEVLKDGDKRAA 67

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E G           G    S FS++FE +FG             +  E GA
Sbjct: 68  YDRYGHAAFEQGGAGGPG----FGAGFASSFSDIFEDLFG----MAGQRGGRGTGRERGA 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LE+AF GKT QI  P +V C +CSG+GAK GT P  C++C G+GRV   AQ
Sbjct: 120 DLRYNMEITLEDAFVGKTAQIEIPVSVTCESCSGTGAKAGTKPKTCSMCGGAGRV-RQAQ 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C+G GQ I  PC  C G GR+  E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPGCQGRGQTIEDPCPACSGAGRIERERTLSVNIPQGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+  H+FF+RDGADL+C VPIS+V  A+GG  +V T+D   S+V +
Sbjct: 239 GLRGGPPGDLYIFLSLASHEFFQRDGADLHCRVPISMVAAALGGEIEVPTIDKGKSKVKV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQ+G++FR+  KGMPV+ S + GD+YVQV VETPQ L KRQ+ELL EFE++SS    
Sbjct: 299 PSGTQSGRRFRIAAKGMPVLRSRQTGDMYVQVVVETPQNLTKRQQELLAEFEKLSSGATQ 358

Query: 366 PQSTGFFARMKDFF 379
           P++ GFF ++KDFF
Sbjct: 359 PEAAGFFTKVKDFF 372


>gi|170750317|ref|YP_001756577.1| chaperone protein DnaJ [Methylobacterium radiotolerans JCM 2831]
 gi|254777969|sp|B1LZ52|DNAJ_METRJ RecName: Full=Chaperone protein dnaJ
 gi|170656839|gb|ACB25894.1| chaperone protein DnaJ [Methylobacterium radiotolerans JCM 2831]
          Length = 380

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/380 (54%), Positives = 268/380 (70%), Gaps = 7/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + AT+ ++K AFR LAM YHPD+N  D +A+ KF +I+EAY+ L D 
Sbjct: 1   MSKRDYYEILGVTKTATEGEMKVAFRKLAMTYHPDRNPGDKDAEIKFKEINEAYQCLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A      SQG GG G G       S++F+  FG   G G +  R  + 
Sbjct: 61  QKRAAYDRFGHAAF-----SQGGGGPGFGNEFGDFMSDIFDNFFGDGRGGGGARGRGGTP 115

Query: 121 GEAG-ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           G    ADLRYNLEI+LEEAF+GK   I+ PT++ C  C GSGAKPG+ P  C  C G GR
Sbjct: 116 GRERGADLRYNLEITLEEAFTGKAETIKIPTSITCEVCDGSGAKPGSKPRTCPTCAGYGR 175

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V   AQ FF+IER C  C G G+I+  PC+ C G GRV+ E+ LS+NVP GVDDG RIRL
Sbjct: 176 V-RAAQGFFAIERTCPNCHGRGEIVDDPCTACQGAGRVNRERTLSINVPAGVDDGLRIRL 234

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG +G+ GG  GDLY+F+S+K+H+FF+RDGADL+C VPIS+VT A+ G   V  +D +
Sbjct: 235 AGEGESGLRGGPAGDLYVFLSIKQHEFFQRDGADLFCRVPISMVTAALSGEITVPVIDGS 294

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            ++V IP GTQT KQFR+KGKGMPV+ S   GDLY+QV VETPQ L KRQRELL+EF+  
Sbjct: 295 QTQVRIPAGTQTAKQFRIKGKGMPVLRSREVGDLYIQVFVETPQNLTKRQRELLQEFDLS 354

Query: 360 SSQDNNPQSTGFFARMKDFF 379
           +S +N+P+S GFF++++DFF
Sbjct: 355 ASPENHPESAGFFSKVRDFF 374


>gi|85714056|ref|ZP_01045045.1| Heat shock protein DnaJ [Nitrobacter sp. Nb-311A]
 gi|85699182|gb|EAQ37050.1| Heat shock protein DnaJ [Nitrobacter sp. Nb-311A]
          Length = 378

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/374 (53%), Positives = 269/374 (71%), Gaps = 8/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L +DRNA D +LK AFR LAMK+HPD+N  D  ++ +F +I+EAYEVL+D  KRA 
Sbjct: 7   YYETLEVDRNADDTKLKAAFRKLAMKWHPDRNPGDASSEMRFKEINEAYEVLKDGNKRAA 66

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E+G    GA G   G    S FS++FE +FG         +  +   E G 
Sbjct: 67  YDRFGHAAFEHGGMGGGAAG--FGAGFASSFSDIFEDLFGMA-----GQRGRTGGRERGG 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LEEAF GKT Q+  P +V C +CSG+GAK GT P +C +C G+GR+   AQ
Sbjct: 120 DLRYNMEITLEEAFQGKTAQVEIPVSVTCESCSGTGAKAGTKPKNCAMCGGAGRIRQ-AQ 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C+G GQ+I  PC  C G GRV+ E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPGCQGRGQMIEDPCPSCGGSGRVNRERSLSVNIPAGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG PGDLYIF+S+  H+FF+RDGADL+C VPIS+VT A+GG  +V T+D + ++V +
Sbjct: 239 GIRGGPPGDLYIFLSLAPHEFFQRDGADLHCRVPISMVTAALGGELEVPTIDKSKTKVKV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQ+G++FR+  KGMPV+ S + GD+YVQV VETPQ L K+Q++LL EFE++SS D  
Sbjct: 299 PSGTQSGRRFRIATKGMPVLRSRQTGDMYVQVVVETPQNLTKKQQDLLAEFEKLSSGDTQ 358

Query: 366 PQSTGFFARMKDFF 379
           P++ GFF ++KDFF
Sbjct: 359 PEAAGFFTKVKDFF 372


>gi|115522376|ref|YP_779287.1| chaperone DnaJ [Rhodopseudomonas palustris BisA53]
 gi|115516323|gb|ABJ04307.1| chaperone protein DnaJ [Rhodopseudomonas palustris BisA53]
          Length = 394

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/374 (53%), Positives = 262/374 (70%), Gaps = 8/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++R+A D  LK+AFR LAMK+HPD+N  D  ++ KF +I+EAYEVL+D  KRA 
Sbjct: 22  YYETLEVERDADDSTLKSAFRKLAMKWHPDKNPGDASSEVKFKEINEAYEVLKDGDKRAA 81

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E G       G G     +  F +LF         +G+      +  E GA
Sbjct: 82  YDRFGHAAFEQGHGGGAGFGAGFASSFSDIFEDLF-------GMAGQRGGGRGTGRERGA 134

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LE+AF+GKT QI  P +V C  CSG+GAK GT P  C++C G GRV   AQ
Sbjct: 135 DLRYNMEITLEDAFAGKTAQIEIPVSVTCEPCSGTGAKAGTKPRTCSMCGGHGRVRQ-AQ 193

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C+G GQ+I  PC  C G GRVS ++ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 194 GFFTLERTCPGCQGRGQMIEDPCPSCSGSGRVSRDRSLSVNIPQGVEDGTRIRLAGEGEA 253

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           G+ GG  GDLYIF+SV  H+FF+RDGADL+C VPIS+VT A+GG F+V ++D   S+V +
Sbjct: 254 GLRGGPSGDLYIFLSVASHEFFQRDGADLHCRVPISMVTAALGGDFEVPSIDGGKSKVKV 313

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQTG++FR+  KGMPV+ S + GD+YVQV VETPQ L KRQ+ELL EFE++SS    
Sbjct: 314 PSGTQTGRRFRIAAKGMPVLRSRQTGDMYVQVVVETPQNLTKRQQELLAEFEKLSSGATQ 373

Query: 366 PQSTGFFARMKDFF 379
           P++ GFFA++KDFF
Sbjct: 374 PEAEGFFAKVKDFF 387


>gi|323136960|ref|ZP_08072040.1| chaperone protein DnaJ [Methylocystis sp. ATCC 49242]
 gi|322397721|gb|EFY00243.1| chaperone protein DnaJ [Methylocystis sp. ATCC 49242]
          Length = 372

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/379 (51%), Positives = 259/379 (68%), Gaps = 9/379 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + AT+ ++K AFR  AM+ HPD++  D EA+ +F +++EAY+ L DP
Sbjct: 1   MSKRDYYEILGVSKTATEVEMKIAFRKAAMQCHPDRHPGDQEAEARFKELNEAYQCLCDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G           +  +++FE +FG +MG           
Sbjct: 61  QKRAAYDRFGHAAFEQGGGMGGF----GAEGFGASMADIFEDLFGDVMGRRGRSGGRERG 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYN+EI+L+EA+ GK   ++ PT+V C  C+G+GAK G+ P  C  C G GRV
Sbjct: 117 ----SDLRYNMEITLDEAYQGKAASLKIPTSVTCDACTGTGAKKGSKPKTCMTCAGHGRV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSIER C +C G G+ I +PC  C G GR + E+ LSVNVPPGV+DGTRIRL+
Sbjct: 173 RAQ-QGFFSIERTCPSCHGRGETIDNPCPGCAGTGRKTVERSLSVNVPPGVEDGTRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG PGDLYIF+SVK H FF+RDGADLYC VPIS+V  A+GG   V  LD + 
Sbjct: 232 GEGEAGLRGGPPGDLYIFLSVKPHPFFQRDGADLYCRVPISMVRAALGGEIAVHALDGSE 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ +PEGTQ+G+Q + KGKGMPV+     GDL+VQ+ VETPQKL KRQ+ELL+EFE+ S
Sbjct: 292 VKLKVPEGTQSGRQIKAKGKGMPVLRGRDHGDLHVQINVETPQKLTKRQKELLQEFEKES 351

Query: 361 SQDNNPQSTGFFARMKDFF 379
           SQ+ +P+  GFFARMKD F
Sbjct: 352 SQETHPEEHGFFARMKDLF 370


>gi|75674397|ref|YP_316818.1| heat shock protein DnaJ [Nitrobacter winogradskyi Nb-255]
 gi|74419267|gb|ABA03466.1| Heat shock protein DnaJ [Nitrobacter winogradskyi Nb-255]
          Length = 378

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 266/374 (71%), Gaps = 8/374 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L +DRNA D +LK AFR LAMK+HPD+N  D  ++ +F +I+EAYEVL+D  KRA 
Sbjct: 7   YYETLEVDRNADDTKLKAAFRKLAMKWHPDRNPGDSSSEMRFKEINEAYEVLKDSNKRAA 66

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E G    GA G   G    S FS++FE +FG         +  S   E G 
Sbjct: 67  YDRFGHAAFEQGGMGGGAAG--FGAGFASSFSDIFEDLFGM-----SGQRGRSGGRERGG 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LEEA+ GKT QI  P +V C +CSG+GAK GT P +C +C G+GR+   AQ
Sbjct: 120 DLRYNMEITLEEAYHGKTAQIEIPVSVTCESCSGTGAKAGTKPKNCAMCGGAGRI-RQAQ 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C+G GQ+I  PC  C G GRV+ E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPGCQGRGQMIEDPCPSCGGSGRVNRERSLSVNIPAGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           GV GG PGDLYIF+S+  HQFF+RDGADL+C VPIS+V  A+GG  +V T+D   ++V +
Sbjct: 239 GVRGGPPGDLYIFLSLIPHQFFQRDGADLHCRVPISMVAAALGGEIEVPTIDKGKTKVRV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQ+G++FR+  KGMPV+ S + GD+YVQV VETPQ L KRQ++LL EFE++SS +  
Sbjct: 299 PSGTQSGRRFRIATKGMPVLRSRQTGDMYVQVVVETPQNLTKRQQDLLAEFEKLSSGETQ 358

Query: 366 PQSTGFFARMKDFF 379
           P++ GFF ++KDFF
Sbjct: 359 PEAAGFFTKVKDFF 372


>gi|27375791|ref|NP_767320.1| chaperone protein DnaJ [Bradyrhizobium japonicum USDA 110]
 gi|3121994|sp|P94319|DNAJ_BRAJA RecName: Full=Chaperone protein dnaJ
 gi|1769956|emb|CAA70848.1| DnaJ protein [Bradyrhizobium japonicum]
 gi|27348929|dbj|BAC45945.1| chaperone protein [Bradyrhizobium japonicum USDA 110]
          Length = 377

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 270/379 (71%), Gaps = 10/379 (2%)

Query: 6   FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           +Y+ L ++R+A + +LK++FR LAMK+HPD+N  D  ++ KF +I+EAYEVL+D  KRA 
Sbjct: 9   YYETLEVERDADESKLKSSFRKLAMKFHPDRNPGDDTSEVKFKEINEAYEVLKDKDKRAA 68

Query: 66  YDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGA 125
           YD+ GH A E   Q    GG G G    S FS++FE +FG       + +R     E GA
Sbjct: 69  YDRFGHAAFE---QGGPGGGAGFGAGFASSFSDIFEDLFG------MAGQRGRGGRERGA 119

Query: 126 DLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQ 185
           DLRYN+EI+LEEAF GKT QI  P +V C  CSG GAK GT P  C+ C G+GRV  + Q
Sbjct: 120 DLRYNMEITLEEAFGGKTAQIEIPVSVTCEACSGIGAKAGTKPKTCSTCGGAGRVRQS-Q 178

Query: 186 SFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGA 245
            FF++ER C  C+G GQ+I   C  C GQGRV+ E+ LSVN+P GV+DGTRIRL+GEG A
Sbjct: 179 GFFTLERTCPGCQGRGQMIEDACPSCSGQGRVTRERTLSVNIPQGVEDGTRIRLAGEGEA 238

Query: 246 GVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTI 305
           GV GG PGDLYIF+S+ +HQFF+RDGADL+C VPIS+VT A+GG F+V T++   ++V +
Sbjct: 239 GVRGGPPGDLYIFLSLAQHQFFQRDGADLHCRVPISMVTAALGGEFEVPTIEKGKAKVKV 298

Query: 306 PEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNN 365
           P GTQ+ ++FR+  KGMPV+ S + GD+YVQV VETPQ L K+Q+ELL EFE++SS +  
Sbjct: 299 PAGTQSNRRFRIASKGMPVLRSRQTGDMYVQVVVETPQNLTKKQQELLAEFEKLSSGNTQ 358

Query: 366 PQSTGFFARMKDFFDSLKN 384
           P+S GFF ++KDFF S  N
Sbjct: 359 PESEGFFTKVKDFFGSRAN 377


>gi|126732882|ref|ZP_01748673.1| chaperone protein DnaJ [Sagittula stellata E-37]
 gi|126706658|gb|EBA05732.1| chaperone protein DnaJ [Sagittula stellata E-37]
          Length = 381

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/385 (48%), Positives = 272/385 (70%), Gaps = 7/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A+  +LK A+R+ A + HPD+N++DP+++ +F +++EAY+VL+D 
Sbjct: 1   MSKRDYYDVLGVKKGASAEELKKAYRAKAKQLHPDRNKDDPDSEAQFKEVNEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            ++A YD+ GH A E G       G GA    +  S FS++F+ +FG  MG GR   R  
Sbjct: 61  DRKAAYDRFGHAAFEGGMGGGPRPGGGAQGNADFASAFSDVFDDLFGDFMG-GRQGGRQR 119

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           +    GADLRYNL ISLE+AF+G    I  PT+V+C  C+G+G++ G+ P  C  C+G G
Sbjct: 120 AA--RGADLRYNLRISLEDAFNGMAKTINVPTSVQCGVCNGTGSEGGSEPTTCPTCSGMG 177

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V  T Q FF++ER C TC G GQI+ +PC  CHG GRV +++ LSVN+P GV+ GTRIR
Sbjct: 178 KVRAT-QGFFTVERTCPTCSGMGQIVKNPCGNCHGAGRVQKDRALSVNIPAGVETGTRIR 236

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG PGDLYIFI V+ H+ F+R+G +L+C VP+SI   A+GG  +V T+D 
Sbjct: 237 LAGEGEAGMRGGPPGDLYIFIEVESHKIFEREGTELHCRVPVSITAAALGGDIEVPTIDG 296

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL+EF++
Sbjct: 297 GRSRVKIPAGSQSGRQMRLRGKGMPALRGGGAGDMFIELAVETPVNLTARQKELLKEFDE 356

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           + S+DNNP+S+ FF+ +K+F+DS+K
Sbjct: 357 L-SEDNNPESSSFFSSVKNFWDSMK 380


>gi|83594883|ref|YP_428635.1| chaperone protein DnaJ [Rhodospirillum rubrum ATCC 11170]
 gi|83577797|gb|ABC24348.1| Heat shock protein DnaJ [Rhodospirillum rubrum ATCC 11170]
          Length = 388

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/384 (50%), Positives = 260/384 (67%), Gaps = 10/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ + A++ ++K ++R+LAM+YHPD+N ND EA+  F +++ AYEVL+D 
Sbjct: 11  MTKRDFYEVLGVSKGASNDEIKKSYRTLAMRYHPDRNPNDAEAEANFREVNTAYEVLKDE 70

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E      GAG         + F+++F+ +FG  MG GR   R  ST
Sbjct: 71  QKRAAYDRFGHAAFE----QAGAGRGAGDFGFGAGFADIFDEMFGEFMGGGR---RGGST 123

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+EISLEEAF+GK   +  PT+V C +C GSG+K G  P  C  C+GSGRV
Sbjct: 124 AMRGADLRYNMEISLEEAFAGKKTTVHVPTSVSCESCRGSGSKGGAAPDGCPTCHGSGRV 183

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C TC G G++I  PC  C G GR   EK L V +P GV++GTRIRL+
Sbjct: 184 RAQ-QGFFTIERTCPTCHGQGKVIRDPCPDCAGSGRQRREKTLEVTIPAGVEEGTRIRLA 242

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ G   GDLYIF+++  H+ F RDGA++ C VPI + T A+GGT +V T+D   
Sbjct: 243 GEGEAGLRGAPSGDLYIFLTIAPHRIFLRDGANIACKVPIPMTTAALGGTIEVPTIDGGR 302

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           + VTIP+GTQTG QFRL+ KGM V+ S  +GD++V   VETP  L KRQ ELL EFE+  
Sbjct: 303 AAVTIPQGTQTGNQFRLRSKGMSVLRSASRGDMFVHAVVETPVNLTKRQEELLREFEEAG 362

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
            +D  ++P+S+ FF ++K+F++ +
Sbjct: 363 DKDTAHSPESSSFFKKVKEFWEDI 386


>gi|46201302|ref|ZP_00055306.2| COG0484: DnaJ-class molecular chaperone with C-terminal Zn finger
           domain [Magnetospirillum magnetotacticum MS-1]
          Length = 382

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 268/386 (69%), Gaps = 9/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y +LG+++ A+   +K A+R  AM++HPD+N  + EA++KF +I+EAY+VL+D 
Sbjct: 1   MSKQDYYDLLGVEKGASPDDIKKAYRKQAMQFHPDRNPGNAEAEQKFKEINEAYDVLKDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G GG   G  G    S++F+ +FG  MG GR   R  ST
Sbjct: 61  QKRAAYDRFGHAAFEQGGPGGGGGGGFGGFGGGGF-SDIFDEMFGEFMGGGR---RGQST 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G  GADLRYN++ISLE+AF+GKT  ++ P++  C  C G+G K G  P+ C+ C+G G++
Sbjct: 117 GR-GADLRYNMDISLEDAFAGKTTTVKVPSSAPCEDCKGTGGKDGAAPVTCSACHGHGKI 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C TC+G G+II  PC  C G GR  +EK L VN+P GV+DGTRIRL+
Sbjct: 176 RQQ-QGFFTIERTCPTCQGMGKIIKDPCRSCGGSGRTRKEKTLQVNIPAGVEDGTRIRLA 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ G  PGDLYIF+S+  H+ F+RDGA+++C VPI + T  +GGT +V T+D + 
Sbjct: 235 GEGEAGMRGAPPGDLYIFLSIAAHRIFQRDGANIFCRVPIPMTTAVLGGTIEVPTIDGSK 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++VTIPEGTQTG QFRL+ KGM V+ S  +GD+++Q  VETP  L KRQ+ELL EF +  
Sbjct: 295 AKVTIPEGTQTGNQFRLRSKGMSVLRSPARGDMFIQAVVETPVNLTKRQKELLHEFNEAG 354

Query: 361 SQD---NNPQSTGFFARMKDFFDSLK 383
             +   N+P+S GFFA++K+ ++ LK
Sbjct: 355 EGEKAKNSPESQGFFAKVKELWEDLK 380


>gi|260576198|ref|ZP_05844191.1| chaperone protein DnaJ [Rhodobacter sp. SW2]
 gi|259021678|gb|EEW24981.1| chaperone protein DnaJ [Rhodobacter sp. SW2]
          Length = 385

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/393 (47%), Positives = 259/393 (65%), Gaps = 17/393 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG+ R A+  +LK A+R+ A + HPD+N  DP A+ +F +++EAY+VL+D 
Sbjct: 1   MAKRDFYEILGVARGASAEELKKAYRAKAKELHPDRNTTDPNAEAQFKEVNEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQ---------GAGGFGAGMYGNSDFSELFEGIFGGIMGSG 111
            K+A YD+ GH A + G             G G F       S FS++FE +FG  MG  
Sbjct: 61  DKKAAYDRYGHAAFDGGMGGGPAGARRGYGGQGDFA------SAFSDVFEDLFGDFMGGR 114

Query: 112 RSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDC 171
                + S  + G+DLRYNL +SLEEAF G    I  P +V C +C G+GA+ G  P+ C
Sbjct: 115 GGGGGNRSRAQRGSDLRYNLRVSLEEAFKGAQKTINVPASVACESCKGTGAEGGAEPVTC 174

Query: 172 NICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGV 231
             C+G G+V    Q FF++ER C TC G GQI+ +PC  C G GRV +E+ LSVN+P GV
Sbjct: 175 PTCSGMGKVRAQ-QGFFTVERTCPTCNGMGQIVKNPCKACGGAGRVEKERALSVNIPAGV 233

Query: 232 DDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTF 291
           + GTRIRL+GEG AG+ GG  GDLYIFI VK+H  F+RDG +LYC VP+S+ T AMGG  
Sbjct: 234 ETGTRIRLAGEGEAGMRGGPSGDLYIFIEVKEHAIFQRDGINLYCRVPVSMPTAAMGGEV 293

Query: 292 DVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRE 351
           +V T+D   SRV +P G+QTGKQ RL+ KGMP +  G  GD+ +++ VETP  L  RQ++
Sbjct: 294 EVPTIDGGMSRVKVPAGSQTGKQMRLRAKGMPALRGGPAGDMLIELAVETPVNLTARQKD 353

Query: 352 LLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN 384
           LL EFE++ S++NNP+ + FF+++K F+D +KN
Sbjct: 354 LLREFEKL-SEENNPEGSSFFSKVKSFWDGMKN 385


>gi|144898438|emb|CAM75302.1| DnaJ central region:Heat shock protein DnaJ, N-terminal:Chaperone
           DnaJ, C-terminal [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 382

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 267/385 (69%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG +R A+  +LK A+R LAM+YHPD+N ++P+A +KF +++EAY+VL+D 
Sbjct: 1   MSKRDYYEVLGAERGASADELKKAYRKLAMQYHPDRNPDNPDAADKFKELNEAYDVLKDE 60

Query: 61  QKRALYDQGGHEALE-YGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
           QKRA YD+ GH A E      +G GG  +   G   FS+LFE +FG  MG GR   R  +
Sbjct: 61  QKRAAYDRFGHAAFENGMGGGRGPGGGFSDFGGGGGFSDLFEEMFGDFMGGGR---RGQA 117

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           TG  G+DLR+N++ISLE+AF+GK+  I  P++  C  C G+GAK G  P  C  C+G G+
Sbjct: 118 TGR-GSDLRFNMDISLEDAFAGKSTTITVPSSAPCEPCKGTGAKDGAQPTTCGTCHGHGK 176

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF+IER C TC+G G++I  PC  C GQG+V ++K L V +P GV++GTRIRL
Sbjct: 177 VRAQ-QGFFTIERTCPTCQGMGKVIKDPCRVCGGQGKVRKDKTLQVTIPAGVEEGTRIRL 235

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG  G   GDLYIF+S+K H+ F+RDGA++YC VPI + T A+GG  DV T++  
Sbjct: 236 AGEGEAGTRGAPAGDLYIFLSIKPHRLFQRDGANIYCRVPIPMTTAALGGAIDVPTIEGA 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            ++VTIP GTQ+G QFRLK KGM V+ S  +GD+++Q  +ETP  L  RQ+ELL+EFE  
Sbjct: 296 MTKVTIPPGTQSGNQFRLKSKGMSVLRSPARGDMFIQAMIETPVNLTDRQKELLKEFETA 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
             +D  +NP+S GFFA++K+ +  L
Sbjct: 356 GDKDTKHNPESEGFFAKVKELWKDL 380


>gi|84514870|ref|ZP_01002233.1| Chaperone, DnaJ [Loktanella vestfoldensis SKA53]
 gi|84511029|gb|EAQ07483.1| Chaperone, DnaJ [Loktanella vestfoldensis SKA53]
          Length = 383

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/385 (50%), Positives = 258/385 (67%), Gaps = 3/385 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLGI + A    +K A+R  A + HPD+N ++P+A+ +F + +EAYEVL+D 
Sbjct: 1   MSKRDYYDVLGIAKGADADAIKKAYRQKAKELHPDRNADNPKAEAQFKEANEAYEVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSSS 119
            K+A YD+ GH A E G  S   G  G G     S FS++F+ +FG  MG         S
Sbjct: 61  NKKAAYDRYGHAAFENGMGSSAGGPRGGGQGDFASAFSDVFDDLFGDFMGGRGGAGGRRS 120

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRYNL I+LE+AF+G    I   TAV C +C+G+GA+ G+ P  C  CNG G+
Sbjct: 121 GAQRGSDLRYNLRINLEDAFAGLQKTITVTTAVSCGSCTGTGAEGGSEPQVCPTCNGMGK 180

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C TC G GQII   C  CHG GRV +EK LSVN+P GV+ GTRIRL
Sbjct: 181 VRAQ-QGFFTVERTCPTCSGMGQIIKDKCKVCHGAGRVEKEKSLSVNIPAGVETGTRIRL 239

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AGV GG  GDLYIFI V  H  F+R+G +LYC VP+SI T A+GG  +V T+D  
Sbjct: 240 SGEGEAGVRGGPAGDLYIFIEVNSHPLFEREGLNLYCRVPVSIATAALGGEIEVPTIDGG 299

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            SRV +PEG+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP KL  RQRE+L EF+++
Sbjct: 300 RSRVKVPEGSQSGRQMRLRGKGMPALRGGPSGDMMIELTVETPVKLTARQREILREFDKL 359

Query: 360 SSQDNNPQSTGFFARMKDFFDSLKN 384
            S++NNPQ + FFA +K F+DS+K+
Sbjct: 360 -SEENNPQGSSFFASVKSFWDSMKS 383


>gi|126734465|ref|ZP_01750212.1| chaperone protein DnaJ [Roseobacter sp. CCS2]
 gi|126717331|gb|EBA14195.1| chaperone protein DnaJ [Roseobacter sp. CCS2]
          Length = 379

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 259/384 (67%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A    +K  +R  A + HPD+N ++P A+ +F + +EAYEVL+D 
Sbjct: 1   MAKRDYYEVLGVAKGADAATIKKGYRQKAKELHPDRNADNPNAEAQFKEANEAYEVLKDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YD+ GH A E G    G  G        S FS++F+ +FG  MG      R S+ 
Sbjct: 61  NKKAAYDRYGHAAFENGMGGGGPRGGQGDF--GSAFSDVFDDLFGDFMGGRGGGGRRSAA 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G DLRYNL I+LE+AF+G    I  PTAV C  C+G+GA+ G+ P  C  C+G G+V
Sbjct: 119 -QRGNDLRYNLRINLEDAFAGMQKTITVPTAVSCGACNGTGAEGGSEPQTCPTCSGMGKV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ER C TC G GQII  PC  CHGQGRV +EK LSVN+P GV+ GTRIRL+
Sbjct: 178 RAQ-QGFFTVERTCPTCSGLGQIIKDPCKTCHGQGRVEKEKSLSVNIPAGVETGTRIRLA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIFI V+ H  F+R+  +LYC VP+SI T A+GG  +V T+D   
Sbjct: 237 GEGEAGMRGGPTGDLYIFIEVQDHALFERESTNLYCRVPVSIATAALGGEIEVPTIDGGR 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV +PEG+Q+G+Q RL+GKGMP +  G  GD+++++ VETP KL  RQRE+L+EF+Q+ 
Sbjct: 297 SRVKVPEGSQSGRQMRLRGKGMPALRGGNTGDMFIELAVETPVKLTSRQREILKEFDQL- 355

Query: 361 SQDNNPQSTGFFARMKDFFDSLKN 384
           S+DNNPQ + FF  +K F+DS+K+
Sbjct: 356 SEDNNPQGSSFFDSVKSFWDSMKS 379


>gi|84684608|ref|ZP_01012509.1| chaperone protein DnaJ [Maritimibacter alkaliphilus HTCC2654]
 gi|84667587|gb|EAQ14056.1| chaperone protein DnaJ [Rhodobacterales bacterium HTCC2654]
          Length = 382

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 264/386 (68%), Gaps = 8/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG  + A+  ++K A+R  A + HPD+N ++P+A+ +F + +EAY+VL+DP
Sbjct: 1   MSKRDYYEVLGTTKGASADEIKKAYRKKAKELHPDRNADNPDAENQFKEANEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN---SDFSELFEGIFGGIMGSGRSYKRS 117
           +K+A YD+ GH A E G       G           S FS++F+ +FG  MG  R   RS
Sbjct: 61  EKKAAYDRFGHAAFEGGMGGGPRPGGPGFGQQGDFASAFSDVFDDLFGDFMGQ-RGGGRS 119

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
            +T   G+DLRYNL ++LEEA+ G    I  PT+V C TC G+G++ G +P  C  C+G 
Sbjct: 120 RAT--RGSDLRYNLRVTLEEAYEGLQKTINVPTSVMCDTCEGTGSEAGADPTTCPTCSGM 177

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF++ER C TC+G GQ+I +PC  CHGQGRV +E+ LSVN+P GV+ GTRI
Sbjct: 178 GKVRAQ-QGFFTVERTCPTCQGVGQMIKNPCKTCHGQGRVEKERALSVNIPAGVETGTRI 236

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG AG+ GG  GDLYIFI V +H  F+RDG  L+C VP+S+ + AMGG  +V T+D
Sbjct: 237 RLAGEGEAGMRGGPSGDLYIFIQVAEHPLFERDGVSLHCRVPVSMTSAAMGGDIEVPTID 296

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
              SRV IP G+Q+G+Q RL+GKGMP +  G  GD+Y+++ VETP  L  +Q+ELL EFE
Sbjct: 297 GGRSRVKIPAGSQSGRQMRLRGKGMPALRGGGHGDMYIELAVETPVNLTSKQKELLREFE 356

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLK 383
           ++ S++NNP+S+ FF+++K F+D +K
Sbjct: 357 KL-SEENNPESSTFFSKVKSFWDGMK 381


>gi|288956881|ref|YP_003447222.1| molecular chaperone [Azospirillum sp. B510]
 gi|288909189|dbj|BAI70678.1| molecular chaperone [Azospirillum sp. B510]
          Length = 384

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 259/387 (66%), Gaps = 6/387 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ +NA+  +LK A+R +AM+YHPD+N+ D +A++KF +ISEAY+VL+D 
Sbjct: 1   MAKQDYYELLGVAKNASADELKKAYRKMAMQYHPDRNQGDKDAEQKFKEISEAYDVLKDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSE---LFEGIFGGIMGSGRSYKRS 117
           QKRA YD+ GH A E G       G G   +          +F+ +FG  MG        
Sbjct: 61  QKRAAYDRFGHAAFEGGRGPGAGAGAGGFNFDFGGGGGFADIFDEMFGEFMGG--RRGGG 118

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 G DLRYNLEI LE+AF G    IR PT V+C  C+GSGA  GT P+ C  C G 
Sbjct: 119 GGASGRGQDLRYNLEIGLEDAFKGAQTTIRVPTTVQCDGCNGSGAAAGTQPITCPTCQGH 178

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF+IER C  C G+G++I   C  C G GR+ +EK L VN+P GV+DGTRI
Sbjct: 179 GKVRAQ-QGFFTIERTCPGCHGAGKVIKDACKTCGGSGRLRKEKTLQVNIPAGVEDGTRI 237

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG AG+ G   GDLYIF+++  H  F+RDGA+++C VPI + T A+GG+ +V T+D
Sbjct: 238 RLAGEGEAGLRGAPAGDLYIFLAIAPHAIFQRDGANIHCRVPIPMTTAALGGSVEVPTID 297

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
            T ++VT+P GTQ+G QFR+KGKGM V+ S ++GD+Y+Q  VETP  L KRQ+ELL EFE
Sbjct: 298 GTRTKVTVPPGTQSGHQFRIKGKGMSVLRSAQRGDMYIQAVVETPVNLTKRQQELLREFE 357

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLKN 384
             + + +NPQS GFFA++K+ ++ LK+
Sbjct: 358 GAAKEGSNPQSEGFFAKVKELWEDLKD 384


>gi|114762076|ref|ZP_01441544.1| chaperone protein DnaJ [Pelagibaca bermudensis HTCC2601]
 gi|114545100|gb|EAU48103.1| chaperone protein DnaJ [Roseovarius sp. HTCC2601]
          Length = 385

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 268/387 (69%), Gaps = 7/387 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A+  ++K  +R  A + HPD+N ++P+A+  F + +EAY+VL+DP
Sbjct: 1   MSKRDYYDVLGVSKGASADEIKKGYRKKAKELHPDRNADNPDAENLFKEANEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF----SELFEGIFGGIMGSGRSYKR 116
           +K+A YD+ GH A E G    G G  G G  G  DF    S++F+ +FG  MG  +    
Sbjct: 61  EKKAAYDRFGHAAFEGGMGGGGGGRPGGGFQGQGDFASAFSDVFDDLFGDFMGGRQGGGG 120

Query: 117 SSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
                   ADLRYNL ++LEEA++G    I  P++V+C  C+GSGA+ G  P+ C  C+G
Sbjct: 121 RQRAARG-ADLRYNLRVTLEEAYNGLQKTINVPSSVQCDECNGSGAEGGAEPVTCPTCSG 179

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
            G+V  T Q FF++ER C TC G GQII +PCSKC GQGRV  E+ LSVN+P GV+ GTR
Sbjct: 180 MGKVRAT-QGFFTVERTCPTCSGLGQIIKNPCSKCGGQGRVQRERALSVNIPAGVETGTR 238

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRL+GEG AG+ GG PGDLYIFI V+KH+ F+R+G++L+C VP+S+ T A+GG  +V T+
Sbjct: 239 IRLAGEGEAGMRGGPPGDLYIFIDVQKHEIFEREGSELHCRVPVSMATAALGGDIEVPTI 298

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           D   SRV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EF
Sbjct: 299 DGGRSRVKIPSGSQSGRQMRLRGKGMPALRGGSAGDMFIELAVETPVNLTSRQKELLREF 358

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSLK 383
           E++ S+DNNP+S  FF+ +++F+DS+K
Sbjct: 359 EEL-SEDNNPESHSFFSSVRNFWDSMK 384


>gi|254467277|ref|ZP_05080688.1| chaperone protein DnaJ [Rhodobacterales bacterium Y4I]
 gi|206688185|gb|EDZ48667.1| chaperone protein DnaJ [Rhodobacterales bacterium Y4I]
          Length = 385

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 262/386 (67%), Gaps = 5/386 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + AT  ++K  FR  A + HPD+N+++P+A+ +F + +EAY+VL+D 
Sbjct: 1   MSKRDYYDVLGVAKGATADEIKKGFRKKAKELHPDRNKDNPDAEAQFKEANEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG---NSDFSELFEGIFGGIMGSGRSYKRS 117
            K+A YD+ GH A E G      GG G G  G   +S FS++F+ +FG  MG  R     
Sbjct: 61  DKKAAYDRFGHAAFENGMGGGQRGGHGQGFGGGDFSSAFSDVFDDLFGDFMGGQRGGGGR 120

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                  ADLRYNL +SLEEAFSG    I+ PT+V CS+C G+GA+ G  P +C  C+G 
Sbjct: 121 QRAARG-ADLRYNLRVSLEEAFSGLHKTIKVPTSVACSSCEGTGAEGGVEPTNCPTCSGM 179

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF++ER C TC G GQII +PC  CHG GRV +++ LSVN+P GV+ GTRI
Sbjct: 180 GKVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCHGHGRVEKDRSLSVNIPAGVETGTRI 238

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG AG+ GG PGDLYIF+ V  H+ F+RDG +LYC VP+S+   A+GG+ +V T+D
Sbjct: 239 RLAGEGEAGLRGGPPGDLYIFVEVSAHKLFERDGNNLYCRVPVSMAKAALGGSIEVPTID 298

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               RV IPEG+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EFE
Sbjct: 299 GGRGRVQIPEGSQSGRQMRLRGKGMPALRGGATGDMFIELAVETPMNLTTRQKELLREFE 358

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLK 383
            IS+++ NP+S  FF+ +K F+D +K
Sbjct: 359 DISAENTNPESRSFFSSVKSFWDGMK 384


>gi|89067384|ref|ZP_01154897.1| Chaperone, DnaJ [Oceanicola granulosus HTCC2516]
 gi|89046953|gb|EAR53007.1| Chaperone, DnaJ [Oceanicola granulosus HTCC2516]
          Length = 384

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 259/385 (67%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K AFR  A + HPD N ++P A+ +F + +EAY+ L+DP
Sbjct: 1   MSKRDYYEVLGVSKGASADEIKKAFRRKAKELHPDSNADNPNAEAQFKEANEAYDCLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
           +K+A YD+ GH A E      G    G     +  S FS++F+ +FG  MG         
Sbjct: 61  EKKAAYDRFGHAAFEGMGAGGGGRRPGGAGQQDFASAFSDVFDDLFGDFMGGRPGAGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G+DLRYNL ++LEEA++G    I  PTAV+C TC G+GA+ G  P  C  C+G G
Sbjct: 121 QRATRGSDLRYNLRVTLEEAYNGLQKTITVPTAVQCGTCHGTGAEGGVEPQTCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G+GQ + +PC  CHG GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCNGAGQTVKNPCHTCHGAGRVEKERSLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H+ F+RDG+ L+C VP+S+   A+GG  +V ++D 
Sbjct: 240 LAGEGEAGLRGGPAGDLYIFIEVREHELFQRDGSHLFCRVPVSLAKAALGGDIEVPSIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IPEG+QTG+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EFE+
Sbjct: 300 GRSRVKIPEGSQTGRQMRLRGKGMPALRGGGHGDMFIELAVETPVNLTGRQKELLREFER 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           + S++NNPQS+ FF+ +K F+D +K
Sbjct: 360 L-SEENNPQSSSFFSAVKSFWDGMK 383


>gi|259418036|ref|ZP_05741955.1| chaperone protein DnaJ [Silicibacter sp. TrichCH4B]
 gi|259346942|gb|EEW58756.1| chaperone protein DnaJ [Silicibacter sp. TrichCH4B]
          Length = 385

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 264/385 (68%), Gaps = 3/385 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K  FR  A + HPD+N ++P+A+ +F + +EAY+VL+DP
Sbjct: 1   MSKRDYYEVLGVSKGASADEIKKGFRKKAKELHPDRNADNPDAEAQFKEANEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
           +++A YD+ GH A E G    G G  G    G+  S FS++F+ +FG  MG G     + 
Sbjct: 61  ERKAAYDRYGHAAFENGMGGGGGGRAGGHPGGDFSSAFSDVFDDLFGDFMGGGGGRGSAR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYNL +SLEEAF+G    I  PT+V C++C G+GA+ G  P  C  C+G G
Sbjct: 121 QRATRGADLRYNLRLSLEEAFAGLHKTINVPTSVSCTSCDGTGAEGGAEPTTCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQ+I +PC  CHG GRV +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGLGQMIKNPCKTCHGHGRVEKDRSLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG PGDLYIFI V +H+ F+R+G +L+C VP+S+   A+GG  +V T+D 
Sbjct: 240 LAGEGEAGLRGGPPGDLYIFIEVARHELFEREGNNLHCRVPVSMAKAALGGAIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IPEG+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+E+L+EF++
Sbjct: 300 GRGRVQIPEGSQSGRQMRLRGKGMPALRGGGTGDMFIELAVETPVNLTPRQKEILKEFDE 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           IS ++ NP++  FF+ +K F+D +K
Sbjct: 360 ISEENTNPETRSFFSSVKSFWDGMK 384


>gi|77464753|ref|YP_354257.1| chaperone, DnaJ [Rhodobacter sphaeroides 2.4.1]
 gi|123590809|sp|Q3IYM8|DNAJ_RHOS4 RecName: Full=Chaperone protein dnaJ
 gi|77389171|gb|ABA80356.1| Chaperone, DnaJ [Rhodobacter sphaeroides 2.4.1]
          Length = 382

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 259/384 (67%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  +LK A+R+ A + HPD+N ++P+A+ +F +++EAY+VLRD 
Sbjct: 1   MAKRDYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNPQAEAQFKEVNEAYDVLRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G       G G G  G+  S FS++FE +FG  MG      RS 
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGARAGGGYGQQGDFASAFSDVFEDLFGDFMGGRGGAPRSR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           +  + G+DLRYNL ++L+EA+ G    I  P +V C  C G+GA+ G   + C  C+G G
Sbjct: 121 A--QRGSDLRYNLRVTLDEAYRGVQKTINVPASVACDACKGTGAEGGAEAVTCPTCSGMG 178

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC  CHG GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 179 KVRAQ-QGFFTVERTCPTCNGMGQIVKNPCKVCHGAGRVEKERSLSVNIPAGVETGTRIR 237

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H  F+RDG  L+C VP+SI   A+GG  +V T+D 
Sbjct: 238 LAGEGEAGMRGGPSGDLYIFIEVREHALFQRDGVHLFCRVPVSIAAAALGGEVEVPTIDG 297

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+QTGKQ RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL EFE+
Sbjct: 298 GSSRVKIPAGSQTGKQMRLRGKGMPALRGGGAGDMLIELAVETPVNLTARQKELLREFEK 357

Query: 359 ISSQDNNPQSTGFFARMKDFFDSL 382
           + S+DNNP+   FF+++K F+D +
Sbjct: 358 L-SEDNNPEGKSFFSKVKGFWDGM 380


>gi|163737935|ref|ZP_02145351.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter
           gallaeciensis BS107]
 gi|163743882|ref|ZP_02151253.1| chaperone protein DnaJ [Phaeobacter gallaeciensis 2.10]
 gi|161382823|gb|EDQ07221.1| chaperone protein DnaJ [Phaeobacter gallaeciensis 2.10]
 gi|161388551|gb|EDQ12904.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter
           gallaeciensis BS107]
          Length = 387

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 255/387 (65%), Gaps = 5/387 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + AT  ++K  FR  A + HPD+N+++PE++ +F + +EAY+VL+DP
Sbjct: 1   MSKRDYYDVLGVSKGATADEIKKGFRKKAKELHPDRNKDNPESEGQFKEANEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFS----ELFEGIFGGIMGSGRSYKR 116
           +K+A YD+ GH A E G      GG G   +G  DFS    ++F+ +FG  MG       
Sbjct: 61  EKKAAYDRYGHAAFENGMGGGQRGGQGGQGFGGGDFSSAFSDVFDDLFGDFMGGRGGQGG 120

Query: 117 SSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
                  G+DLRYNL ISLE+AF+G    I  PTAV C +C G+GA+ G  P  C  C+G
Sbjct: 121 GRQRAARGSDLRYNLRISLEDAFAGMHKTINVPTAVACGSCEGTGAEGGVEPTTCPTCSG 180

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
            G+V    Q FF++ER C TC G GQII +PC  C G GRV +++ LSVN+P GV+ GTR
Sbjct: 181 MGKVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCQGHGRVEKDRSLSVNIPAGVETGTR 239

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRL+GEG AG+ GG PGDLYIF+ V  H  F+RDG +LYC VP+S+   A+GG  +V T+
Sbjct: 240 IRLAGEGEAGMRGGPPGDLYIFVEVAAHDLFERDGNNLYCRVPVSLAKAALGGAIEVPTI 299

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           D    RV IPEG+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EF
Sbjct: 300 DGGRGRVQIPEGSQSGRQMRLRGKGMPALRGGATGDMFIELAVETPVNLTSRQKELLREF 359

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSLK 383
           E +S  + NP+S  FF+ +K F+D +K
Sbjct: 360 EDLSEDNTNPESRSFFSSVKSFWDGMK 386


>gi|126463594|ref|YP_001044708.1| chaperone protein DnaJ [Rhodobacter sphaeroides ATCC 17029]
 gi|189083355|sp|A3PNM0|DNAJ_RHOS1 RecName: Full=Chaperone protein dnaJ
 gi|126105258|gb|ABN77936.1| chaperone protein DnaJ [Rhodobacter sphaeroides ATCC 17029]
          Length = 382

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 259/384 (67%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  +LK A+R+ A + HPD+N ++P+A+ +F +++EAY+VLRD 
Sbjct: 1   MAKRDYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNPQAEAQFKEVNEAYDVLRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G       G G G  G+  S FS++FE +FG  MG      RS 
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGARAGGGYGQQGDFASAFSDVFEDLFGDFMGGRGGAPRSR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           +  + G+DLRYNL ++L+EA+ G    I  P +V C  C G+GA+ G   + C  C+G G
Sbjct: 121 A--QRGSDLRYNLRVTLDEAYRGVQKTINVPASVACDACKGTGAEGGAEAVTCPTCSGMG 178

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC  CHG GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 179 KVRAQ-QGFFTVERTCPTCNGMGQIVKNPCKVCHGAGRVEKERSLSVNIPAGVETGTRIR 237

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H  F+RDG  L+C VP+SI   A+GG  +V T+D 
Sbjct: 238 LAGEGEAGMRGGPSGDLYIFIEVREHALFQRDGVHLFCRVPVSITAAALGGEVEVPTIDG 297

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+QTGKQ RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL EFE+
Sbjct: 298 GSSRVKIPAGSQTGKQMRLRGKGMPALRGGGAGDMLIELAVETPVNLTARQKELLREFEK 357

Query: 359 ISSQDNNPQSTGFFARMKDFFDSL 382
           + S+DNNP+   FF+++K F+D +
Sbjct: 358 L-SEDNNPEGKSFFSKVKGFWDGM 380


>gi|260866167|ref|YP_003232569.1| chaperone Hsp40 [Escherichia coli O111:H- str. 11128]
 gi|257762523|dbj|BAI34018.1| chaperone Hsp40 [Escherichia coli O111:H- str. 11128]
 gi|323176322|gb|EFZ61914.1| chaperone protein DnaJ [Escherichia coli 1180]
          Length = 371

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 256/386 (66%), Gaps = 21/386 (5%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G           GM G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQG-----------GMGGGADFSDIFGDVFGDIFGGGRGRQRAAR- 108

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 109 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 165

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 166 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 224

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 225 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 283

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 284 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 343

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 344 GGPTGEHNSPRSKSFFDGVKKFFDDL 369


>gi|86136817|ref|ZP_01055395.1| chaperone protein DnaJ [Roseobacter sp. MED193]
 gi|85826141|gb|EAQ46338.1| chaperone protein DnaJ [Roseobacter sp. MED193]
          Length = 385

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 254/385 (65%), Gaps = 3/385 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ + A+  ++K  FR  A + HPD+N ++P+A+ +F + +EAYEVL+D 
Sbjct: 1   MSKRDYYETLGVAKGASADEIKKGFRKKAKELHPDRNSDNPDAEAQFKEANEAYEVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
           +K+A YD+ GH A E G    G    G    G+  S FS++F+ +FG  MG         
Sbjct: 61  EKKAAYDRFGHAAFENGMGGGGGQRGGHPGGGDFSSAFSDVFDDLFGDFMGGRSQAGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYNL +SLEEAFSG    I+ PT+V C+ C GSGA+ G  P  C  C+G G
Sbjct: 121 QRASRGADLRYNLRVSLEEAFSGLHKTIKVPTSVSCTACDGSGAEGGVEPTTCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER+C TC G GQII +PC  CHG GR+ +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERSCPTCSGLGQIIKNPCKTCHGHGRIEKDRSLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG PGDLYIF+ V  H  F+RDG +LYC VP+S+   A+GG  +V T+D 
Sbjct: 240 LAGEGEAGLRGGPPGDLYIFVEVSSHDLFERDGNNLYCRVPVSMAKAALGGAIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IPEG+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  RQ+E++ EFE 
Sbjct: 300 GRGRVQIPEGSQSGRQMRLRSKGMPALRGGGVGDMFIELAVETPVNLTARQKEIMREFED 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           +S  + NP+S  FF+ +K F+D +K
Sbjct: 360 LSEDNTNPESRSFFSSVKGFWDGMK 384


>gi|146278798|ref|YP_001168957.1| chaperone protein DnaJ [Rhodobacter sphaeroides ATCC 17025]
 gi|189083356|sp|A4WW88|DNAJ_RHOS5 RecName: Full=Chaperone protein dnaJ
 gi|145557039|gb|ABP71652.1| chaperone protein DnaJ [Rhodobacter sphaeroides ATCC 17025]
          Length = 382

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 259/384 (67%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  +LK A+R+ A + HPD+N ++P+A+ +F +++EAY+VLRD 
Sbjct: 1   MAKRDYYEVLGVSRGASADELKKAYRTKAKELHPDRNADNPQAEAQFKEVNEAYDVLRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G    G      G   +  S FS++FE +FG  MG      RS 
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGGARGAYGQQADFASAFSDVFEDLFGDFMGGRGGAARSR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           +  + G+DLRYNL ++L+EA+ G    I  P +V C +C G+GA+ G  P+ C  C+G G
Sbjct: 121 A--QRGSDLRYNLRVTLDEAYRGVQKTINVPASVACDSCKGTGAEGGAEPVTCPTCSGMG 178

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC  CHG GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 179 KVRAQ-QGFFTVERTCPTCNGMGQIVKNPCKSCHGAGRVEKERTLSVNIPAGVETGTRIR 237

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H  F+RDG  L+C VP+SI   A+GG  +V T+D 
Sbjct: 238 LAGEGEAGMRGGPSGDLYIFIEVREHALFQRDGVHLFCRVPVSITAAALGGEVEVPTIDG 297

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+QTGKQ RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL EFE+
Sbjct: 298 GSSRVKIPAGSQTGKQMRLRGKGMPALRGGGAGDMLIELAVETPVNLTARQKELLREFEK 357

Query: 359 ISSQDNNPQSTGFFARMKDFFDSL 382
           + S+DNNP+   FF+++K F+D +
Sbjct: 358 L-SEDNNPEGKSFFSKVKGFWDGM 380


>gi|126738440|ref|ZP_01754145.1| chaperone protein DnaJ [Roseobacter sp. SK209-2-6]
 gi|126720239|gb|EBA16945.1| chaperone protein DnaJ [Roseobacter sp. SK209-2-6]
          Length = 385

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 259/387 (66%), Gaps = 5/387 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A+  ++K  FR  A + HPD+N ++P+A+ +F + +EAY+VL+D 
Sbjct: 1   MSKRDYYDVLGVAKGASADEIKKGFRKKAKELHPDRNSDNPDAEAQFKEANEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG---NSDFSELFEGIFGGIMGSGRSYKRS 117
           +K+A YD+ GH A E G    G G  G G  G   +S FS++F+ +FG  MG        
Sbjct: 61  EKKAAYDRFGHAAFENGMGGGGRGPGGMGAGGGDFSSAFSDVFDDLFGDFMGGRGGAGGR 120

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 GADLRYNL +SLEEAF+G    I+ PT+V CS+C GSGA+ G  P  C  C+G 
Sbjct: 121 QRATR-GADLRYNLRVSLEEAFAGMHKTIKVPTSVSCSSCDGSGAEGGVEPTTCPTCSGM 179

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF++ER C TC G GQII +PC  CHG GRV +++ LSVN+P GV+ GTRI
Sbjct: 180 GKVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCHGHGRVEKDRSLSVNIPAGVETGTRI 238

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG AG+ GG PGDLYIF+ V+ H  F+R+G +LYC VP+S+   A+GG  +V T+D
Sbjct: 239 RLAGEGEAGLRGGPPGDLYIFVEVEAHDLFEREGNNLYCRVPVSMAKAALGGAIEVPTID 298

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               RV IPEG+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  RQ+ELL EFE
Sbjct: 299 GGRGRVQIPEGSQSGRQMRLRSKGMPALRGGGVGDMFIELAVETPVNLTSRQKELLREFE 358

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLKN 384
            +S + NNP+S  FF+ +K F+D +K+
Sbjct: 359 DLSEEANNPESRSFFSSVKSFWDGMKS 385


>gi|99079850|ref|YP_612004.1| chaperone DnaJ [Ruegeria sp. TM1040]
 gi|122984499|sp|Q1GKS4|DNAJ_SILST RecName: Full=Chaperone protein dnaJ
 gi|99036130|gb|ABF62742.1| Chaperone DnaJ [Ruegeria sp. TM1040]
          Length = 385

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 264/385 (68%), Gaps = 3/385 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K  FR  A + HPD+N ++P+A+ +F + +EAY+VL+DP
Sbjct: 1   MSKRDYYEVLGVSKGASADEIKKGFRKKAKELHPDRNADNPDAEAQFKEANEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
           +++A YD+ GH A E G    G G  G    G+  S FS++F+ +FG  MG G     + 
Sbjct: 61  ERKAAYDRYGHAAFENGMGGGGGGRAGGHPGGDFSSAFSDVFDDLFGDFMGGGGGRAGAR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYNL +SLEEAF+G    I  PT+V C++C G+GA+ G  P  C  C+G G
Sbjct: 121 QRATRGADLRYNLRLSLEEAFAGLHKTINVPTSVSCTSCEGTGAEGGAEPTTCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQ+I +PC  C+G GRV +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGLGQMIKNPCKTCNGHGRVEKDRSLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG PGDLYIFI V +H+ F+R+G +L+C VP+S+   A+GG  +V T+D 
Sbjct: 240 LAGEGEAGLRGGPPGDLYIFIEVARHELFEREGNNLHCRVPVSMAKAALGGAIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IPEG+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+E+L+EF++
Sbjct: 300 GRGRVQIPEGSQSGRQMRLRGKGMPALRGGGTGDMFIELAVETPVNLTPRQKEILKEFDE 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           IS ++ NP++  FF+ +K F+D +K
Sbjct: 360 ISEENTNPETRSFFSSVKSFWDGMK 384


>gi|163797069|ref|ZP_02191024.1| export protein SecB [alpha proteobacterium BAL199]
 gi|159177585|gb|EDP62138.1| export protein SecB [alpha proteobacterium BAL199]
          Length = 377

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 265/385 (68%), Gaps = 9/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ R A+   LK ++R LAM+YHPD+N  D EA+ +F +++EAY+VL+D 
Sbjct: 1   MSKRDYYDVLGVARGASKDDLKRSYRKLAMQYHPDRNPGDDEAERQFKELNEAYDVLKDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+A YD+ GH A E GA  +  GG G G  G +D   +FE +FG  M       R    
Sbjct: 61  EKKAAYDRFGHAAFENGAAGRPGGGGGFGGGGFAD---IFEEMFGEFM----GGARRGGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+ ISLE+AF G+  +IR PT+  C +C+GSGA+ G+ P+ C  C+G+G+V
Sbjct: 114 AGRGSDLRYNMTISLEDAFQGRQTEIRIPTSAACESCNGSGAEKGSKPIGCPTCHGAGKV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C  C G GQ+I  PC  C G GR  +EK LSVN+P GV+DGTRIRL+
Sbjct: 174 RAQ-QGFFTIERTCPACGGVGQVIEKPCRTCSGAGRQRKEKTLSVNIPAGVEDGTRIRLT 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ G   GDLY+F+SV+ H  F+R+GAD++C VP+S+V  A+GG  +V T++   
Sbjct: 233 GEGEAGMRGAPAGDLYLFLSVEPHPLFQREGADVHCRVPVSMVAAALGGQIEVPTIEGAR 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+T+P GTQ+G+QFRLKGKGM V+ S  +GD+YV+V VETP  L KRQRELL EF+  +
Sbjct: 293 ARLTVPAGTQSGRQFRLKGKGMSVLRSPARGDMYVEVAVETPMNLTKRQRELLAEFKAEA 352

Query: 361 SQD-NNPQSTGFFARMKDFFDSLKN 384
             D  +PQS GFF ++K+ +D L++
Sbjct: 353 GDDTTSPQSHGFFDKVKELWDDLRD 377


>gi|221640667|ref|YP_002526929.1| chaperone protein DnaJ [Rhodobacter sphaeroides KD131]
 gi|254777973|sp|B9KPP3|DNAJ_RHOSK RecName: Full=Chaperone protein dnaJ
 gi|221161448|gb|ACM02428.1| Chaperone protein DnaJ [Rhodobacter sphaeroides KD131]
          Length = 381

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 256/389 (65%), Gaps = 17/389 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  +LK A+R+ A + HPD+N ++P+A+ +F +++EAY+VLRD 
Sbjct: 1   MAKRDYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNPQAEAQFKEVNEAYDVLRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGA-------GGFGAGMYGNSDFSELFEGIFGGIMGSGRS 113
            K+A YD+ GH A E G             G F       S FS++FE +FG  MG    
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGARAGGYGQQGDFA------SAFSDVFEDLFGDFMGGRGG 114

Query: 114 YKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNI 173
             RS +  + G+DLRYNL ++L+EA+ G    I  P +V C  C G+GA+ G   + C  
Sbjct: 115 APRSRA--QRGSDLRYNLRVTLDEAYRGVQKTINVPASVACDACKGTGAEGGAEAVTCPT 172

Query: 174 CNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDD 233
           C+G G+V    Q FF++ER C TC G GQI+ +PC  CHG GRV +E+ LSVN+P GV+ 
Sbjct: 173 CSGMGKVRAQ-QGFFTVERTCPTCNGMGQIVKNPCKVCHGAGRVEKERSLSVNIPAGVET 231

Query: 234 GTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDV 293
           GTRIRL+GEG AG+ GG  GDLYIFI V++H  F+RDG  L+C VP+SI   A+GG  +V
Sbjct: 232 GTRIRLAGEGEAGMRGGPSGDLYIFIEVREHALFQRDGVHLFCRVPVSIAAAALGGEVEV 291

Query: 294 ATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELL 353
            T+D   SRV IP G+QTGKQ RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL
Sbjct: 292 PTIDGGSSRVKIPAGSQTGKQMRLRGKGMPALRGGGAGDMLIELAVETPVNLTARQKELL 351

Query: 354 EEFEQISSQDNNPQSTGFFARMKDFFDSL 382
            EFE++ S+DNNP+   FF+++K F+D +
Sbjct: 352 REFEKL-SEDNNPEGKSFFSKVKGFWDGM 379


>gi|260429246|ref|ZP_05783223.1| chaperone protein DnaJ [Citreicella sp. SE45]
 gi|260419869|gb|EEX13122.1| chaperone protein DnaJ [Citreicella sp. SE45]
          Length = 385

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/388 (48%), Positives = 266/388 (68%), Gaps = 9/388 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y +LG+ + A+  ++K  +R  A + HPD+N ++P+A+ +F +I+EAY+VL+D 
Sbjct: 1   MSKRDYYDLLGVAKGASAEEIKKGYRKKAKELHPDRNADNPDAEAQFKEINEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN-----SDFSELFEGIFGGIMGSGRSYK 115
            K+A YD+ GH A E G    G G  G G  G      S FS++F+ +FG  MG      
Sbjct: 61  DKKAAYDRFGHAAFEGGMGGGGGGRPGGGFQGGQGDFASAFSDVFDDLFGDFMGG--RQG 118

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRYNL ++LEEA++G    I  PT+V+C  C+GSGA+ G  P+ C  C+
Sbjct: 119 GGRQRAARGADLRYNLRVTLEEAYNGLQKTINVPTSVQCGECNGSGAEGGAEPVTCPTCS 178

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G G+V  T Q FF++ER C TC G GQII +PC+KC GQGRV +E+ LSVN+P GV+ GT
Sbjct: 179 GMGKVRAT-QGFFTVERTCPTCSGLGQIIKNPCAKCGGQGRVQKERALSVNIPAGVETGT 237

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIRL+GEG AG+ GG PGDLYIFI VK H+ F+R+G +L+C VP+S+ T A+GG  +V T
Sbjct: 238 RIRLAGEGEAGMRGGPPGDLYIFIEVKPHEIFEREGVELHCRVPVSMTTAALGGDIEVPT 297

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           +D   SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  RQ+ELL E
Sbjct: 298 IDGGRSRVKIPSGSQSGRQMRLRSKGMPALRGGAAGDMFIELAVETPVNLTSRQKELLRE 357

Query: 356 FEQISSQDNNPQSTGFFARMKDFFDSLK 383
           FE++ S+DNNP+S  FF+ +K+F+DS+K
Sbjct: 358 FEEL-SEDNNPESHSFFSSVKNFWDSMK 384


>gi|332559647|ref|ZP_08413969.1| chaperone protein DnaJ [Rhodobacter sphaeroides WS8N]
 gi|332277359|gb|EGJ22674.1| chaperone protein DnaJ [Rhodobacter sphaeroides WS8N]
          Length = 382

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/384 (48%), Positives = 260/384 (67%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  +LK A+R+ A + HPD+N ++P+A+ +F +++EAY+VLRD 
Sbjct: 1   MAKRDYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNPQAEAQFKEVNEAYDVLRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G    GA   G G  G+  S FS++FE +FG  MG      RS 
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGARAGGYGQQGDFASAFSDVFEDLFGDFMGGRGGAPRSR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           +  + G+DLRYNL ++L+EA+ G    I  P +V C  C G+GA+ G   + C  C+G G
Sbjct: 121 A--QRGSDLRYNLRVTLDEAYRGVQKTINVPASVACDACKGTGAEGGAEAVTCPTCSGMG 178

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC  CHG GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 179 KVRAQ-QGFFTVERTCPTCNGMGQIVKNPCKVCHGAGRVEKERSLSVNIPAGVETGTRIR 237

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H  F+RDG  L+C VP+SI   A+GG  +V T+D 
Sbjct: 238 LAGEGEAGMRGGPSGDLYIFIEVREHALFQRDGVHLFCRVPVSIAAAALGGEVEVPTIDG 297

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+QTGKQ RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL EFE+
Sbjct: 298 GSSRVKIPAGSQTGKQMRLRGKGMPALRGGGAGDMLIELAVETPVNLTARQKELLREFEK 357

Query: 359 ISSQDNNPQSTGFFARMKDFFDSL 382
           + S+DNNP+   FF+++K F+D +
Sbjct: 358 L-SEDNNPEGKSFFSKVKGFWDGM 380


>gi|83951120|ref|ZP_00959853.1| chaperone protein DnaJ [Roseovarius nubinhibens ISM]
 gi|83839019|gb|EAP78315.1| chaperone protein DnaJ [Roseovarius nubinhibens ISM]
          Length = 384

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 260/386 (67%), Gaps = 4/386 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  ++K A+R  A + HPD+N+++PEA+ +F +  EAY+VL+D 
Sbjct: 1   MAKRDYYEVLGVARGASADEIKKAYRRKAKELHPDRNKDNPEAETQFKEAGEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G       G G    G+  S FS++F+ +FG  MG   +     
Sbjct: 61  DKKAAYDRFGHAAFEGGMGGGPRPGGGGHGQGDFASAFSDVFDDLFGDFMGGRGAPGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G+DLRYNL ++LEEAFSG    I  PT+V+C +C+GSGA+ G  P  C  C+G G
Sbjct: 121 QRASRGSDLRYNLRVTLEEAFSGLQKNITVPTSVQCGSCNGSGAEGGGEPTTCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQ I +PC  C G GRV +++ L+VN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGMGQTIKNPCKNCGGAGRVEKDRALNVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG+ GG  GDLYIFI V KH+ F+RD   L+C VP+S+   A+GG  +V T+D 
Sbjct: 240 LSGEGEAGLRGGPSGDLYIFIEVSKHKLFERDDMHLFCHVPVSMSVAALGGDIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+Q+G+Q RL+GKGMP + S  +GD+++++ VETP  L  RQ+ELL+EF+ 
Sbjct: 300 GRSRVKIPAGSQSGRQMRLRGKGMPALRSNTRGDMFIELAVETPVNLTARQKELLKEFDS 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLKN 384
           + S+DNNP+S  FF+ +K F+DS+K+
Sbjct: 360 L-SEDNNPESKSFFSSVKTFWDSMKS 384


>gi|254476589|ref|ZP_05089975.1| chaperone protein DnaJ [Ruegeria sp. R11]
 gi|214030832|gb|EEB71667.1| chaperone protein DnaJ [Ruegeria sp. R11]
          Length = 385

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 254/386 (65%), Gaps = 5/386 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y +LG+ + A+  ++K  FR  A + HPD+N ++P+A+ +F + +EAY+VL+DP
Sbjct: 1   MSKRDYYDILGVAKGASADEIKKGFRKKAKELHPDRNSDNPDAEAQFKEANEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG---NSDFSELFEGIFGGIMGSGRSYKRS 117
           +K+A YD+ GH A E G       G G G  G   +S FS++F+ +FG  MG        
Sbjct: 61  EKKAAYDRYGHAAFENGMGGGQRPGGGQGFGGGDFSSAFSDVFDDLFGDFMGGRGGAGGR 120

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                  +DLRYNL I+LEEAFSG    I  PTAV C +C G+GA+ G  P  C  C+G 
Sbjct: 121 QRAARG-SDLRYNLRINLEEAFSGLHKTINVPTAVACGSCEGTGAEGGVEPTTCPTCSGM 179

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF++ER C TC G GQII +PC  C G GRV +E+ LSVN+P GV+ GTRI
Sbjct: 180 GKVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCQGHGRVEKERSLSVNIPAGVETGTRI 238

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG AG+ GG PGDLYIF+ V  H  F+RDG +LYC VP+S+   A+GG  +V T+D
Sbjct: 239 RLAGEGEAGMRGGPPGDLYIFVEVAAHDLFERDGNNLYCRVPVSMAKAALGGAIEVPTID 298

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               RV IPEG+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+E+L EFE
Sbjct: 299 GGRGRVQIPEGSQSGRQMRLRGKGMPALRGGATGDMFIELAVETPVNLTSRQKEILREFE 358

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLK 383
           ++S  + NP+S  FF+ +K F+D +K
Sbjct: 359 ELSEDNTNPESRSFFSSVKSFWDGMK 384


>gi|238786665|ref|ZP_04630466.1| hypothetical protein yfred0001_16280 [Yersinia frederiksenii ATCC
           33641]
 gi|238725033|gb|EEQ16672.1| hypothetical protein yfred0001_16280 [Yersinia frederiksenii ATCC
           33641]
          Length = 376

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 260/386 (67%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVKKDADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G    G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C+ C G+G+V
Sbjct: 114 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLNECDVCHGSGAKPGSSPVTCSTCRGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++AC TC GSGQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 171 HMR-QGFFTVQQACPTCHGSGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVHLNEKQKQLLRELEESF 348

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 349 VGAAGEKNSPRSKSFLDGVKKFFDDL 374


>gi|56694972|ref|YP_165317.1| chaperone protein DnaJ [Ruegeria pomeroyi DSS-3]
 gi|62900157|sp|Q5LWJ5|DNAJ_SILPO RecName: Full=Chaperone protein dnaJ
 gi|56676709|gb|AAV93375.1| chaperone protein DnaJ [Ruegeria pomeroyi DSS-3]
          Length = 381

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 258/384 (67%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A+  ++K A+R  A + HPD+N+++P+A+  F +++EAYEVL+D 
Sbjct: 1   MSKRDYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKDNPDAESLFKEVNEAYEVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSD-FSELFEGIFGGIMGSGRSYKRSSS 119
           +K+A YD+ GH A E G       G G G    S  FS++FE +FG  MG          
Sbjct: 61  EKKAAYDRFGHAAFEGGMGGGQRPGGGFGSGDFSSAFSDVFEDLFGDFMGG--QRGGGGR 118

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G+DLRYNL ++LEEAFSG    I  PTAV CS+C G+GA+ G  P  C  C+G G+
Sbjct: 119 RAARGSDLRYNLRVTLEEAFSGLQKTINVPTAVACSSCEGTGAEGGVEPTTCPTCSGMGK 178

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C TC G GQII +PC  C GQGRV +++ LSVN+P GV+ GTRIRL
Sbjct: 179 VRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCRGQGRVEKDRALSVNIPAGVETGTRIRL 237

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG+ GG PGDLYIF+ V KH+ F+RDG +LYC VP+S+   A+GG  +V T+D  
Sbjct: 238 AGEGEAGMRGGPPGDLYIFVEVAKHELFERDGVNLYCRVPVSMAKAALGGAIEVPTIDGG 297

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             RV +P G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  +Q++LL EF+++
Sbjct: 298 RGRVQVPAGSQSGRQMRLRSKGMPALRGGGIGDMFIELAVETPVNLTSKQKDLLREFDEL 357

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
            S+DNNP++  FF+ +K F+D +K
Sbjct: 358 -SEDNNPETKSFFSSVKSFWDGMK 380


>gi|62899972|sp|Q6VAY5|DNAJ_PSEST RecName: Full=Chaperone protein dnaJ
 gi|33578041|gb|AAQ22347.1| heat shock protein [Pseudomonas stutzeri A15]
 gi|327482039|gb|AEA85349.1| DnaJ protein [Pseudomonas stutzeri DSM 4166]
          Length = 376

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/381 (51%), Positives = 250/381 (65%), Gaps = 10/381 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG++R A++ +LK A+R LAMK+HPD+N  D  A+E F + +EAYEVL DP
Sbjct: 1   MAKRDFYEVLGVERGASEAELKKAYRRLAMKHHPDRNPGDKAAEEAFKEANEAYEVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH     G   Q   G G   YG ++FS++F  +F            S   
Sbjct: 61  SKRAAYDQYGHA----GVDPQMGAGAGGAGYGGANFSDIFGDVFSDFFSG--GRGGSRGG 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE+ LEEA  G TV IR PT V+C TC GSGAK GT+P+ C  C G G+V
Sbjct: 115 AQRGSDLRYTLELDLEEAVRGTTVTIRVPTLVECKTCDGSGAKKGTSPVTCTTCGGIGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG++I  PC  CHGQGRV E+K LSV VPPGVD G RIRLS
Sbjct: 175 RMQ-QGFFSVQQTCPRCHGSGKMISDPCGSCHGQGRVEEQKTLSVKVPPGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ ++V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 234 GEGEAGTQGGPAGDLYVVVNVREHAIFQRDGKHLYCEVPISFADAALGGELEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRE+LEEF    
Sbjct: 293 VKLKIPEGTQTGKQFRLRGKGVAPVRGGAAGDLMCRVVVETPVNLSKRQREMLEEFRGTL 352

Query: 361 SQD--NNPQSTGFFARMKDFF 379
             D  ++P+++G+F  +K FF
Sbjct: 353 QGDTSHSPKASGWFEGVKRFF 373


>gi|226946320|ref|YP_002801393.1| chaperone protein DnaJ [Azotobacter vinelandii DJ]
 gi|259645266|sp|C1DFM2|DNAJ_AZOVD RecName: Full=Chaperone protein dnaJ
 gi|226721247|gb|ACO80418.1| chaperone protein DnaJ [Azotobacter vinelandii DJ]
          Length = 375

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/385 (51%), Positives = 252/385 (65%), Gaps = 13/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R A + +LK A+R LAMKYHPD+N +D  A+EKF +++EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGAGEAELKKAYRRLAMKYHPDRNPDDKSAEEKFKEVNEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KR  YDQ GH  ++     Q  GG      G ++FS++F  +F    G+      +   
Sbjct: 61  GKRMAYDQYGHAGVD-----QSMGGGAGFGAGGANFSDIFGDVFSDFFGA--GRAGARGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C TC GSGAK GT P+ C  C G G+V
Sbjct: 114 PQRGSDLRYTLELNLEEAVRGTTVTIRVPTLVHCKTCDGSGAKKGTTPVTCTTCGGIGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG++I  PC  CHGQGRV E K LSV VP GVD G RIRL+
Sbjct: 174 -RMQQGFFSVQQTCPRCHGSGKMIADPCPDCHGQGRVEEHKTLSVKVPAGVDSGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG PGDLY+ +SV++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 233 GEGEAGTLGGPPGDLYVVVSVREHPIFQRDGKHLYCEVPISFADAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGK FRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   S
Sbjct: 292 VKLKIPEGTQTGKLFRLRGKGVAPVRGGAAGDLMCRVVVETPVNLSKRQRELLEEFRG-S 350

Query: 361 SQDN---NPQSTGFFARMKDFFDSL 382
            Q N   +P+++G+F  MK FFD L
Sbjct: 351 LQGNSSHSPKASGWFEGMKRFFDDL 375


>gi|310817247|ref|YP_003965211.1| Chaperone protein DnaJ [Ketogulonicigenium vulgare Y25]
 gi|308755982|gb|ADO43911.1| Chaperone protein DnaJ [Ketogulonicigenium vulgare Y25]
          Length = 381

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/383 (49%), Positives = 260/383 (67%), Gaps = 3/383 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A   ++K A+R+ A + HPD+N+++P A+E+F + +EAY+VL+D 
Sbjct: 1   MAKRDYYEVLGVSRGAGADEIKKAYRTKAKELHPDRNKDNPNAEEQFKEANEAYDVLKDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YD+ GH A E G    G     AG  G   FS++FE +F      GRS       
Sbjct: 61  DKKAAYDRFGHAAFEGGMGGGGGARGNAGAGGFGAFSDIFEDLF--GDFGGRSGGGGRQR 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+ I+L EAF+G    I  PT+V C  C GSGA+ G+ P+ C  C G G+V
Sbjct: 119 AQRGSDLRYNMRITLGEAFAGTHKTITVPTSVSCGHCHGSGAEDGSEPVTCPTCGGMGKV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ERAC TC G GQII +PCS CHG GRV  EK LSVN+P GV+ GTRIRLS
Sbjct: 179 RAQ-QGFFAVERACPTCNGLGQIIKNPCSVCHGAGRVEREKQLSVNIPAGVETGTRIRLS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDL+IFI V+ H+ F+RDG  LYC VP+S+ T A+GG  +V T+D   
Sbjct: 238 GEGEAGMRGGPAGDLFIFIEVRDHELFQRDGLHLYCRVPVSMATAALGGDIEVPTIDGGK 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV IPEG+Q G+Q RL+GKGMP + S   GD+++++ VETP  L+ +Q+ELL EF+++ 
Sbjct: 298 SRVKIPEGSQNGRQMRLRGKGMPALRSKEFGDMFIELAVETPVNLSAKQKELLREFDKLG 357

Query: 361 SQDNNPQSTGFFARMKDFFDSLK 383
              NNP+ST FF+ +K+F+DS+K
Sbjct: 358 EARNNPESTNFFSAVKNFWDSMK 380


>gi|56551557|ref|YP_162396.1| chaperone protein DnaJ [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761312|ref|ZP_04759400.1| chaperone protein DnaJ [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|62900164|sp|Q5NPS5|DNAJ_ZYMMO RecName: Full=Chaperone protein dnaJ
 gi|56543131|gb|AAV89285.1| chaperone protein DnaJ [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374219|gb|EER63716.1| chaperone protein DnaJ [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 375

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/379 (49%), Positives = 255/379 (67%), Gaps = 7/379 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M + D+Y +L ++R A D+ +KT++R LAM+YHPD+N  D +A+E+F  ISEAY+ L+DP
Sbjct: 1   MSELDYYSLLEVERTADDKTIKTSYRRLAMRYHPDRNPGDSDAEERFKAISEAYDCLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ G +A + G    G GG      G SD   +FE +FG  MG GR   RSS  
Sbjct: 61  QKRAAYDRYGKDAFQGGGGFGGFGGGAQDFGGFSD---IFESVFGEFMG-GRGQARSSV- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRY+L+ISLEEAF GKTV I    A  C  C GSGAK G+    C+ C+GSGR+
Sbjct: 116 -QRGADLRYDLKISLEEAFKGKTVDIEIDVASVCDACHGSGAKAGSGRKTCDTCHGSGRI 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +E++C  C+G G++I  PC +CHG+GR  + K LSVN+P GVDDGTRIRLS
Sbjct: 175 -RVQQGFFVVEQSCPVCQGKGEVISDPCPECHGEGRCEKHKTLSVNIPAGVDDGTRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV+GG  GDLYIFI V  HQ F+R+  +L+  VPIS    A+GG+  V +LD   
Sbjct: 234 GEGEAGVHGGPAGDLYIFIHVTPHQVFQRESYNLFAHVPISFTKAALGGSIHVPSLDGEQ 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             ++IP G Q+GKQ + +G GMPV+N   +GDL +Q+ VETP +L  +QRELLE+F +  
Sbjct: 294 YEISIPAGIQSGKQLKRRGAGMPVLNGRGRGDLIIQIDVETPTRLTAKQRELLEQFRETE 353

Query: 361 SQDNNPQSTGFFARMKDFF 379
           + +  P+S+GFF+++K   
Sbjct: 354 TGEECPKSSGFFSKLKTIL 372


>gi|300939416|ref|ZP_07154079.1| chaperone protein DnaJ [Escherichia coli MS 21-1]
 gi|300455717|gb|EFK19210.1| chaperone protein DnaJ [Escherichia coli MS 21-1]
          Length = 376

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSRTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|260752844|ref|YP_003225737.1| chaperone protein DnaJ [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552207|gb|ACV75153.1| chaperone protein DnaJ [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 375

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/379 (49%), Positives = 255/379 (67%), Gaps = 7/379 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M + D+Y +L ++R A D+ +KT++R LAM+YHPD+N  D +A+E+F  ISEAY+ L+DP
Sbjct: 1   MSELDYYSLLEVERTADDKTIKTSYRRLAMRYHPDRNPGDSDAEERFKAISEAYDCLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ G +A + G    G GG      G SD   +FE +FG  MG GR   RSS  
Sbjct: 61  QKRAAYDRYGKDAFQGGGGFGGFGGGAQDFGGFSD---IFESVFGEFMG-GRGQARSSV- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRY+L+ISLEEAF GKTV I    A  C  C GSGAK G+    C+ C+GSGR+
Sbjct: 116 -QRGADLRYDLKISLEEAFKGKTVDIEIDVASVCDACHGSGAKAGSGRKTCDTCHGSGRI 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +E++C  C+G G++I  PC +CHG+GR  + K LSVN+P GVDDGTRIRLS
Sbjct: 175 -RVQQGFFVVEQSCPVCQGKGEVISDPCPECHGEGRCEKHKTLSVNIPAGVDDGTRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV+GG  GDLYIFI V  HQ F+R+  +L+  VPIS    A+GG+  + +LD   
Sbjct: 234 GEGEAGVHGGPAGDLYIFIHVTPHQVFQRESYNLFAHVPISFTKAALGGSIHIPSLDGEQ 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             ++IP G Q+GKQ + +G GMPV+N   +GDL +Q+ VETP +L  +QRELLE+F +  
Sbjct: 294 YEISIPAGIQSGKQLKRRGAGMPVLNGRGRGDLIIQIDVETPTRLTAKQRELLEQFRETE 353

Query: 361 SQDNNPQSTGFFARMKDFF 379
           + +  P+S+GFF+++K   
Sbjct: 354 TGEECPKSSGFFSKLKTIL 372


>gi|237704155|ref|ZP_04534636.1| chaperone with DnaK [Escherichia sp. 3_2_53FAA]
 gi|331645118|ref|ZP_08346229.1| chaperone protein DnaJ [Escherichia coli M605]
 gi|115511432|gb|ABI99506.1| chaperone with DnaK; heat shock protein [Escherichia coli APEC O1]
 gi|226902067|gb|EEH88326.1| chaperone with DnaK [Escherichia sp. 3_2_53FAA]
 gi|331045875|gb|EGI17994.1| chaperone protein DnaJ [Escherichia coli M605]
          Length = 386

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 11  MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 70

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 71  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 123

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 124 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 181 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 240 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 299 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 359 GGPTGEHNSPRSKSFFDGVKKFFDDL 384


>gi|331680585|ref|ZP_08381244.1| chaperone protein DnaJ [Escherichia coli H591]
 gi|332281300|ref|ZP_08393713.1| chaperone DnaJ [Shigella sp. D9]
 gi|110341820|gb|ABG68057.1| chaperone protein DnaJ [Escherichia coli 536]
 gi|331072048|gb|EGI43384.1| chaperone protein DnaJ [Escherichia coli H591]
 gi|332103652|gb|EGJ06998.1| chaperone DnaJ [Shigella sp. D9]
          Length = 386

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 11  MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 70

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 71  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 123

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 124 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 181 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 240 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 299 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 359 GGPTGEHNSPRSKSFFDGVKKFFDDL 384


>gi|16128009|ref|NP_414556.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli str. K-12
           substr. MG1655]
 gi|89106899|ref|AP_000679.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli str. K-12
           substr. W3110]
 gi|170079678|ref|YP_001728998.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli str. K-12
           substr. DH10B]
 gi|312970110|ref|ZP_07784292.1| chaperone protein DnaJ [Escherichia coli 1827-70]
 gi|118719|sp|P08622|DNAJ_ECOLI RecName: Full=Chaperone protein dnaJ; AltName: Full=HSP40; AltName:
           Full=Heat shock protein J
 gi|226735566|sp|B1XBE0|DNAJ_ECODH RecName: Full=Chaperone protein dnaJ
 gi|145769|gb|AAA23693.1| heat shock protein dnaJ [Escherichia coli]
 gi|145772|gb|AAA00009.1| DnaJ [Escherichia coli]
 gi|1786197|gb|AAC73126.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli str. K-12
           substr. MG1655]
 gi|21321903|dbj|BAB96590.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli str. K12
           substr. W3110]
 gi|169887513|gb|ACB01220.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli str. K-12
           substr. DH10B]
 gi|260450773|gb|ACX41195.1| chaperone protein DnaJ [Escherichia coli DH1]
 gi|310337608|gb|EFQ02719.1| chaperone protein DnaJ [Escherichia coli 1827-70]
 gi|315134711|dbj|BAJ41870.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli DH1]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQ++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|123440975|ref|YP_001004964.1| chaperone protein DnaJ [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332160240|ref|YP_004296817.1| chaperone protein DnaJ [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|189027790|sp|A1JJD6|DNAJ_YERE8 RecName: Full=Chaperone protein dnaJ
 gi|122087936|emb|CAL10724.1| chaperone protein DnaJ [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607190|emb|CBY28688.1| chaperone protein DnaJ [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325664470|gb|ADZ41114.1| chaperone protein DnaJ [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330863053|emb|CBX73185.1| chaperone protein dnaJ [Yersinia enterocolitica W22703]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 260/386 (67%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVKKDADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G    G +DF+++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGFGGGGADFTDIFGDVFGDIFGGGRRQRASR-- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C+ C G+G+V
Sbjct: 114 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLNECDVCHGSGAKPGSSPVTCSTCRGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++AC TC GSGQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 171 HMR-QGFFTVQQACPTCHGSGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVHLSEKQKQLLRELEESF 348

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 349 VGAAGEKNSPRSKSFLDGVKKFFDDL 374


>gi|170768452|ref|ZP_02902905.1| chaperone protein DnaJ [Escherichia albertii TW07627]
 gi|170122556|gb|EDS91487.1| chaperone protein DnaJ [Escherichia albertii TW07627]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 257/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKSAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|238752257|ref|ZP_04613737.1| hypothetical protein yrohd0001_5360 [Yersinia rohdei ATCC 43380]
 gi|238709525|gb|EEQ01763.1| hypothetical protein yrohd0001_5360 [Yersinia rohdei ATCC 43380]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 260/386 (67%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVKKDAEEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G    G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C+ C G+G+V
Sbjct: 114 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLNECDVCHGSGAKPGSSPVTCSTCRGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++AC TC G+GQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 171 HMR-QGFFTVQQACPTCHGNGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVHLSEKQKQLLRELEESF 348

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 349 VGAAGEKNSPRSKSFLDGVKKFFDDL 374


>gi|331661376|ref|ZP_08362300.1| chaperone protein DnaJ [Escherichia coli TA143]
 gi|331061291|gb|EGI33254.1| chaperone protein DnaJ [Escherichia coli TA143]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEHSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|82542633|ref|YP_406580.1| chaperone protein DnaJ [Shigella boydii Sb227]
 gi|187730634|ref|YP_001878838.1| chaperone protein DnaJ [Shigella boydii CDC 3083-94]
 gi|123560624|sp|Q326K6|DNAJ_SHIBS RecName: Full=Chaperone protein dnaJ
 gi|226735606|sp|B2U233|DNAJ_SHIB3 RecName: Full=Chaperone protein dnaJ
 gi|81244044|gb|ABB64752.1| chaperone with DnaK [Shigella boydii Sb227]
 gi|187427626|gb|ACD06900.1| chaperone protein DnaJ [Shigella boydii CDC 3083-94]
 gi|320174102|gb|EFW49270.1| Chaperone protein DnaJ [Shigella dysenteriae CDC 74-1112]
 gi|320186334|gb|EFW61069.1| Chaperone protein DnaJ [Shigella flexneri CDC 796-83]
 gi|332090543|gb|EGI95641.1| chaperone protein DnaJ [Shigella boydii 3594-74]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGQHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|311695971|gb|ADP98844.1| chaperone protein dnaJ [marine bacterium HP15]
          Length = 375

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/387 (51%), Positives = 252/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LGI R+A ++++K A+R LAMKYHPD+N +D EA+ KF + SEAYEVL +P
Sbjct: 1   MAKRDYYEILGISRDADEKEIKRAYRKLAMKYHPDRNPDDTEAENKFKEASEAYEVLAEP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH      A   G  G G    G + FS++F  +FG I G           
Sbjct: 61  SKRAAYDQFGH------AGVDGQAGGGGFGGGGASFSDIFGDVFGDIFGG-----GGRGR 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY LE+ LEEA  GKTVQI+ P   +C  C GSGA+ G+ P  C+ C G G+V
Sbjct: 110 NTRGADLRYTLELDLEEAVKGKTVQIKIPGHRECEVCDGSGAEKGSRPETCSTCKGMGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TCRGSGQII +PC  CHGQGRV EEK LSV VPPGVD G RIRLS
Sbjct: 170 -RMQQGFFTVQQACPTCRGSGQIIKNPCKACHGQGRVQEEKTLSVKVPPGVDTGDRIRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  GV GG PGDLY+ I+V++H  F RDG +LYC VPISIV  ++GG  +V TLD   
Sbjct: 229 GEGEMGVDGGPPGDLYVQIAVREHSIFTRDGRNLYCEVPISIVDASLGGELEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQTGK FRL+ KG+  +  G  GDL  +V VETP  L KRQ+ELLEEF++  
Sbjct: 288 VKLKIPPETQTGKLFRLRNKGVSPVRGGPAGDLLCRVIVETPVNLTKRQKELLEEFQKTL 347

Query: 361 SQDN----NPQSTGFFARMKDFFDSLK 383
              N     P+ T +F  +K FFD +K
Sbjct: 348 DASNGTEHGPKKTSWFEGVKSFFDEMK 374


>gi|15799695|ref|NP_285707.1| chaperone protein DnaJ [Escherichia coli O157:H7 EDL933]
 gi|15829269|ref|NP_308042.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. Sakai]
 gi|26245937|ref|NP_751976.1| chaperone protein DnaJ [Escherichia coli CFT073]
 gi|74310628|ref|YP_309047.1| chaperone protein DnaJ [Shigella sonnei Ss046]
 gi|91209072|ref|YP_539058.1| chaperone protein DnaJ [Escherichia coli UTI89]
 gi|157156432|ref|YP_001461184.1| chaperone protein DnaJ [Escherichia coli E24377A]
 gi|157159482|ref|YP_001456800.1| chaperone protein DnaJ [Escherichia coli HS]
 gi|168762775|ref|ZP_02787782.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4501]
 gi|168785065|ref|ZP_02810072.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC869]
 gi|168797995|ref|ZP_02823002.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC508]
 gi|170021625|ref|YP_001726579.1| chaperone protein DnaJ [Escherichia coli ATCC 8739]
 gi|170683873|ref|YP_001742130.1| chaperone protein DnaJ [Escherichia coli SMS-3-5]
 gi|188495716|ref|ZP_03002986.1| chaperone protein DnaJ [Escherichia coli 53638]
 gi|191167400|ref|ZP_03029215.1| chaperone protein DnaJ [Escherichia coli B7A]
 gi|191174613|ref|ZP_03036103.1| chaperone protein DnaJ [Escherichia coli F11]
 gi|193065637|ref|ZP_03046703.1| chaperone protein DnaJ [Escherichia coli E22]
 gi|193070593|ref|ZP_03051531.1| chaperone protein DnaJ [Escherichia coli E110019]
 gi|209917205|ref|YP_002291289.1| chaperone protein DnaJ [Escherichia coli SE11]
 gi|215485176|ref|YP_002327607.1| chaperone protein DnaJ [Escherichia coli O127:H6 str. E2348/69]
 gi|217325343|ref|ZP_03441427.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. TW14588]
 gi|218547452|ref|YP_002381243.1| chaperone protein DnaJ [Escherichia fergusonii ATCC 35469]
 gi|218552599|ref|YP_002385512.1| chaperone protein DnaJ [Escherichia coli IAI1]
 gi|218556953|ref|YP_002389866.1| chaperone protein DnaJ [Escherichia coli S88]
 gi|218687891|ref|YP_002396103.1| chaperone protein DnaJ [Escherichia coli ED1a]
 gi|218693490|ref|YP_002401157.1| chaperone protein DnaJ [Escherichia coli 55989]
 gi|218698433|ref|YP_002406062.1| chaperone protein DnaJ [Escherichia coli IAI39]
 gi|218703275|ref|YP_002410794.1| chaperone protein DnaJ [Escherichia coli UMN026]
 gi|227885090|ref|ZP_04002895.1| chaperone protein DnaJ [Escherichia coli 83972]
 gi|229560216|ref|YP_667956.2| chaperone protein DnaJ [Escherichia coli 536]
 gi|229775981|ref|YP_851221.2| chaperone protein DnaJ [Escherichia coli APEC O1]
 gi|256020141|ref|ZP_05434006.1| chaperone protein DnaJ [Shigella sp. D9]
 gi|260842254|ref|YP_003220032.1| chaperone Hsp40 [Escherichia coli O103:H2 str. 12009]
 gi|260853227|ref|YP_003227118.1| chaperone Hsp40 [Escherichia coli O26:H11 str. 11368]
 gi|261226774|ref|ZP_05941055.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255177|ref|ZP_05947710.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. FRIK966]
 gi|291280837|ref|YP_003497655.1| Chaperone protein DnaJ [Escherichia coli O55:H7 str. CB9615]
 gi|293403087|ref|ZP_06647184.1| chaperone DnaJ [Escherichia coli FVEC1412]
 gi|293408106|ref|ZP_06651946.1| chaperone DnaJ [Escherichia coli B354]
 gi|293417890|ref|ZP_06660512.1| chaperone DnaJ [Escherichia coli B185]
 gi|293476679|ref|ZP_06665087.1| chaperone DnaJ [Escherichia coli B088]
 gi|298378614|ref|ZP_06988498.1| chaperone DnaJ [Escherichia coli FVEC1302]
 gi|300816046|ref|ZP_07096269.1| chaperone protein DnaJ [Escherichia coli MS 107-1]
 gi|300821986|ref|ZP_07102130.1| chaperone protein DnaJ [Escherichia coli MS 119-7]
 gi|300896776|ref|ZP_07115281.1| chaperone protein DnaJ [Escherichia coli MS 198-1]
 gi|300905411|ref|ZP_07123179.1| chaperone protein DnaJ [Escherichia coli MS 84-1]
 gi|300924041|ref|ZP_07140040.1| chaperone protein DnaJ [Escherichia coli MS 182-1]
 gi|300980946|ref|ZP_07175260.1| chaperone protein DnaJ [Escherichia coli MS 45-1]
 gi|300984036|ref|ZP_07176855.1| chaperone protein DnaJ [Escherichia coli MS 200-1]
 gi|301019815|ref|ZP_07183957.1| chaperone protein DnaJ [Escherichia coli MS 69-1]
 gi|301048394|ref|ZP_07195422.1| chaperone protein DnaJ [Escherichia coli MS 185-1]
 gi|301303525|ref|ZP_07209648.1| chaperone protein DnaJ [Escherichia coli MS 124-1]
 gi|306815387|ref|ZP_07449536.1| chaperone protein DnaJ [Escherichia coli NC101]
 gi|307311530|ref|ZP_07591172.1| chaperone protein DnaJ [Escherichia coli W]
 gi|309797779|ref|ZP_07692163.1| chaperone protein DnaJ [Escherichia coli MS 145-7]
 gi|312966137|ref|ZP_07780363.1| chaperone protein DnaJ [Escherichia coli 2362-75]
 gi|331661052|ref|ZP_08361984.1| chaperone protein DnaJ [Escherichia coli TA206]
 gi|331666248|ref|ZP_08367129.1| chaperone protein DnaJ [Escherichia coli TA271]
 gi|331681401|ref|ZP_08382038.1| chaperone protein DnaJ [Escherichia coli H299]
 gi|62900017|sp|Q8FLC5|DNAJ_ECOL6 RecName: Full=Chaperone protein dnaJ
 gi|62900031|sp|Q8XA65|DNAJ_ECO57 RecName: Full=Chaperone protein dnaJ
 gi|122425085|sp|Q1RGI7|DNAJ_ECOUT RecName: Full=Chaperone protein dnaJ
 gi|123618128|sp|Q3Z600|DNAJ_SHISS RecName: Full=Chaperone protein dnaJ
 gi|189083319|sp|A7ZHA5|DNAJ_ECO24 RecName: Full=Chaperone protein dnaJ
 gi|189083320|sp|A7ZVV8|DNAJ_ECOHS RecName: Full=Chaperone protein dnaJ
 gi|189083321|sp|B1IRF9|DNAJ_ECOLC RecName: Full=Chaperone protein dnaJ
 gi|226735562|sp|B7MAD6|DNAJ_ECO45 RecName: Full=Chaperone protein dnaJ
 gi|226735564|sp|B7NHB7|DNAJ_ECO7I RecName: Full=Chaperone protein dnaJ
 gi|226735565|sp|B7M0B1|DNAJ_ECO8A RecName: Full=Chaperone protein dnaJ
 gi|226735567|sp|B7N7N9|DNAJ_ECOLU RecName: Full=Chaperone protein dnaJ
 gi|226735568|sp|B6HZ11|DNAJ_ECOSE RecName: Full=Chaperone protein dnaJ
 gi|226735569|sp|B1LFU5|DNAJ_ECOSM RecName: Full=Chaperone protein dnaJ
 gi|226735571|sp|B7LVP7|DNAJ_ESCF3 RecName: Full=Chaperone protein dnaJ
 gi|254777956|sp|B7UI60|DNAJ_ECO27 RecName: Full=Chaperone protein dnaJ
 gi|254777957|sp|B7L4D9|DNAJ_ECO55 RecName: Full=Chaperone protein dnaJ
 gi|254777958|sp|B7MNM2|DNAJ_ECO81 RecName: Full=Chaperone protein dnaJ
 gi|12512693|gb|AAG54315.1|AE005178_5 chaperone with DnaK; heat shock protein [Escherichia coli O157:H7
           str. EDL933]
 gi|26106334|gb|AAN78520.1|AE016755_20 Chaperone protein dnaJ [Escherichia coli CFT073]
 gi|13359471|dbj|BAB33438.1| DnaJ protein [Escherichia coli O157:H7 str. Sakai]
 gi|73854105|gb|AAZ86812.1| chaperone with DnaK [Shigella sonnei Ss046]
 gi|91070646|gb|ABE05527.1| chaperone with DnaK; heat shock protein [Escherichia coli UTI89]
 gi|157065162|gb|ABV04417.1| chaperone protein DnaJ [Escherichia coli HS]
 gi|157078462|gb|ABV18170.1| chaperone protein DnaJ [Escherichia coli E24377A]
 gi|169756553|gb|ACA79252.1| chaperone protein DnaJ [Escherichia coli ATCC 8739]
 gi|170521591|gb|ACB19769.1| chaperone protein DnaJ [Escherichia coli SMS-3-5]
 gi|188490915|gb|EDU66018.1| chaperone protein DnaJ [Escherichia coli 53638]
 gi|189366928|gb|EDU85344.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4501]
 gi|189374927|gb|EDU93343.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC869]
 gi|189379547|gb|EDU97963.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC508]
 gi|190902540|gb|EDV62274.1| chaperone protein DnaJ [Escherichia coli B7A]
 gi|190905109|gb|EDV64758.1| chaperone protein DnaJ [Escherichia coli F11]
 gi|192926710|gb|EDV81338.1| chaperone protein DnaJ [Escherichia coli E22]
 gi|192956076|gb|EDV86541.1| chaperone protein DnaJ [Escherichia coli E110019]
 gi|209747184|gb|ACI71899.1| DnaJ protein [Escherichia coli]
 gi|209747186|gb|ACI71900.1| DnaJ protein [Escherichia coli]
 gi|209747188|gb|ACI71901.1| DnaJ protein [Escherichia coli]
 gi|209747190|gb|ACI71902.1| DnaJ protein [Escherichia coli]
 gi|209910464|dbj|BAG75538.1| chaperone protein DnaJ [Escherichia coli SE11]
 gi|215263248|emb|CAS07563.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli O127:H6
           str. E2348/69]
 gi|217321564|gb|EEC29988.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. TW14588]
 gi|218350222|emb|CAU95903.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli 55989]
 gi|218354993|emb|CAQ87599.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia fergusonii
           ATCC 35469]
 gi|218359367|emb|CAQ96906.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli IAI1]
 gi|218363722|emb|CAR01382.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli S88]
 gi|218368419|emb|CAR16155.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli IAI39]
 gi|218425455|emb|CAR06237.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli ED1a]
 gi|218430372|emb|CAR11239.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli UMN026]
 gi|222031847|emb|CAP74585.1| chaperone protein dnaJ [Escherichia coli LF82]
 gi|227837919|gb|EEJ48385.1| chaperone protein DnaJ [Escherichia coli 83972]
 gi|257751876|dbj|BAI23378.1| chaperone Hsp40 [Escherichia coli O26:H11 str. 11368]
 gi|257757401|dbj|BAI28898.1| chaperone Hsp40 [Escherichia coli O103:H2 str. 12009]
 gi|281177225|dbj|BAI53555.1| chaperone protein DnaJ [Escherichia coli SE15]
 gi|284919794|emb|CBG32849.1| chaperone protein DnaJ (heat shock protein J) [Escherichia coli
           042]
 gi|290760710|gb|ADD54671.1| Chaperone protein DnaJ [Escherichia coli O55:H7 str. CB9615]
 gi|291321132|gb|EFE60574.1| chaperone DnaJ [Escherichia coli B088]
 gi|291430002|gb|EFF03016.1| chaperone DnaJ [Escherichia coli FVEC1412]
 gi|291430608|gb|EFF03606.1| chaperone DnaJ [Escherichia coli B185]
 gi|291472357|gb|EFF14839.1| chaperone DnaJ [Escherichia coli B354]
 gi|294491995|gb|ADE90751.1| chaperone protein DnaJ [Escherichia coli IHE3034]
 gi|298280948|gb|EFI22449.1| chaperone DnaJ [Escherichia coli FVEC1302]
 gi|300299773|gb|EFJ56158.1| chaperone protein DnaJ [Escherichia coli MS 185-1]
 gi|300306783|gb|EFJ61303.1| chaperone protein DnaJ [Escherichia coli MS 200-1]
 gi|300359394|gb|EFJ75264.1| chaperone protein DnaJ [Escherichia coli MS 198-1]
 gi|300399056|gb|EFJ82594.1| chaperone protein DnaJ [Escherichia coli MS 69-1]
 gi|300402742|gb|EFJ86280.1| chaperone protein DnaJ [Escherichia coli MS 84-1]
 gi|300409103|gb|EFJ92641.1| chaperone protein DnaJ [Escherichia coli MS 45-1]
 gi|300419721|gb|EFK03032.1| chaperone protein DnaJ [Escherichia coli MS 182-1]
 gi|300525586|gb|EFK46655.1| chaperone protein DnaJ [Escherichia coli MS 119-7]
 gi|300531253|gb|EFK52315.1| chaperone protein DnaJ [Escherichia coli MS 107-1]
 gi|300841252|gb|EFK69012.1| chaperone protein DnaJ [Escherichia coli MS 124-1]
 gi|305851049|gb|EFM51504.1| chaperone protein DnaJ [Escherichia coli NC101]
 gi|306908509|gb|EFN39007.1| chaperone protein DnaJ [Escherichia coli W]
 gi|307551858|gb|ADN44633.1| chaperone protein DnaJ [Escherichia coli ABU 83972]
 gi|307629587|gb|ADN73891.1| chaperone protein DnaJ [Escherichia coli UM146]
 gi|308118608|gb|EFO55870.1| chaperone protein DnaJ [Escherichia coli MS 145-7]
 gi|312289380|gb|EFR17274.1| chaperone protein DnaJ [Escherichia coli 2362-75]
 gi|312944620|gb|ADR25447.1| chaperone protein DnaJ [Escherichia coli O83:H1 str. NRG 857C]
 gi|315059241|gb|ADT73568.1| chaperone HSP40, co-chaperone with DnaK [Escherichia coli W]
 gi|315255718|gb|EFU35686.1| chaperone protein DnaJ [Escherichia coli MS 85-1]
 gi|315284987|gb|EFU44432.1| chaperone protein DnaJ [Escherichia coli MS 110-3]
 gi|315293345|gb|EFU52697.1| chaperone protein DnaJ [Escherichia coli MS 153-1]
 gi|315298384|gb|EFU57639.1| chaperone protein DnaJ [Escherichia coli MS 16-3]
 gi|320190466|gb|EFW65116.1| Chaperone protein DnaJ [Escherichia coli O157:H7 str. EC1212]
 gi|320200466|gb|EFW75052.1| Chaperone protein DnaJ [Escherichia coli EC4100B]
 gi|320642054|gb|EFX11405.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. G5101]
 gi|320647416|gb|EFX16211.1| chaperone protein DnaJ [Escherichia coli O157:H- str. 493-89]
 gi|320652750|gb|EFX20988.1| chaperone protein DnaJ [Escherichia coli O157:H- str. H 2687]
 gi|320658140|gb|EFX25869.1| chaperone protein DnaJ [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320663449|gb|EFX30733.1| chaperone protein DnaJ [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668761|gb|EFX35556.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. LSU-61]
 gi|323163238|gb|EFZ49070.1| chaperone protein DnaJ [Escherichia coli E128010]
 gi|323166054|gb|EFZ51833.1| chaperone protein DnaJ [Shigella sonnei 53G]
 gi|323171434|gb|EFZ57081.1| chaperone protein DnaJ [Escherichia coli LT-68]
 gi|323181711|gb|EFZ67124.1| chaperone protein DnaJ [Escherichia coli 1357]
 gi|323190303|gb|EFZ75579.1| chaperone protein DnaJ [Escherichia coli RN587/1]
 gi|323380200|gb|ADX52468.1| chaperone protein DnaJ [Escherichia coli KO11]
 gi|323945754|gb|EGB41801.1| chaperone DnaJ [Escherichia coli H120]
 gi|323950496|gb|EGB46374.1| chaperone DnaJ [Escherichia coli H252]
 gi|323955210|gb|EGB50983.1| chaperone DnaJ [Escherichia coli H263]
 gi|323964895|gb|EGB60362.1| chaperone DnaJ [Escherichia coli M863]
 gi|323975824|gb|EGB70920.1| chaperone DnaJ [Escherichia coli TW10509]
 gi|324007737|gb|EGB76956.1| chaperone protein DnaJ [Escherichia coli MS 57-2]
 gi|324012371|gb|EGB81590.1| chaperone protein DnaJ [Escherichia coli MS 60-1]
 gi|324019831|gb|EGB89050.1| chaperone protein DnaJ [Escherichia coli MS 117-3]
 gi|324112593|gb|EGC06570.1| chaperone DnaJ [Escherichia fergusonii B253]
 gi|324118368|gb|EGC12262.1| chaperone DnaJ [Escherichia coli E1167]
 gi|326345269|gb|EGD69012.1| Chaperone protein DnaJ [Escherichia coli O157:H7 str. 1125]
 gi|326346877|gb|EGD70611.1| Chaperone protein DnaJ [Escherichia coli O157:H7 str. 1044]
 gi|327254981|gb|EGE66584.1| chaperone protein DnaJ [Escherichia coli STEC_7v]
 gi|330909861|gb|EGH38371.1| chaperone protein DnaJ [Escherichia coli AA86]
 gi|331052094|gb|EGI24133.1| chaperone protein DnaJ [Escherichia coli TA206]
 gi|331066459|gb|EGI38336.1| chaperone protein DnaJ [Escherichia coli TA271]
 gi|331081622|gb|EGI52783.1| chaperone protein DnaJ [Escherichia coli H299]
 gi|332341345|gb|AEE54679.1| chaperone protein DnaJ [Escherichia coli UMNK88]
          Length = 376

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|300947459|ref|ZP_07161644.1| chaperone protein DnaJ [Escherichia coli MS 116-1]
 gi|300955618|ref|ZP_07167974.1| chaperone protein DnaJ [Escherichia coli MS 175-1]
 gi|300317486|gb|EFJ67270.1| chaperone protein DnaJ [Escherichia coli MS 175-1]
 gi|300452930|gb|EFK16550.1| chaperone protein DnaJ [Escherichia coli MS 116-1]
          Length = 376

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDQEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|300919563|ref|ZP_07136056.1| chaperone protein DnaJ [Escherichia coli MS 115-1]
 gi|300413381|gb|EFJ96691.1| chaperone protein DnaJ [Escherichia coli MS 115-1]
          Length = 376

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGC- 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|168750942|ref|ZP_02775964.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4113]
 gi|168756840|ref|ZP_02781847.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4401]
 gi|168766704|ref|ZP_02791711.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4486]
 gi|168776600|ref|ZP_02801607.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4196]
 gi|168781712|ref|ZP_02806719.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4076]
 gi|195937687|ref|ZP_03083069.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4024]
 gi|208808054|ref|ZP_03250391.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4206]
 gi|208813303|ref|ZP_03254632.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4045]
 gi|208821075|ref|ZP_03261395.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4042]
 gi|209399638|ref|YP_002268622.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4115]
 gi|254791151|ref|YP_003075988.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. TW14359]
 gi|226735563|sp|B5YYA8|DNAJ_ECO5E RecName: Full=Chaperone protein dnaJ
 gi|187767979|gb|EDU31823.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4196]
 gi|188014895|gb|EDU53017.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4113]
 gi|189000733|gb|EDU69719.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4076]
 gi|189356057|gb|EDU74476.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4401]
 gi|189364259|gb|EDU82678.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4486]
 gi|208727855|gb|EDZ77456.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4206]
 gi|208734580|gb|EDZ83267.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4045]
 gi|208741198|gb|EDZ88880.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4042]
 gi|209161038|gb|ACI38471.1| chaperone protein DnaJ [Escherichia coli O157:H7 str. EC4115]
 gi|209747192|gb|ACI71903.1| DnaJ protein [Escherichia coli]
 gi|254590551|gb|ACT69912.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli O157:H7
           str. TW14359]
          Length = 376

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAETKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|238782689|ref|ZP_04626719.1| hypothetical protein yberc0001_9760 [Yersinia bercovieri ATCC
           43970]
 gi|238797511|ref|ZP_04641009.1| hypothetical protein ymoll0001_7240 [Yersinia mollaretii ATCC
           43969]
 gi|238716349|gb|EEQ08331.1| hypothetical protein yberc0001_9760 [Yersinia bercovieri ATCC
           43970]
 gi|238718652|gb|EEQ10470.1| hypothetical protein ymoll0001_7240 [Yersinia mollaretii ATCC
           43969]
          Length = 377

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 259/386 (67%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVQKNADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G      G  G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----FGGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C+ C G+G+V
Sbjct: 115 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLNECDVCHGSGAKPGSSPVTCSTCRGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++AC TC G+GQII  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 HMR-QGFFTVQQACPTCHGNGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLT 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 290 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVHLSEKQKQLLRELEESF 349

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 350 VGAAGEKNSPRSKSFLDGVKKFFDDL 375


>gi|331640463|ref|ZP_08341611.1| chaperone protein DnaJ [Escherichia coli H736]
 gi|331650904|ref|ZP_08351932.1| chaperone protein DnaJ [Escherichia coli M718]
 gi|331040209|gb|EGI12416.1| chaperone protein DnaJ [Escherichia coli H736]
 gi|331051358|gb|EGI23407.1| chaperone protein DnaJ [Escherichia coli M718]
          Length = 386

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 11  MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 70

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 71  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 123

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 124 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 181 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 240 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 299 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 359 GGPTGEHNSPRSKSFFDGVKKFFDDL 384


>gi|238899420|ref|YP_002925216.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli BW2952]
 gi|259534084|sp|C4ZPU1|DNAJ_ECOBW RecName: Full=Chaperone protein dnaJ
 gi|238860138|gb|ACR62136.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli BW2952]
          Length = 376

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MVKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQ++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|261338981|ref|ZP_05966839.1| hypothetical protein ENTCAN_05185 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318811|gb|EFC57749.1| chaperone protein DnaJ [Enterobacter cancerogenus ATCC 35316]
          Length = 382

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKLDYYEILGVPKTAEEREIKKAYKRLAMKYHPDRNQGDKEAESKFKEIKEAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGAGGFGGGADFSDIFGDVFGDIFGGGRGRQRAAR- 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 120 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 177 -QMRQGFFAVQQACPHCHGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLS 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 236 GEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL+E ++  
Sbjct: 295 VNLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKELQESF 354

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + ++N+P+S  FF  +K FFD L
Sbjct: 355 GGPTGENNSPRSKSFFDGVKKFFDDL 380


>gi|309700227|emb|CBI99515.1| chaperone protein DnaJ (heat shock protein J) [Escherichia coli
           ETEC H10407]
          Length = 376

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEVKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|238764636|ref|ZP_04625581.1| hypothetical protein ykris0001_12310 [Yersinia kristensenii ATCC
           33638]
 gi|238697128|gb|EEP89900.1| hypothetical protein ykris0001_12310 [Yersinia kristensenii ATCC
           33638]
          Length = 376

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 259/386 (67%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVTKGADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G    G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C+ C G+G+V
Sbjct: 114 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLNECDVCHGSGAKPGSSPVTCSTCRGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++AC TC GSGQII  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 171 HMR-QGFFTVQQACPTCHGSGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLN 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVHLSEKQKQLLRELEESF 348

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 349 VGAAGEKNSPRSKSFLDGVKKFFDDL 374


>gi|83313540|ref|YP_423804.1| chaperone protein DnaJ [Magnetospirillum magneticum AMB-1]
 gi|123540317|sp|Q2VYT0|DNAJ_MAGMM RecName: Full=Chaperone protein dnaJ
 gi|82948381|dbj|BAE53245.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Magnetospirillum magneticum AMB-1]
          Length = 383

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 267/386 (69%), Gaps = 8/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+++ A+   +K A+R  AM++HPD+N  + +A++KF +I+EAY+VL+D 
Sbjct: 1   MSKQDYYELLGVEKGASPDDIKKAYRKQAMQFHPDRNPGNADAEQKFKEINEAYDVLKDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G GG   G  G    S++F+ +FG  MG G    +S+  
Sbjct: 61  QKRAAYDRFGHAAFEQGGPGGGGGGGFGGFGGGGF-SDIFDEMFGEFMGGGGRRGQSTGR 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G   ADLRYN++ISLE+AF+GKT  ++ P++  C  C G+G K G  P+ C+ C+G G+V
Sbjct: 120 G---ADLRYNMDISLEDAFAGKTATVKVPSSAPCEDCKGTGGKDGAQPVTCSACHGHGKV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+IER C TC+G G+II  PC  C G GR  +EK L VN+P GV+DGTRIRL+
Sbjct: 177 RQQ-QGFFTIERTCPTCQGMGKIIKDPCRSCGGSGRTRKEKTLQVNIPAGVEDGTRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ G   GDLYIF+S+  H+ F+RDGA+++C VPI + T A+GGT +V T+D + 
Sbjct: 236 GEGEAGMRGAPAGDLYIFLSIAAHRIFQRDGANIFCRVPIPMTTAALGGTIEVPTIDGSK 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++VTIPEGTQTG QFRL+ KGM V+ S  +GD+++Q  VETP  L KRQ+ELL EF +  
Sbjct: 296 AKVTIPEGTQTGNQFRLRSKGMSVLRSPARGDMFIQAVVETPVNLTKRQKELLNEFNEAG 355

Query: 361 SQD---NNPQSTGFFARMKDFFDSLK 383
             +   N+P+S GFFA++K+ ++ LK
Sbjct: 356 EGEKAKNSPESQGFFAKVKELWEDLK 381


>gi|30061585|ref|NP_835756.1| chaperone protein DnaJ [Shigella flexneri 2a str. 2457T]
 gi|110804086|ref|YP_687606.1| chaperone protein DnaJ [Shigella flexneri 5 str. 8401]
 gi|256025335|ref|ZP_05439200.1| chaperone protein DnaJ [Escherichia sp. 4_1_40B]
 gi|301024704|ref|ZP_07188348.1| chaperone protein DnaJ [Escherichia coli MS 196-1]
 gi|301330224|ref|ZP_07222884.1| chaperone protein DnaJ [Escherichia coli MS 78-1]
 gi|301646943|ref|ZP_07246787.1| chaperone protein DnaJ [Escherichia coli MS 146-1]
 gi|307136615|ref|ZP_07495971.1| chaperone protein DnaJ [Escherichia coli H736]
 gi|123343189|sp|Q0T8H5|DNAJ_SHIF8 RecName: Full=Chaperone protein dnaJ
 gi|30039827|gb|AAP15561.1| chaperone with DnaK; heat shock protein [Shigella flexneri 2a str.
           2457T]
 gi|110613634|gb|ABF02301.1| chaperone with DnaK [Shigella flexneri 5 str. 8401]
 gi|281599378|gb|ADA72362.1| Chaperone with DnaK [Shigella flexneri 2002017]
 gi|299880300|gb|EFI88511.1| chaperone protein DnaJ [Escherichia coli MS 196-1]
 gi|300843786|gb|EFK71546.1| chaperone protein DnaJ [Escherichia coli MS 78-1]
 gi|301074891|gb|EFK89697.1| chaperone protein DnaJ [Escherichia coli MS 146-1]
 gi|313646608|gb|EFS11069.1| chaperone protein DnaJ [Shigella flexneri 2a str. 2457T]
 gi|315616211|gb|EFU96830.1| chaperone protein DnaJ [Escherichia coli 3431]
 gi|323939767|gb|EGB35969.1| chaperone DnaJ [Escherichia coli E482]
 gi|332762367|gb|EGJ92634.1| chaperone protein DnaJ [Shigella flexneri 2747-71]
 gi|332762576|gb|EGJ92841.1| chaperone protein DnaJ [Shigella flexneri 4343-70]
 gi|332764859|gb|EGJ95087.1| chaperone protein DnaJ [Shigella flexneri K-671]
 gi|332768805|gb|EGJ98984.1| chaperone protein DnaJ [Shigella flexneri 2930-71]
 gi|333009464|gb|EGK28920.1| chaperone protein DnaJ [Shigella flexneri K-218]
 gi|333010509|gb|EGK29942.1| chaperone protein DnaJ [Shigella flexneri VA-6]
 gi|333011400|gb|EGK30814.1| chaperone protein DnaJ [Shigella flexneri K-272]
 gi|333021638|gb|EGK40887.1| chaperone protein DnaJ [Shigella flexneri K-227]
 gi|333022476|gb|EGK41714.1| chaperone protein DnaJ [Shigella flexneri K-304]
          Length = 376

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 256/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|212709121|ref|ZP_03317249.1| hypothetical protein PROVALCAL_00154 [Providencia alcalifaciens DSM
           30120]
 gi|212688033|gb|EEB47561.1| hypothetical protein PROVALCAL_00154 [Providencia alcalifaciens DSM
           30120]
          Length = 385

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 258/390 (66%), Gaps = 12/390 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP-EAKEKFAQISEAYEVLRD 59
           M K DFY+VLG+++NA+D+ +K A++ LAMK+HPD+N+    EA+EKF +I EAYEVL D
Sbjct: 1   MAKRDFYEVLGLEKNASDKDIKRAYKRLAMKHHPDRNQEKKDEAEEKFKEIKEAYEVLSD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF-SELFEGIFGGIMGSGRSYKRSS 118
            QKRA YDQ GH A E G    G GG G G +G  DF S++F  IFG I G GR  +R S
Sbjct: 61  EQKRAAYDQYGHAAFEQGGMGGGGGGGGFGGFGGGDFNSDIFGDIFGDIFGGGRRQQRPS 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G+DL+YN+E++LEEA  G T +IR PT   C  C GSGAKPGT+   C  C+G G
Sbjct: 121 R----GSDLQYNMELTLEEAVRGVTKEIRIPTLESCDVCHGSGAKPGTSAETCQTCHGMG 176

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V+   Q FFS+++AC TC G G+II  PC+KCHGQGRV + K LSV +P GVD G R+R
Sbjct: 177 QVHMR-QGFFSVQQACPTCHGRGKIIKDPCNKCHGQGRVEKYKTLSVKIPAGVDTGDRVR 235

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG  G   GDL++ + V  H  F+RDG +L+C VPI+  T A+GG  +V TLD 
Sbjct: 236 LSGEGEAGANGAPAGDLFVQMHVLPHDIFERDGNNLHCEVPINFATAALGGEIEVPTLDG 295

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF-- 356
              ++ IP  TQTGK FR+KGKG+  +  G +GDL   + VETP KLN++Q+ELL EF  
Sbjct: 296 -RVKLKIPAETQTGKTFRMKGKGVKSVRGGMQGDLMCHIVVETPVKLNEKQKELLREFGE 354

Query: 357 --EQISSQDNNPQSTGFFARMKDFFDSLKN 384
                  + N+P+S  F   +K FFD L N
Sbjct: 355 SLGGSGGEKNSPRSKRFLDGVKKFFDDLTN 384


>gi|85058388|ref|YP_454090.1| chaperone protein DnaJ [Sodalis glossinidius str. 'morsitans']
 gi|123520111|sp|Q2NVZ0|DNAJ_SODGM RecName: Full=Chaperone protein dnaJ
 gi|84778908|dbj|BAE73685.1| chaperone protein DnaJ [Sodalis glossinidius str. 'morsitans']
          Length = 374

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 252/386 (65%), Gaps = 18/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ R+A +R++K A++  AMK+HPD+NR + EA+ KF +I EAYEVL D 
Sbjct: 1   MAKSDYYEILGVSRDAEEREIKKAYKRQAMKFHPDRNRGNAEAEAKFKEIKEAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G           G    +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMG-------GGGASGADFSDIFGDVFGDIFGGGRRQRVSR-- 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G T +IR PT  +C  C GSGAKPGT+ + C  C+G G+V
Sbjct: 112 ---GADLRYNMELSLEEAVRGVTREIRIPTLEECDVCHGSGAKPGTSAVTCPTCHGQGQV 168

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF+I++ C TC+G G+II  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 169 -QMRQGFFAIQQTCPTCQGQGKIIKDPCTKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 227

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G +G A GDLY+ + V KH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 228 GEGEVGEHGAAAGDLYVQVQVCKHPIFEREENNLYCEVPINFAMAALGGEIEVPTLDG-R 286

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP KLN+RQ++LL E E+  
Sbjct: 287 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVKLNERQKQLLRELEESF 346

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S   N+P+S  F   +K FFD L
Sbjct: 347 GGPSGDQNSPRSKSFLDGVKKFFDDL 372


>gi|238795016|ref|ZP_04638611.1| hypothetical protein yinte0001_31730 [Yersinia intermedia ATCC
           29909]
 gi|238725667|gb|EEQ17226.1| hypothetical protein yinte0001_31730 [Yersinia intermedia ATCC
           29909]
          Length = 377

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 259/386 (67%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVKKDADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G      G  G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----FGGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C+ C G+G+V
Sbjct: 115 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLNECDVCHGSGAKPGSSPVTCSTCRGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++AC TC G+GQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 172 HMR-QGFFTVQQACPTCHGNGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 290 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVHLSEKQKQLLRELEESF 349

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 350 VGAAGEKNSPRSKSFLDGVKKFFDDL 375


>gi|149926207|ref|ZP_01914469.1| molecular chaperone [Limnobacter sp. MED105]
 gi|149825025|gb|EDM84237.1| molecular chaperone [Limnobacter sp. MED105]
          Length = 375

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/383 (50%), Positives = 252/383 (65%), Gaps = 13/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG+ +NATD +LK A+R +AMKYHPD+N +  +A+ KF +  EAYE+L DP
Sbjct: 1   MAKRDFYEILGVQKNATDDELKKAYRKMAMKYHPDRNPDSKDAEAKFKEAKEAYEMLTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRS-SS 119
           +KRA YD+ GH  ++      GAGGF       SDFS+ F  IFG I G       S  S
Sbjct: 61  KKRAAYDRHGHAGVDPNMGGGGAGGF-------SDFSDAFGDIFGDIFGGRAGGGGSRQS 113

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G+DL+YN+EI+LE+A  G   QIR P    C TCSGSGAKPGT P  C+ C GSG 
Sbjct: 114 QMYRGSDLKYNMEITLEQAAKGFDTQIRVPVWDNCGTCSGSGAKPGTKPETCSTCGGSGA 173

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V  T Q FFS+++ C  C G+G++IPHPC  C G GR    K L V VP G+DDG RIRL
Sbjct: 174 VRMT-QGFFSVQQTCPKCHGTGKMIPHPCHDCEGLGRKKTNKTLEVKVPAGIDDGMRIRL 232

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SG+G  GV GG  GDLY+ + +K+H  F+RDG DL+C +P+S    A+GGT +V TL   
Sbjct: 233 SGKGEPGVNGGPAGDLYVEVHLKEHAVFQRDGDDLHCEMPVSFAAAALGGTIEVPTLGGK 292

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            S   IPEGTQTGK FRL+GKG+  + S   GDL+  + VETP +L++RQ+ELL+EFEQ 
Sbjct: 293 AS-FDIPEGTQTGKTFRLRGKGIKGVRSSYPGDLFCHIVVETPVRLSERQKELLKEFEQS 351

Query: 360 SSQD---NNPQSTGFFARMKDFF 379
            + D   ++P++ G+  ++KDFF
Sbjct: 352 CTADGDKHSPRAKGWMDKVKDFF 374


>gi|304396516|ref|ZP_07378397.1| chaperone protein DnaJ [Pantoea sp. aB]
 gi|304356025|gb|EFM20391.1| chaperone protein DnaJ [Pantoea sp. aB]
          Length = 381

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 253/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ ++A +R++K A++ LAMK+HPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKSDYYEILGVAKSADEREIKKAYKRLAMKFHPDRNPGDKEAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G    G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G T +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 119 ---GADLRYNMELSLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCSTCHGAGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 176 QMR-QGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ +SVKKH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 235 GEGEAGEQGAPAGDLYVQVSVKKHPIFEREENNLYCEVPINFAMAALGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++G+G+  +  G  GDL  +V VETP  LN++Q+ LL E E+  
Sbjct: 294 VKLKVPSETQTGKLFRMRGRGVKSVRGGAVGDLLCRVVVETPVSLNEKQKTLLRELEESF 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 354 GGPSGEHNSPRSKSFFDGVKKFFDDL 379


>gi|15599954|ref|NP_253448.1| chaperone protein DnaJ [Pseudomonas aeruginosa PAO1]
 gi|107103857|ref|ZP_01367775.1| hypothetical protein PaerPA_01004928 [Pseudomonas aeruginosa PACS2]
 gi|116052907|ref|YP_793224.1| chaperone protein DnaJ [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893855|ref|YP_002442724.1| DnaJ protein [Pseudomonas aeruginosa LESB58]
 gi|254238505|ref|ZP_04931828.1| DnaJ protein [Pseudomonas aeruginosa C3719]
 gi|254244339|ref|ZP_04937661.1| DnaJ protein [Pseudomonas aeruginosa 2192]
 gi|296391587|ref|ZP_06881062.1| chaperone protein DnaJ [Pseudomonas aeruginosa PAb1]
 gi|313109741|ref|ZP_07795681.1| chaperone protein DnaJ [Pseudomonas aeruginosa 39016]
 gi|14916557|sp|Q9HV44|DNAJ_PSEAE RecName: Full=Chaperone protein dnaJ
 gi|122257082|sp|Q02FR2|DNAJ_PSEAB RecName: Full=Chaperone protein dnaJ
 gi|226735589|sp|B7V1H2|DNAJ_PSEA8 RecName: Full=Chaperone protein dnaJ
 gi|9951023|gb|AAG08146.1|AE004889_9 DnaJ protein [Pseudomonas aeruginosa PAO1]
 gi|115588128|gb|ABJ14143.1| chaperone protein DnaJ [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170436|gb|EAZ55947.1| DnaJ protein [Pseudomonas aeruginosa C3719]
 gi|126197717|gb|EAZ61780.1| DnaJ protein [Pseudomonas aeruginosa 2192]
 gi|218774083|emb|CAW29899.1| DnaJ protein [Pseudomonas aeruginosa LESB58]
 gi|310882183|gb|EFQ40777.1| chaperone protein DnaJ [Pseudomonas aeruginosa 39016]
          Length = 377

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/384 (50%), Positives = 250/384 (65%), Gaps = 9/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG++R A++  LK A+R LAMKYHPD+N  D EA++KF + +EAYEVL D 
Sbjct: 1   MAKRDFYEVLGVERGASEADLKKAYRRLAMKYHPDRNPGDKEAEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++               +G + FS++F  +F    G G +   S   
Sbjct: 61  SKRAAYDQYGHAGVDPNMGGGAGA-----GFGGASFSDIFGDVFSDFFGGGGARGGSRGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRY L++ LEEA  G TV IR PT V C TC+GSGAKPGT P+ C  C G G+V
Sbjct: 116 AQRGADLRYTLDLDLEEAVRGTTVTIRVPTLVGCKTCNGSGAKPGTTPVTCTTCGGIGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G+G++I  PC  CHGQGRV E+K LSV VP GVD G RIRL+
Sbjct: 176 -RMQQGFFSVQQTCPRCHGTGKMISDPCGSCHGQGRVEEQKTLSVKVPAGVDTGDRIRLT 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ ++V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 235 GEGEAGSMGGPAGDLYVVVNVREHPIFQRDGKHLYCEVPISFADAALGGELEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPE TQTGK FRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF +  
Sbjct: 294 VKLKIPESTQTGKLFRLRGKGVAPVRGGGAGDLMCKVVVETPVNLDKRQRELLEEFRKSL 353

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  MK FFD L
Sbjct: 354 QSDTSHSPKASGWFEGMKRFFDDL 377


>gi|153950863|ref|YP_001402420.1| chaperone protein DnaJ [Yersinia pseudotuberculosis IP 31758]
 gi|189027791|sp|A7FME2|DNAJ_YERP3 RecName: Full=Chaperone protein dnaJ
 gi|152962358|gb|ABS49819.1| chaperone protein DnaJ [Yersinia pseudotuberculosis IP 31758]
          Length = 379

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 256/386 (66%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A +R++K A++ LAMK+HPD+   D  A+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRKSEDKNAEEKFKEAKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GG   G  G +DFS++F  +FG I G GR  +R+S  
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGGFGGGGGGADFSDIFGDVFGDIFGGGRRQQRASR- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G+G+V
Sbjct: 117 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVTCPTCHGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 174 -QMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 292 VKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESF 351

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P++  F   +K FFD L
Sbjct: 352 VGAAGEKNSPRAKSFLDGVKKFFDDL 377


>gi|22127579|ref|NP_671002.1| chaperone protein DnaJ [Yersinia pestis KIM 10]
 gi|45443443|ref|NP_994982.1| chaperone protein DnaJ [Yersinia pestis biovar Microtus str. 91001]
 gi|51594963|ref|YP_069154.1| chaperone protein DnaJ [Yersinia pseudotuberculosis IP 32953]
 gi|108810053|ref|YP_653969.1| chaperone protein DnaJ [Yersinia pestis Antiqua]
 gi|108810507|ref|YP_646274.1| chaperone protein DnaJ [Yersinia pestis Nepal516]
 gi|145600417|ref|YP_001164493.1| chaperone protein DnaJ [Yersinia pestis Pestoides F]
 gi|150260495|ref|ZP_01917223.1| chaperone protein DnaJ [Yersinia pestis CA88-4125]
 gi|162418501|ref|YP_001605371.1| chaperone protein DnaJ [Yersinia pestis Angola]
 gi|165927315|ref|ZP_02223147.1| chaperone protein DnaJ [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936576|ref|ZP_02225144.1| chaperone protein DnaJ [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009061|ref|ZP_02229959.1| chaperone protein DnaJ [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212081|ref|ZP_02238116.1| chaperone protein DnaJ [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401548|ref|ZP_02307042.1| chaperone protein DnaJ [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419240|ref|ZP_02310993.1| chaperone protein DnaJ [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426033|ref|ZP_02317786.1| chaperone protein DnaJ [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170025808|ref|YP_001722313.1| chaperone protein DnaJ [Yersinia pseudotuberculosis YPIII]
 gi|186893965|ref|YP_001871077.1| chaperone protein DnaJ [Yersinia pseudotuberculosis PB1/+]
 gi|218927666|ref|YP_002345541.1| chaperone protein DnaJ [Yersinia pestis CO92]
 gi|229836948|ref|ZP_04457113.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis Pestoides
           A]
 gi|229840356|ref|ZP_04460515.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842436|ref|ZP_04462591.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900696|ref|ZP_04515820.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis Nepal516]
 gi|270487936|ref|ZP_06205010.1| chaperone protein DnaJ [Yersinia pestis KIM D27]
 gi|294502566|ref|YP_003566628.1| chaperone protein DnaJ [Yersinia pestis Z176003]
 gi|62900194|sp|Q66ES9|DNAJ_YERPS RecName: Full=Chaperone protein dnaJ
 gi|62900319|sp|Q8ZIM6|DNAJ_YERPE RecName: Full=Chaperone protein dnaJ
 gi|122980349|sp|Q1CMV6|DNAJ_YERPN RecName: Full=Chaperone protein dnaJ
 gi|123371959|sp|Q1C0J8|DNAJ_YERPA RecName: Full=Chaperone protein dnaJ
 gi|189027792|sp|A4TQF8|DNAJ_YERPP RecName: Full=Chaperone protein dnaJ
 gi|226738070|sp|B2K3M1|DNAJ_YERPB RecName: Full=Chaperone protein dnaJ
 gi|226738071|sp|A9R014|DNAJ_YERPG RecName: Full=Chaperone protein dnaJ
 gi|226738072|sp|B1JL03|DNAJ_YERPY RecName: Full=Chaperone protein dnaJ
 gi|21960686|gb|AAM87253.1|AE013974_1 chaperone with DnaK; heat shock protein [Yersinia pestis KIM 10]
 gi|45438312|gb|AAS63859.1| chaperone protein DnaJ [Yersinia pestis biovar Microtus str. 91001]
 gi|51588245|emb|CAH19852.1| heat shock protein, DnaJ and GrpE stimulates ATPase activity of
           DnaK [Yersinia pseudotuberculosis IP 32953]
 gi|108774155|gb|ABG16674.1| chaperone protein DnaJ [Yersinia pestis Nepal516]
 gi|108781966|gb|ABG16024.1| chaperone protein DnaJ [Yersinia pestis Antiqua]
 gi|115346277|emb|CAL19148.1| chaperone protein DnaJ [Yersinia pestis CO92]
 gi|145212113|gb|ABP41520.1| chaperone protein DnaJ [Yersinia pestis Pestoides F]
 gi|149289903|gb|EDM39980.1| chaperone protein DnaJ [Yersinia pestis CA88-4125]
 gi|162351316|gb|ABX85264.1| chaperone protein DnaJ [Yersinia pestis Angola]
 gi|165915692|gb|EDR34301.1| chaperone protein DnaJ [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920777|gb|EDR38025.1| chaperone protein DnaJ [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992400|gb|EDR44701.1| chaperone protein DnaJ [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206827|gb|EDR51307.1| chaperone protein DnaJ [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963234|gb|EDR59255.1| chaperone protein DnaJ [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048930|gb|EDR60338.1| chaperone protein DnaJ [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054956|gb|EDR64756.1| chaperone protein DnaJ [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752342|gb|ACA69860.1| chaperone protein DnaJ [Yersinia pseudotuberculosis YPIII]
 gi|186696991|gb|ACC87620.1| chaperone protein DnaJ [Yersinia pseudotuberculosis PB1/+]
 gi|229682035|gb|EEO78127.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis Nepal516]
 gi|229690746|gb|EEO82800.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696722|gb|EEO86769.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229705891|gb|EEO91900.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis Pestoides
           A]
 gi|262360597|gb|ACY57318.1| chaperone protein DnaJ [Yersinia pestis D106004]
 gi|262364542|gb|ACY61099.1| chaperone protein DnaJ [Yersinia pestis D182038]
 gi|270336440|gb|EFA47217.1| chaperone protein DnaJ [Yersinia pestis KIM D27]
 gi|294353025|gb|ADE63366.1| chaperone protein DnaJ [Yersinia pestis Z176003]
 gi|320016966|gb|ADW00538.1| chaperone Hsp40, co-chaperone with DnaK [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 379

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 256/386 (66%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A +R++K A++ LAMK+HPD+   D  A+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GG   G  G +DFS++F  +FG I G GR  +R+S  
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGGFGGGGGGADFSDIFGDVFGDIFGGGRRQQRASR- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G+G+V
Sbjct: 117 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVTCPTCHGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 174 -QMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 292 VKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESF 351

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P++  F   +K FFD L
Sbjct: 352 VGAAGEKNSPRAKSFLDGVKKFFDDL 377


>gi|254037429|ref|ZP_04871506.1| chaperone DnaJ [Escherichia sp. 1_1_43]
 gi|226840535|gb|EEH72537.1| chaperone DnaJ [Escherichia sp. 1_1_43]
          Length = 386

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 255/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A + ++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 11  MAKQDYYEILGVSKTAEEHEIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 70

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 71  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 123

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 124 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 181 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 240 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 299 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 359 GGPTGEHNSPRSKSFFDGVKKFFDDL 384


>gi|284006368|emb|CBA71603.1| chaperone protein [Arsenophonus nasoniae]
          Length = 378

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 257/386 (66%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQVLG+ + A ++++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKRDYYQVLGVTKTADEKEIKKAYKRLAMKYHPDRNQGDKEAESKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GGF  G    +DFS++F  +FG I G GR  +RS+  
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGFSGGFASGADFSDIFGDVFGDIFGGGRR-QRSAR- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADL+Y + ++LEEA  G + +IR PT  KC  C+GSGAKPGT P  C+ C+G+G+V
Sbjct: 116 ---GADLQYEMTLTLEEAVRGVSKEIRIPTLEKCDVCNGSGAKPGTKPETCSTCHGAGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G GQII  PC KCHG GRV + K LSV +PPGV+ G RIRL+
Sbjct: 173 -QIRQGFFAVQQTCPTCHGRGQIIKEPCIKCHGHGRVEKYKTLSVKIPPGVNTGDRIRLN 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ ++V +H  F+RDG +LYC VPI+    A+GG  DV TLD   
Sbjct: 232 GEGEAGENGAPAGDLYVQVNVTRHAIFERDGNNLYCEVPINFTIAALGGEIDVPTLDGRV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF-EQI 359
           S + IP  TQTGK FR+KGKG+  +  G  GDL  ++ VETP KLN++Q+ LL+EF E +
Sbjct: 292 S-LKIPAETQTGKIFRMKGKGVKPVRGGMTGDLMCRILVETPVKLNEKQKALLKEFGESL 350

Query: 360 SSQD---NNPQSTGFFARMKDFFDSL 382
           + +    N+P+S  F   +K FFD L
Sbjct: 351 NGESGGKNSPRSKSFLDSVKKFFDDL 376


>gi|82775396|ref|YP_401742.1| chaperone protein DnaJ [Shigella dysenteriae Sd197]
 gi|309787358|ref|ZP_07681970.1| chaperone protein DnaJ [Shigella dysenteriae 1617]
 gi|123563582|sp|Q32KA4|DNAJ_SHIDS RecName: Full=Chaperone protein dnaJ
 gi|81239544|gb|ABB60254.1| heat shock protein [Shigella dysenteriae Sd197]
 gi|308924936|gb|EFP70431.1| chaperone protein DnaJ [Shigella dysenteriae 1617]
          Length = 376

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 255/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEVGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|194439289|ref|ZP_03071368.1| chaperone protein DnaJ [Escherichia coli 101-1]
 gi|253774954|ref|YP_003037785.1| chaperone protein DnaJ [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160136|ref|YP_003043244.1| chaperone protein DnaJ [Escherichia coli B str. REL606]
 gi|300930618|ref|ZP_07146008.1| chaperone protein DnaJ [Escherichia coli MS 187-1]
 gi|194421771|gb|EDX37779.1| chaperone protein DnaJ [Escherichia coli 101-1]
 gi|242375852|emb|CAQ30532.1| chaperone with DnaK; heat shock protein, subunit of DnaJ/DnaK/GrpE
           [Escherichia coli BL21(DE3)]
 gi|253325998|gb|ACT30600.1| chaperone protein DnaJ [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972037|gb|ACT37708.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli B str.
           REL606]
 gi|253976247|gb|ACT41917.1| chaperone Hsp40, co-chaperone with DnaK [Escherichia coli
           BL21(DE3)]
 gi|300461501|gb|EFK24994.1| chaperone protein DnaJ [Escherichia coli MS 187-1]
 gi|323960130|gb|EGB55775.1| chaperone DnaJ [Escherichia coli H489]
 gi|323970865|gb|EGB66117.1| chaperone DnaJ [Escherichia coli TA007]
          Length = 376

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 255/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A + ++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEHEIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|194429152|ref|ZP_03061681.1| chaperone protein DnaJ [Escherichia coli B171]
 gi|194412767|gb|EDX29060.1| chaperone protein DnaJ [Escherichia coli B171]
          Length = 376

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 255/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA    T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRSVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|325981944|ref|YP_004294346.1| chaperone protein DnaJ [Nitrosomonas sp. AL212]
 gi|325531463|gb|ADZ26184.1| chaperone protein DnaJ [Nitrosomonas sp. AL212]
          Length = 369

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/382 (48%), Positives = 246/382 (64%), Gaps = 18/382 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ R A +  +K A+R LAMKYHPD+N  D +++E F +  EAYEVL D 
Sbjct: 1   MSKRDYYHVLGVSREADENTIKKAYRKLAMKYHPDRNAGDVKSEEMFKEAKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++  A   G             FS+ F  IFG I G GRS   S S 
Sbjct: 61  NKRAAYDQFGHAGVDSNAAGGGG---------AQGFSDAFSDIFGDIFG-GRS---SRSN 107

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLEI+LE+A  G   +IR PT   C TC GSG+KPG++P  C  CNG G+V
Sbjct: 108 MHRGSDLRYNLEITLEQAAHGTETKIRIPTMENCETCHGSGSKPGSSPKTCPTCNGHGQV 167

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C GSG++I +PC+ CHG GR+ ++K L+V +P GVDDG RIR+S
Sbjct: 168 -RMQQGFFSIQQTCPKCHGSGKVIVNPCTSCHGNGRIKQQKTLNVKIPEGVDDGDRIRIS 226

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G+ GG PGDLY+ + +  H  F+RDG +L+C +PIS    A+GG  +V TLD  H
Sbjct: 227 GEGEVGINGGPPGDLYVVVHLSAHSVFRRDGDNLHCEIPISFTVAALGGEIEVPTLDG-H 285

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ +PE TQTGK FRL+GKG+  + S  KGDL   V VETP KL  RQ+ELLEE E IS
Sbjct: 286 AKIKVPEETQTGKIFRLRGKGIKGVRSHDKGDLLCHVVVETPVKLTARQKELLEELESIS 345

Query: 361 SQD---NNPQSTGFFARMKDFF 379
            +D   ++P++  +  + ++FF
Sbjct: 346 LKDGPRHSPRAKSWMDKAREFF 367


>gi|82703356|ref|YP_412922.1| heat shock protein DnaJ [Nitrosospira multiformis ATCC 25196]
 gi|82411421|gb|ABB75530.1| Heat shock protein DnaJ [Nitrosospira multiformis ATCC 25196]
          Length = 377

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 246/382 (64%), Gaps = 19/382 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLGI+R++++ ++K A+R LAMKYHPD+N + P+A+E F +  EAYEVL DP
Sbjct: 10  MSKRDYYEVLGINRDSSEDEIKKAYRRLAMKYHPDRNPDSPKAEEHFKEAKEAYEVLSDP 69

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  ++      GA GF         F ++F  +FGG       Y+     
Sbjct: 70  RKRAAYDQHGHAGVDASMGGGGAQGFADA------FGDIFGDLFGGRSAQANVYR----- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEISLE+A  G   +IR PT   C TC GSGAKPGT+P  C  CNG G+V
Sbjct: 119 ---GADLRYNLEISLEQAARGTETKIRIPTMDACGTCHGSGAKPGTSPTTCPTCNGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C GSG+ I  PC+ C G GRV   K LSV +P GVD+G RIRLS
Sbjct: 176 -RMQQGFFSIQQTCPKCHGSGKFISSPCNTCGGSGRVKHHKTLSVKIPAGVDEGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV  G PGDLY+ I +  H  F+RD  DL+C +P+S  T A+GG  ++ TL+  H
Sbjct: 235 GEGEAGVNSGPPGDLYVVIHLTPHSVFQRDHNDLHCEMPVSFTTAALGGEIEIPTLEG-H 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQ+GK FRL+GKG+  + S   GDL   V VETP KL  RQ+ELL+E E I+
Sbjct: 294 AKIRIPAETQSGKIFRLRGKGIKGVRSNNPGDLLCHVVVETPVKLTPRQKELLQELEAIN 353

Query: 361 SQD---NNPQSTGFFARMKDFF 379
            +D   ++P++  +  ++++FF
Sbjct: 354 QEDGSRHSPRAKSWMDKVREFF 375


>gi|283783791|ref|YP_003363656.1| chaperone protein DnaJ (heat shock protein J) [Citrobacter
           rodentium ICC168]
 gi|282947245|emb|CBG86790.1| chaperone protein DnaJ (heat shock protein J) [Citrobacter
           rodentium ICC168]
          Length = 376

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 257/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R+A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKKDYYEILGVSRSAEEREIKKAYKRLAMKYHPDRNQGDKEAEGKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL++ ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQDLQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEKNSPRSKNFFEGVKKFFDDL 374


>gi|317493356|ref|ZP_07951778.1| chaperone DnaJ [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918749|gb|EFV40086.1| chaperone DnaJ [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 375

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 257/386 (66%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A +R++K A++ LAMK+HPD+N+ D +A+EKF ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRNQ-DTDAEEKFKEVKEAYEILTDA 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  + +   
Sbjct: 60  QKRAAYDQYGHAAFE-----QGGMGGGGGYGGGADFSDIFGDVFGDIFGGGRRQRATR-- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT V+C  C GSGAK GT+P+ C  C+G+G+V
Sbjct: 113 ---GADLRYNMELTLEEAVRGVTKEIRIPTLVECEVCHGSGAKKGTDPVTCPTCHGAGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 170 -QMRQGFFTVQQPCPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+  +L+C VPI+    A+GG  +V TLD   
Sbjct: 229 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE--- 357
            ++ IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL E E   
Sbjct: 288 VKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVNLNEKQKQLLRELEDSF 347

Query: 358 -QISSQDNNPQSTGFFARMKDFFDSL 382
              SS +N+P+S  F   +K FFD L
Sbjct: 348 GDSSSANNSPRSKSFLDGVKKFFDDL 373


>gi|146310243|ref|YP_001175317.1| chaperone protein DnaJ [Enterobacter sp. 638]
 gi|189083322|sp|A4W6D6|DNAJ_ENT38 RecName: Full=Chaperone protein dnaJ
 gi|145317119|gb|ABP59266.1| chaperone protein DnaJ [Enterobacter sp. 638]
          Length = 382

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 255/386 (66%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG+ + A +R++K A++ LAMK+HPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDFYEILGVPKTAEEREIKKAYKRLAMKFHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G    G +DF ++F  +FG I G GR  +R+S  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGYGGGGFGGGGADFGDIFGDVFGDIFGGGRGRQRASR- 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 120 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDICHGSGAKVGTKPQTCPTCHGSGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 177 -QIRQGFFAVQQACPHCHGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 236 GEGEAGEHGAQAGDLYVQVQVKQHAIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++G+G+  +  G +GDL  +V VETP  LN +Q++LL+E ++  
Sbjct: 295 VNLKVPGETQTGKLFRMRGRGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKELQESF 354

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + ++N+P+S  FF  +K FFD L
Sbjct: 355 GGPTGENNSPRSKSFFDGVKKFFDDL 380


>gi|206576157|ref|YP_002240532.1| chaperone protein DnaJ [Klebsiella pneumoniae 342]
 gi|288937229|ref|YP_003441288.1| chaperone protein DnaJ [Klebsiella variicola At-22]
 gi|290512634|ref|ZP_06552000.1| chaperone DnaJ [Klebsiella sp. 1_1_55]
 gi|226735574|sp|B5Y241|DNAJ_KLEP3 RecName: Full=Chaperone protein dnaJ
 gi|206565215|gb|ACI06991.1| chaperone protein DnaJ [Klebsiella pneumoniae 342]
 gi|288891938|gb|ADC60256.1| chaperone protein DnaJ [Klebsiella variicola At-22]
 gi|289774975|gb|EFD82977.1| chaperone DnaJ [Klebsiella sp. 1_1_55]
          Length = 377

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 259/386 (67%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAAR- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 115 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGSKPQTCPTCHGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFTMAALGGEIEVPTLDGRV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 291 S-LKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLKELQESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + ++N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGENNSPRSKSFFDGVKKFFDDL 375


>gi|152968597|ref|YP_001333706.1| chaperone protein DnaJ [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238893002|ref|YP_002917736.1| chaperone protein DnaJ [Klebsiella pneumoniae NTUH-K2044]
 gi|262044940|ref|ZP_06017982.1| chaperone DnaJ [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|330009382|ref|ZP_08306521.1| chaperone protein DnaJ [Klebsiella sp. MS 92-3]
 gi|189083331|sp|A6T4F5|DNAJ_KLEP7 RecName: Full=Chaperone protein dnaJ
 gi|150953446|gb|ABR75476.1| chaperone with DnaK; heat shock protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238545318|dbj|BAH61669.1| chaperone protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|238774005|dbj|BAH66502.1| chaperone with DnaK; heat shock protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|259037667|gb|EEW38896.1| chaperone DnaJ [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|328534816|gb|EGF61363.1| chaperone protein DnaJ [Klebsiella sp. MS 92-3]
          Length = 377

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 258/386 (66%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAAR- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 115 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGSKPQTCPTCHGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFTMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 290 VNLKIPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLKELQESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + ++N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGENNSPRSKSFFDGVKKFFDDL 375


>gi|157147571|ref|YP_001454890.1| chaperone protein DnaJ [Citrobacter koseri ATCC BAA-895]
 gi|157084776|gb|ABV14454.1| hypothetical protein CKO_03371 [Citrobacter koseri ATCC BAA-895]
          Length = 385

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 260/386 (67%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 9   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDA 68

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG GGFG G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 69  QKRAAYDQYGHAAFE-----QGGGGFGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAAR- 122

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 123 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 180 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLS 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 239 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINCAMAALGGEIEVPTLDG-R 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++G+G+  +  G +GDL  +V VETP  LN++Q++LL++ ++  
Sbjct: 298 VKLKVPHETQTGKLFRMRGRGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLKDLQESF 357

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 358 GGPTGEKNSPRSKSFFDGVKKFFDDL 383


>gi|268592120|ref|ZP_06126341.1| chaperone protein DnaJ [Providencia rettgeri DSM 1131]
 gi|291312518|gb|EFE52971.1| chaperone protein DnaJ [Providencia rettgeri DSM 1131]
          Length = 377

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 255/388 (65%), Gaps = 16/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG++RNA+D+ +K A++ LAMK+HPD+N+ D  +++KF +I EAYEVL D 
Sbjct: 1   MAKRDFYEVLGLERNASDKDIKRAYKRLAMKHHPDRNQGDKGSEDKFKEIKEAYEVLSDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G G  GA      DFS++F  +FG I G GR  +R S  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGGFGGA------DFSDIFGDVFGDIFGGGRRQQRPSR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DL+YN+E++LEEA  G T +IR PT   C  C G+GAKPGT+   C+ C+G G+V
Sbjct: 114 ---GSDLQYNMELTLEEAVRGVTKEIRIPTLETCDVCHGNGAKPGTSADTCSTCHGMGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FFS+++ C TC G G++I  PC+KCHG GRV   K LSV +P GVD G R+RLS
Sbjct: 171 HMR-QGFFSVQQPCPTCHGRGKVIKDPCNKCHGHGRVERYKTLSVKIPAGVDTGDRVRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDL++ + V  H  F+RDG +L+C VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGENGAPAGDLFVQVHVLPHNIFERDGNNLHCEVPINFADAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FR+KGKG+  +  G +GDL   + VETP KLN++Q+ELL+EF +  
Sbjct: 289 VKLKIPAETQTGKIFRMKGKGVKSVRGGLQGDLMCHIVVETPVKLNEKQKELLKEFGESL 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSLKN 384
              S + N+P+S  F   +K FFD L N
Sbjct: 349 GGKSGEKNSPRSKSFLDGVKKFFDDLTN 376


>gi|89091966|ref|ZP_01164921.1| dnaJ protein [Oceanospirillum sp. MED92]
 gi|89083701|gb|EAR62918.1| dnaJ protein [Oceanospirillum sp. MED92]
          Length = 377

 Score =  368 bits (944), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 248/385 (64%), Gaps = 12/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+++DR +K AFR +AMKYHPD+N +D EA+E F +++EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVSRDSSDRDIKKAFRRMAMKYHPDRNPDDKEAEESFKEVNEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH  ++   +               +FS++F  +FG I G G      SS 
Sbjct: 61  QKKAAYDQYGHAGVDPNMRGGHG------GGFEGNFSDIFGDVFGDIFGGGGGRGGRSSV 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+E++LEEA  G   +IR PT V C TC GSGAKPGT+   C  C G G+V
Sbjct: 115 -QRGADLRYNMEMTLEEAVRGVEKEIRVPTLVGCETCDGSGAKPGTSAKICGTCGGQGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C TC G G++I  PC+ CHG GR+ + K L+V +P GVD G RIRL+
Sbjct: 174 -RMQQGFFSVQQTCPTCHGEGKVISDPCNDCHGHGRIEKTKTLNVKIPAGVDTGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ + VK H  F+RDG  LYC VPIS V  A+GG  +V TLD   
Sbjct: 233 GEGEAGTHGGPAGDLYVQVHVKDHPIFERDGKHLYCEVPISFVDAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ +P  TQTGK FRL+GKG+  +  G  GDL V+V VETP  L+ RQ+ELL EF+   
Sbjct: 292 VKLKVPSETQTGKMFRLRGKGISPVRGGSTGDLLVKVVVETPVNLSSRQKELLREFQDEM 351

Query: 361 SQ---DNNPQSTGFFARMKDFFDSL 382
            Q    ++P+  GFF  +K FF+ +
Sbjct: 352 EQGTHKHSPKKHGFFDSVKKFFEDM 376


>gi|149202959|ref|ZP_01879930.1| chaperone protein DnaJ [Roseovarius sp. TM1035]
 gi|149143505|gb|EDM31541.1| chaperone protein DnaJ [Roseovarius sp. TM1035]
          Length = 386

 Score =  368 bits (944), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 258/389 (66%), Gaps = 8/389 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+   +K A+R  A + HPD+N ++P+++ +F +  EAY+VL+DP
Sbjct: 1   MAKRDYYEVLGLSKGASADDIKKAYRKKAKELHPDRNADNPDSERQFKEAGEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN-----SDFSELFEGIFGGIMGSGRSYK 115
           +K+A YD+ GH A E G    GA   G G         S FS++F+ +FG  MG  R   
Sbjct: 61  EKKAAYDRFGHAAFEGGMGGGGARPGGFGGGAGQGDFASAFSDVFDDLFGDFMGGARGGT 120

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRYNL I+LEEA++G    I+ P+AV C  C GSGA+ G  P  C  C+
Sbjct: 121 GRQRAAR-GADLRYNLRITLEEAYAGLQKTIKVPSAVPCDACEGSGAEGGAQPSTCPTCS 179

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G G+V    Q FF++ER C TC G GQII +PC  C GQGRV +++ LSVN+P GV+ GT
Sbjct: 180 GMGKVRAQ-QGFFTVERTCPTCGGLGQIIKNPCKSCQGQGRVQKDRALSVNIPAGVETGT 238

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIRL+GEG AG+ GG  GDLYIFI V KH+ F+R+  +L+C VP+S+   A+GG  +V T
Sbjct: 239 RIRLAGEGEAGMRGGPAGDLYIFIEVAKHELFEREETNLFCRVPVSMTKAALGGDIEVPT 298

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           +D   SRV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ ELL E
Sbjct: 299 IDGGRSRVKIPPGSQSGRQMRLRGKGMPALRGGAHGDMFIEMAVETPVNLTSRQTELLRE 358

Query: 356 FEQISSQDNNPQSTGFFARMKDFFDSLKN 384
           FE + S+DN+P+S  FF+ ++ F+DS+K+
Sbjct: 359 FEAL-SEDNSPESKSFFSSVRSFWDSMKS 386


>gi|329296948|ref|ZP_08254284.1| chaperone protein DnaJ [Plautia stali symbiont]
          Length = 378

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 251/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+DFY++LG+ ++A +R++K A++ LAMKYHPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKSDFYEILGVSKSADEREIKKAYKRLAMKYHPDRNPGDKEAETKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q  G G  G    G +DF+++F  +FG I G  R  + S   
Sbjct: 61  QKRAAYDQYGHAAFE---QGGGGGFGGGFGGGGADFNDIFGDVFGDIFGGSRRQRASR-- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+G+G+V
Sbjct: 116 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGAGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV  +K LSV +P GVD G RIRLS
Sbjct: 173 -QMRQGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVERQKTLSVKIPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ +SVKKH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGEHGAPAGDLYVQVSVKKHPIFEREDNNLYCEVPINFAMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G  GDL  +V VETP  LN +Q+ LL E E+  
Sbjct: 291 VKLKVPAETQTGKLFRMRGKGVKSVRGGAVGDLLCRVVVETPVSLNDKQKSLLRELEESF 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 351 GGPTGEKNSPRSKSFFDGVKKFFDDL 376


>gi|88857467|ref|ZP_01132110.1| Chaperone protein dnaJ [Pseudoalteromonas tunicata D2]
 gi|88820664|gb|EAR30476.1| Chaperone protein dnaJ [Pseudoalteromonas tunicata D2]
          Length = 376

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 250/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A++R +K A++ LAMKYHPD+   D + + KF ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVERDASERDIKKAYKRLAMKYHPDRTAGDKDLEAKFKEVKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YDQ GH A E G    G         G  DF ++F  +FG I G G    R  S 
Sbjct: 61  QKRKTYDQYGHAAFEQGGGHGGF------GGGQGDFGDIFGDVFGDIFGGG---GRRQSR 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+++SLEEA  GK+V+I+ PT V C  C GSGAK G+ P  C  C+GSG+V
Sbjct: 112 QQRGADLRYNMDLSLEEAVRGKSVEIKVPTWVSCDPCDGSGAKAGSKPTTCGTCHGSGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G GQII  PC+KCHGQGRV + K LSV +P GVD G RIRLS
Sbjct: 172 -QMRQGFFAVQQTCPTCSGRGQIISDPCNKCHGQGRVEKTKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ G   GDLY+ +SV++H  F RDG +LYC VPIS  T A+GG  +V TLD   
Sbjct: 231 GEGEAGLNGAPAGDLYVQVSVREHAIFVRDGNNLYCEVPISFTTAALGGDVEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
           +++ IP   QT K FRL+ KG+  + SG  GDL  +V +ETP  LN+RQ+ELL E E+  
Sbjct: 290 AKLKIPSECQTDKMFRLRAKGVKSVRSGAIGDLICKVVIETPVNLNERQKELLRELEESM 349

Query: 359 -ISSQDNNPQSTGFFARMKDFFDSL 382
             ++  N P+  GFF  +K FFD L
Sbjct: 350 GSNTSKNRPKEQGFFDGVKKFFDDL 374


>gi|291616217|ref|YP_003518959.1| DnaJ [Pantoea ananatis LMG 20103]
 gi|291151247|gb|ADD75831.1| DnaJ [Pantoea ananatis LMG 20103]
 gi|327392669|dbj|BAK10091.1| chaperone protein DnaJ [Pantoea ananatis AJ13355]
          Length = 381

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 252/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ ++A +R++K A++ LAMK+HPD+N  D E++ KF +  EAYE+L DP
Sbjct: 1   MAKSDYYEILGVAKSADEREIKKAYKRLAMKHHPDRNPGDKESETKFKEAKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G    G +DFS++F  +FG I G GR  + +   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGYGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRAAR-- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 119 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTKPQTCSTCHGAGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 176 QMR-QGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ +SVKKH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 235 GEGEAGEQGAPAGDLYVQVSVKKHPIFEREENNLYCEVPINFAMAALGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++G+G+  +  G  GDL  +V VETP  LN +Q+ LL E E+  
Sbjct: 294 VKLKVPAETQTGKLFRMRGRGVKSVRGGAVGDLLCRVVVETPVSLNDKQKALLRELEESF 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 354 GGPSGEHNSPRSKSFFDGVKKFFDDL 379


>gi|89052702|ref|YP_508153.1| chaperone protein DnaJ [Jannaschia sp. CCS1]
 gi|122499783|sp|Q28VY4|DNAJ_JANSC RecName: Full=Chaperone protein dnaJ
 gi|88862251|gb|ABD53128.1| Chaperone DnaJ [Jannaschia sp. CCS1]
          Length = 385

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 260/386 (67%), Gaps = 3/386 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K  FR+ A + HPD+N ++PEA+ +F + +EAY+VL+D 
Sbjct: 1   MAKRDYYEVLGVSKGASADEIKKGFRTKAKELHPDRNADNPEAESQFKEANEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSSS 119
            K+A YD+ GH A + G      GG G G     S FS++FE +FG  MG  R     + 
Sbjct: 61  DKKAAYDRFGHAAFDGGMAGGPRGGGGQGQGDFASAFSDVFEDLFGDFMGGQRGRPGGAR 120

Query: 120 T-GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           T    G+DLRYNL I+LE+A++G + QI  P++V CS+C G+G++ G  P  C  C+G G
Sbjct: 121 TQATRGSDLRYNLSITLEDAYNGLSKQITVPSSVACSSCDGTGSEAGAEPTSCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC  C G GR  +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCNGMGQIVKNPCRTCGGAGRQEKDRALSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG+ GG  GDLYIF+ V+ H  F+RDG DL+C VP+S+V+ A+GG  +V ++D 
Sbjct: 240 LSGEGEAGLRGGPAGDLYIFVEVQDHALFQRDGMDLFCRVPVSMVSAALGGEIEVPSIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV +PEG+Q+G+Q RL+GKGMP +     G++Y+++ VETP  L   Q ELL +FE+
Sbjct: 300 GRSRVRVPEGSQSGRQMRLRGKGMPALRGPGLGEMYIELMVETPVNLTGDQAELLRQFEE 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLKN 384
              + NNP ++GFF ++K F+D +++
Sbjct: 360 SCKKTNNPNASGFFDKVKSFWDKVRD 385


>gi|238758973|ref|ZP_04620144.1| hypothetical protein yaldo0001_28010 [Yersinia aldovae ATCC 35236]
 gi|238702784|gb|EEP95330.1| hypothetical protein yaldo0001_28010 [Yersinia aldovae ATCC 35236]
          Length = 378

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 257/386 (66%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A +R++K A++ LA+KYHPD+N+++ +  E F ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVKKDADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G      G  G +DF+++F  +FG I G GR  +R+S  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----FGGGGGADFTDIFGDVFGDIFGGGRRQQRASR- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G G+V
Sbjct: 116 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVTCPTCHGHGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KC G GRV + K LSV +P GVD G RIRLS
Sbjct: 173 -QMRQGFFTVQQACPHCHGRGQIIKDPCNKCRGNGRVEKAKTLSVKIPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G + GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGEHGASSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL E EQ  
Sbjct: 291 VKLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVHLNEKQKQLLRELEQSF 350

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 351 VGAAGEKNSPRSKSFLDGVKKFFDDL 376


>gi|253999613|ref|YP_003051676.1| chaperone protein DnaJ [Methylovorus sp. SIP3-4]
 gi|313201652|ref|YP_004040310.1| chaperone protein dnaj [Methylovorus sp. MP688]
 gi|253986292|gb|ACT51149.1| chaperone protein DnaJ [Methylovorus sp. SIP3-4]
 gi|312440968|gb|ADQ85074.1| chaperone protein DnaJ [Methylovorus sp. MP688]
          Length = 373

 Score =  367 bits (942), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 188/382 (49%), Positives = 255/382 (66%), Gaps = 13/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A+D ++K ++R LAMKYHPD+N ++P+A+E F +  EAYEVL D 
Sbjct: 1   MAKKDYYEVLGVNRDASDEEIKKSYRKLAMKYHPDRNPDNPKAEESFKEAKEAYEVLSDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A             G  +F++ F  IFG I G G   +RS+  
Sbjct: 61  QKRAAYDQYGHAGVDPSAGPGPG------GQGFGNFADAFGDIFGDIFGGGGGNRRSNVY 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+EISLE+A  G   +IR P   +C TC GSGA+PGT P+ C  C G G+V
Sbjct: 115 --RGADLRYNMEISLEDAARGTETKIRIPVMSECETCHGSGARPGTQPVTCTTCGGHGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG+++  PC  CHG GRV + K LSV +P GVD+G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPKCHGSGKMVKEPCPSCHGAGRVKKHKTLSVKIPAGVDEGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG PGDLY+ + +K+H  F+RDG +L+C +PIS  T A+GG  ++ TLD  H
Sbjct: 232 GEGEAGVNGGPPGDLYVVVHLKQHDIFQRDGGNLHCEMPISFTTAALGGEIEIPTLDG-H 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQTG  FRL+GKG+  + S   GDL   V VETP KL +RQ+ELL E E+I+
Sbjct: 291 AKMKIPPETQTGATFRLRGKGIKPLRSNDPGDLMCHVVVETPIKLTERQKELLREMEEIN 350

Query: 361 SQDNN---PQSTGFFARMKDFF 379
            QD++   P++ G+  ++KDFF
Sbjct: 351 LQDSDKHSPRAKGWMDKVKDFF 372


>gi|308185610|ref|YP_003929741.1| Chaperone protein dnaJ [Pantoea vagans C9-1]
 gi|308056120|gb|ADO08292.1| Chaperone protein dnaJ [Pantoea vagans C9-1]
          Length = 381

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 252/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ ++A +R++K A++ LAMK+HPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKSDYYEILGVAKSADEREIKKAYKRLAMKFHPDRNPGDKEAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G    G +DFS++F  +FG I G GR  + +   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRAAR-- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G T +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 119 ---GADLRYNMELSLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCSTCHGAGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 176 QMR-QGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ +SVKKH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 235 GEGEAGEQGAPAGDLYVQVSVKKHPIFEREENNLYCEVPINFAMAALGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++G+G+  +  G  GDL  +V VETP  LN++Q+ LL E E+  
Sbjct: 294 VKLKVPSETQTGKLFRMRGRGVKSVRGGAVGDLLCRVVVETPVSLNEKQKTLLRELEESF 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  F   +K FFD L
Sbjct: 354 GGPSGEHNSPRSKSFLDGVKKFFDDL 379


>gi|270159359|ref|ZP_06188015.1| chaperone protein DnaJ [Legionella longbeachae D-4968]
 gi|289165825|ref|YP_003455963.1| chaperone protein DnaJ (heat shock protein) [Legionella longbeachae
           NSW150]
 gi|269987698|gb|EEZ93953.1| chaperone protein DnaJ [Legionella longbeachae D-4968]
 gi|288858998|emb|CBJ12924.1| chaperone protein DnaJ (heat shock protein) [Legionella longbeachae
           NSW150]
          Length = 379

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 259/388 (66%), Gaps = 15/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M+K D+Y++L + R A+D ++K A+R LAMKYHPD+N  D EA+EKF +I  AY VL DP
Sbjct: 1   MEKRDYYELLEVSRTASDAEIKKAYRKLAMKYHPDRNPGDSEAEEKFKEIQSAYSVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++   +    G  G G +G+  F ++FE IF G   SGR      S 
Sbjct: 61  QKRAAYDQFGHAGVDPSMRGGPGGFGGFGGFGDV-FEDIFENIFSGGRASGRQ-----SR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G+ GADL++N++++LEEA  GK VQI  P    C+ C+GSGAK GT P  C  CNG G+V
Sbjct: 115 GQRGADLQFNVQLTLEEAALGKEVQITVPRHGTCTVCNGSGAKAGTQPKTCETCNGVGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C G G+ I  PCS CHGQGR+ E K L+V +PPGVD+G R+RLS
Sbjct: 175 -RIQQGFFSIQQTCPHCHGEGKTISDPCSSCHGQGRIRESKKLTVKIPPGVDNGDRVRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++GG PGDLY+ +S+KKH  F+R   DL+C VPIS +T A+GG+ +V TL+   
Sbjct: 234 GEGEAGMHGGGPGDLYVQVSIKKHTIFERHENDLHCEVPISFITAALGGSIEVPTLEG-- 291

Query: 301 SRVT--IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
            RVT  IP+ TQT K FRL+GKGM  +    +GDL  +V VETP  L++ Q+ELL +F +
Sbjct: 292 -RVTLKIPQETQTSKVFRLRGKGMKSVRGHGQGDLLCKVVVETPVNLSREQKELLTKFHE 350

Query: 359 I---SSQDNNPQSTGFFARMKDFFDSLK 383
               +  +++P+S  +FA +K FF+ +K
Sbjct: 351 SLENAKGNHSPRSNSWFAGVKKFFEDMK 378


>gi|91775103|ref|YP_544859.1| chaperone DnaJ [Methylobacillus flagellatus KT]
 gi|123078907|sp|Q1H3B9|DNAJ_METFK RecName: Full=Chaperone protein dnaJ
 gi|91709090|gb|ABE49018.1| Chaperone DnaJ [Methylobacillus flagellatus KT]
          Length = 373

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 245/382 (64%), Gaps = 13/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+ATD ++K A+R LAMKYHPD+N ++P+A+E F +  EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNRDATDEEIKKAYRKLAMKYHPDRNPDNPKAEEHFKEAKEAYEVLSDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A +    G                   GG       Y+     
Sbjct: 61  QKRAAYDQYGHAGVDPSAAAGAGAGGFGNFADAFGDIFGDIFGGGGGGRRSNVYR----- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+EISLEEA  G   +IR P   +C TC GSGA+PGT P+ C+ C G G+V
Sbjct: 116 ---GADLRYNMEISLEEAARGTETKIRIPVMAECETCHGSGARPGTQPVTCSTCGGHGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG+++  PC  CHG GRV + K LSV +P GVD+G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPKCHGSGKMVKDPCPTCHGGGRVKQHKTLSVKIPAGVDEGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG PGDLY+ + +KKH  F+RDGA+L+C +PIS  T A+GG  ++ TLD  H
Sbjct: 232 GEGEAGVNGGPPGDLYVVVHLKKHPIFERDGANLHCEMPISFTTAALGGEIEIPTLDG-H 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ +P  TQTG  FRL+GKG+  + S   GDL+  V VETP KL +RQ+ELL E E I+
Sbjct: 291 AKMKVPPETQTGAVFRLRGKGIKPLRSNEHGDLFCHVIVETPVKLTERQKELLRELEDIN 350

Query: 361 SQD---NNPQSTGFFARMKDFF 379
            QD   ++P+   +  ++KDFF
Sbjct: 351 QQDSGKHSPREKSWMTKVKDFF 372


>gi|224824610|ref|ZP_03697717.1| chaperone protein DnaJ [Lutiella nitroferrum 2002]
 gi|224603103|gb|EEG09279.1| chaperone protein DnaJ [Lutiella nitroferrum 2002]
          Length = 373

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 191/383 (49%), Positives = 247/383 (64%), Gaps = 15/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y  LG++R+A+D  +K A+R LAMK+HPD+N +  EA++KF ++ EAYE+L D 
Sbjct: 1   MSKRDYYDTLGVNRDASDDDIKKAYRKLAMKHHPDRNPDSKEAEDKFKEVKEAYEILSDG 60

Query: 61  QKRALYDQGGHEALEYGAQ-SQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
           QKRA YDQ GH  ++  A  ++G  GFG       DF++ F  IFG I G      RS+ 
Sbjct: 61  QKRAAYDQFGHAGVDPNAAGARGGQGFG-------DFADAFSDIFGDIFGGRGGGGRSNV 113

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               GADLRYN+EISLEEA  G   QIR P+   C  C GSGAKPGT P  C  C G G+
Sbjct: 114 Y--RGADLRYNMEISLEEAARGCEKQIRIPSHENCDVCHGSGAKPGTQPKTCPTCGGHGQ 171

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V  + Q FFSI++ C TC GSG+ I  PC KCHG G+V   K L+V +PPGVD+G RIRL
Sbjct: 172 VRVS-QGFFSIQQTCPTCHGSGKQITDPCHKCHGAGQVKTHKTLNVKIPPGVDEGDRIRL 230

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+   +K H  F+RDG DL+C +PIS  T A+GG  ++ TLD  
Sbjct: 231 SGEGEAGQNGGPAGDLYVVTHIKAHPVFQRDGMDLHCEMPISFATAALGGEVEIPTLDGL 290

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            ++V I   TQ+G+Q+RL+GKG+  +     GDL   V VETP  L +RQ+ELL EFE I
Sbjct: 291 -AKVKIAAETQSGRQYRLRGKGIKSVRGSDYGDLLCHVVVETPINLTERQKELLREFEAI 349

Query: 360 SSQD---NNPQSTGFFARMKDFF 379
           S  D   +NP++  F  ++KDFF
Sbjct: 350 SQGDTAMHNPRAKSFMDKLKDFF 372


>gi|294675780|ref|YP_003576395.1| chaperone DnaJ [Rhodobacter capsulatus SB 1003]
 gi|294474600|gb|ADE83988.1| chaperone DnaJ [Rhodobacter capsulatus SB 1003]
          Length = 384

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/385 (45%), Positives = 258/385 (67%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ + A+  ++K A+RS A + HPD+N+++P+A+ +F +++EAY+VL+D 
Sbjct: 1   MAKRDFYEVLGVSKGASAEEIKKAYRSKAKELHPDRNQDNPQAEAQFKEVNEAYDVLKDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSS- 118
            K+A YD+ GH A E G    G  G        +S FS++FE +FG  MG          
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGPRGPYGQGADFSSAFSDVFEDLFGDFMGGRGGPGGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           S    G+DLRYN+ ++LEEAF G    I  P +  C +C+G+GA+ G  P  C  C+G G
Sbjct: 121 SRATRGSDLRYNMRVTLEEAFKGAQKTITVPGSAACGSCNGTGAEGGAEPQTCPTCSGLG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V      FF++ER C TC G GQ++ +PC  CHG GR+ +E+ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-NGFFTVERTCPTCGGQGQVVKNPCRVCHGSGRIEKERTLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H  F+RDG +L+C VP+S+V+ A+GG  +V T+D 
Sbjct: 240 LAGEGEAGMRGGPSGDLYIFIEVREHAIFQRDGVNLFCRVPVSMVSAALGGEVEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             S+V +P G+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL+EF++
Sbjct: 300 GRSKVKVPVGSQSGRQMRLRGKGMPALRGGGIGDMVIELAVETPVNLTARQKELLDEFQR 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           I ++ NNP+   FF ++K F+D +K
Sbjct: 360 IQAE-NNPEGASFFQKVKSFWDGMK 383


>gi|330958063|gb|EGH58323.1| chaperone protein DnaJ [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 379

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 195/384 (50%), Positives = 253/384 (65%), Gaps = 7/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D E++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKESEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR        
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRGGGGGRGG 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G +V IR PT V C  C GSGAK G++P+ C  C G G+V
Sbjct: 118 AQRGSDLRYTLELNLEEAVRGTSVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E K L+V VPPGVD G RIRLS
Sbjct: 178 -RMQQGFFSVQQTCPRCHGQGKIISDPCDSCHGEGRVEEYKTLAVKVPPGVDTGDRIRLS 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG  GDLY+ I+V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 237 GEGEAGVQGGPTGDLYVVINVREHAIFQRDGKHLYCEVPISFTDAALGGELEVPTLDG-R 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF    
Sbjct: 296 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTSL 355

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 356 EDDESHSPKASGWFEGVKRFFGDL 379


>gi|237729313|ref|ZP_04559794.1| chaperone DnaJ [Citrobacter sp. 30_2]
 gi|226909042|gb|EEH94960.1| chaperone DnaJ [Citrobacter sp. 30_2]
          Length = 377

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 257/386 (66%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYEILGVSKSAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  +R+S  
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRASR- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 115 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL++ +   
Sbjct: 290 VKLKIPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKDLQDSF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGEQNSPRSKSFFDGVKKFFDDL 375


>gi|295098542|emb|CBK87632.1| chaperone protein DnaJ [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 381

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 254/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVPKTAEEREIKKAYKRLAMKFHPDRNQGDKEAEAKFKEIKEAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G      +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGGFGG-GADFSDIFGDVFGDIFGGGRGRQRAAR- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 119 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 176 -QMRQGFFAVQQACPHCHGRGTLIKDPCTKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLA 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 235 GEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL+E ++  
Sbjct: 294 VNLKIPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKELQESF 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 354 GGPTGEKNSPRSKSFFDGVKKFFDDL 379


>gi|332528800|ref|ZP_08404777.1| chaperone protein DnaJ [Hylemonella gracilis ATCC 19624]
 gi|332041866|gb|EGI78215.1| chaperone protein DnaJ [Hylemonella gracilis ATCC 19624]
          Length = 377

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 188/384 (48%), Positives = 248/384 (64%), Gaps = 13/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND--PEAKEKFAQISEAYEVLR 58
           M K D+Y+VLG+ + A++  +K A+R LAMKYHPD+N+ +    A+EKF +  EAYE+L 
Sbjct: 1   MAKRDYYEVLGVAKGASEDDIKKAYRKLAMKYHPDRNQGEGAKAAEEKFKEAKEAYEMLT 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++   +  G  GF AG      F+E F  IFG + G  R   R +
Sbjct: 61  DAQKRAAYDQYGHAGVDPNMRGGGDSGFAAG-----GFAEAFGDIFGDMFGQQRG-ARGA 114

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G DL Y +EI+LEEA  GK  QIR P+   C+TCSG+GAKPGT    C  C+GSG
Sbjct: 115 RQVYRGGDLSYAMEITLEEAARGKDAQIRIPSWDGCTTCSGTGAKPGTQVKTCTTCHGSG 174

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FFS+++ C  C+G+G+IIP PC  C GQGR+  +K L V +P G+DDG RIR
Sbjct: 175 QVQMR-QGFFSVQQTCPHCQGTGKIIPEPCPSCAGQGRIKRQKTLEVKIPAGIDDGMRIR 233

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG PGDLYI I +KKH  F+RDG DL+CTVPISIVT A+GG  +V TL  
Sbjct: 234 STGHGEPGINGGPPGDLYIEIRIKKHDIFERDGDDLHCTVPISIVTAALGGEIEVPTLQG 293

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQTGKQFRL+GKG+  + S   GDLY  + VETP KL + QR+LL E + 
Sbjct: 294 KAA-IDIPEGTQTGKQFRLRGKGIKDVRSSYPGDLYCHISVETPVKLTEAQRKLLRELDD 352

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
           +  +    ++P   G+  R++ FF
Sbjct: 353 LLKKGGAKHSPSQGGWADRLRSFF 376


>gi|302879637|ref|YP_003848201.1| chaperone protein DnaJ [Gallionella capsiferriformans ES-2]
 gi|302582426|gb|ADL56437.1| chaperone protein DnaJ [Gallionella capsiferriformans ES-2]
          Length = 379

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 248/385 (64%), Gaps = 10/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A+D ++K A+R LAMK+HPD+N ++P+A+E F +  EAYE L D 
Sbjct: 1   MSKKDYYEVLGVNRDASDEEIKKAYRKLAMKHHPDRNPDNPKAEEHFKEAKEAYETLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNS-DFSELFEGIFGGIMGSGRSYKRSSS 119
           QKRA YDQ GH A E G    G+     G      DFS+    IFG I G GR      S
Sbjct: 61  QKRAAYDQYGHAAFEAGGMGGGSPFGAGGAGAQGFDFSD----IFGDIFGGGRGGAGGRS 116

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + GADLRYNLEI+LE+A  G   QIR PT  +C TC GSGAKPGT+P  C  C G G+
Sbjct: 117 NVQRGADLRYNLEITLEQAARGTETQIRVPTMEECDTCHGSGAKPGTSPTTCTTCGGHGQ 176

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFSI++ C  C G+G++I  PC  C+G GR+ + K LSV +PPGVD+  RIRL
Sbjct: 177 V-RMQQGFFSIQQPCPRCHGNGKMISQPCKPCNGSGRIKQHKTLSVKIPPGVDNDDRIRL 235

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG  GV GG  GDLY+ I VK H  F+RD  DL+C +PIS  T A+GG  ++ TLD  
Sbjct: 236 SGEGEHGVNGGPSGDLYVVIHVKAHAVFQRDHNDLHCEMPISFSTAALGGEIEIPTLDGK 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            + + IP  TQ+GK FRL+GKG+  + S   GDL+  V VETP  L  RQRELL EFE I
Sbjct: 296 -AHIKIPAETQSGKIFRLRGKGIKGVRSATHGDLHCHVIVETPVNLTDRQRELLREFESI 354

Query: 360 ---SSQDNNPQSTGFFARMKDFFDS 381
              +S  +NP++  +  ++KDFF S
Sbjct: 355 NDLNSAHHNPRAKSWMNKVKDFFAS 379


>gi|254461919|ref|ZP_05075335.1| chaperone protein DnaJ [Rhodobacterales bacterium HTCC2083]
 gi|206678508|gb|EDZ42995.1| chaperone protein DnaJ [Rhodobacteraceae bacterium HTCC2083]
          Length = 380

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 186/383 (48%), Positives = 261/383 (68%), Gaps = 4/383 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLGI + A+  ++K  +R  A + HPD+N ++P+A+E+F + +EA+EVL+DP
Sbjct: 1   MSKRDYYDVLGIAKGASTDEIKKGYRKKAKELHPDRNSDNPKAEEQFKEANEAHEVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+A YD+ GH A E G      GG       +S FS++F+ +FG  MG  R      + 
Sbjct: 61  EKKAAYDRYGHAAFEGGMGGGRPGGGQGDF--SSAFSDVFDDLFGDFMGGQRGGGGGRNR 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLR+NL +SLEEAF+G    I  P+AV C++C G+GA  G  P +C  C+G G+V
Sbjct: 119 AARGSDLRFNLRVSLEEAFAGLQKTINVPSAVNCTSCEGTGADGGAEPTNCPTCSGMGKV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ER C TC G GQII +PC  C GQGRV +E+ LSVN+P GV+ GTRIRLS
Sbjct: 179 RAQ-QGFFTVERTCPTCSGMGQIIKNPCKSCSGQGRVEKERALSVNIPAGVETGTRIRLS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIFI V KH+ F+R+G +L+C VP+S+ + A+GG  +V T+D   
Sbjct: 238 GEGEAGMRGGPSGDLYIFIEVNKHKLFEREGVNLFCNVPVSMSSAALGGDIEVPTIDGGR 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  RQ+ELL+EFE + 
Sbjct: 298 SRVKIPAGSQSGRQMRLRSKGMPALRGGGAGDMFIELAVETPVNLTSRQKELLKEFEDL- 356

Query: 361 SQDNNPQSTGFFARMKDFFDSLK 383
           S+DNNP+S  FF+ +K F+D +K
Sbjct: 357 SEDNNPESKSFFSSVKSFWDGMK 379


>gi|326387910|ref|ZP_08209516.1| chaperone DnaJ [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207956|gb|EGD58767.1| chaperone DnaJ [Novosphingobium nitrogenifigens DSM 19370]
          Length = 378

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 246/378 (65%), Gaps = 7/378 (1%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           DFY++L ++R A D+ +K+AFR LAM+YHPD+N  D +A+ KF QI+EAY  L DPQKRA
Sbjct: 6   DFYELLEVERTADDKTIKSAFRKLAMRYHPDKNPGDQDAEAKFKQINEAYGCLSDPQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH A + G      GG G G    SD  ++FE IFGG  G GR   R       G
Sbjct: 66  AYDRFGHAAFQQGGPGGPGGGAGFGDGNFSDLGDIFETIFGGFGGGGRQPARR------G 119

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRY+LEISLEEAF GK  +I    +  C  C+GSGA PGT    CN+C G G+V    
Sbjct: 120 ADLRYDLEISLEEAFHGKNTEISVEISQACEPCAGSGATPGTATRRCNMCGGQGKVRAQ- 178

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF +ER C TC G G++I  PC  CHG+GRV + + L V VPPGVD+GTRIRL+G+G 
Sbjct: 179 QGFFMVERTCPTCGGRGEVIEKPCKHCHGEGRVDKPQRLEVEVPPGVDNGTRIRLAGKGE 238

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG +G  PGDLYIF+ V +H+ F+RDG  L    PIS  T A+GG+ ++  LD     + 
Sbjct: 239 AGPFGAPPGDLYIFLHVARHKVFERDGTTLLTRAPISFTTAALGGSIELPGLDGAKHVIE 298

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           IP G Q+GKQ R +G GMPV+     GDL +++ VETP +L+ RQRELL EF++  + + 
Sbjct: 299 IPAGIQSGKQLRKRGAGMPVLQGRGAGDLVIEIHVETPTRLSTRQRELLREFQETETGEE 358

Query: 365 NPQSTGFFARMKDFFDSL 382
            PQS GFF R++D ++ L
Sbjct: 359 CPQSKGFFERIRDAWNDL 376


>gi|291086100|ref|ZP_06354820.2| chaperone protein DnaJ [Citrobacter youngae ATCC 29220]
 gi|291069372|gb|EFE07481.1| chaperone protein DnaJ [Citrobacter youngae ATCC 29220]
          Length = 385

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 257/386 (66%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 9   MAKQDYYEILGVSKSAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEILTDA 68

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  +R+S  
Sbjct: 69  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRASR- 122

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 123 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKSGTQPQTCPTCHGSGQV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 180 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 239 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL++ +   
Sbjct: 298 VKLKIPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKDLQDSF 357

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 358 GGPTGEQNSPRSKSFFDGVKKFFDDL 383


>gi|37524584|ref|NP_927928.1| chaperone protein DnaJ [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|62899987|sp|Q7N8Y3|DNAJ_PHOLL RecName: Full=Chaperone protein dnaJ
 gi|36784008|emb|CAE12875.1| heat shock protein dnaJ (HSP40) (chaperone protein) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 372

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 248/386 (64%), Gaps = 20/386 (5%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+++++K A++ LAMKYHPD+N+ D EA+ +F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVSKTASEKEIKKAYKRLAMKYHPDRNQGDKEAESQFKEVKEAYEILTDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G           +DFS++F  +FG I G GR  +R S  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----------ADFSDIFGDVFGDIFGGGRRQQRPSR- 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++E++LEEA  G T +IR PT   C  C GSGAK GT+P+ C+ C G+G+V
Sbjct: 110 ---GADLRYSMELTLEEAVRGVTKEIRIPTLETCDICHGSGAKAGTSPVTCSTCQGAGQV 166

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++ C  C G GQII   C KCHG GRV   K LSV +P GVD G R+RLS
Sbjct: 167 HMR-QGFFTVQQPCPHCHGRGQIIKDSCHKCHGHGRVERYKTLSVKIPAGVDTGDRVRLS 225

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK H  F+R  ++LYC VP++    A+GG  +V TLD   
Sbjct: 226 GEGEAGAKGAPAGDLYVQVQVKSHHIFERQESNLYCEVPVNFAMAALGGEIEVPTLDG-R 284

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQTGK FR+KGKG+  +  G +GDL  +V VETP KLN+RQ+ELL E    F
Sbjct: 285 VKLKIPAETQTGKMFRMKGKGVKSVRGGVQGDLLCRVVVETPVKLNERQKELLRELGESF 344

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                + N+P+S  FF  +K FFD L
Sbjct: 345 GGAGEETNSPRSKSFFDGVKKFFDDL 370


>gi|293392927|ref|ZP_06637244.1| chaperone DnaJ [Serratia odorifera DSM 4582]
 gi|291424461|gb|EFE97673.1| chaperone DnaJ [Serratia odorifera DSM 4582]
          Length = 383

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 255/386 (66%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A +R++K A++ LAMKYHPD+N+ + +A+ KF +I EAYE+L D 
Sbjct: 8   MAKRDYYEVLGVAKTADEREIKKAYKRLAMKYHPDRNQ-ETDAEAKFKEIKEAYEILTDD 66

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    GA     G  G +DFS++F  +FG I G GR  + S   
Sbjct: 67  QKRAAYDQYGHAAFEQGGMGGGA----GGFGGGADFSDIFGDVFGDIFGGGRRQRASR-- 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G G+V
Sbjct: 121 ---GSDLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGSSPVTCPTCHGQGQV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 178 -QMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 237 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP KLN RQ++LL+E E+  
Sbjct: 296 VNLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVKLNDRQKQLLKELEESL 355

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S   N+P+S  FF  +K FFD L
Sbjct: 356 GGPSGDKNSPRSKSFFDGVKKFFDDL 381


>gi|149375769|ref|ZP_01893537.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Marinobacter algicola DG893]
 gi|149359894|gb|EDM48350.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Marinobacter algicola DG893]
          Length = 375

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 195/387 (50%), Positives = 253/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R A ++++K A+R LAMKYHPD+N +D +A  KF + SEAYE+L D 
Sbjct: 1   MAKRDYYEILGVSREADEKEIKRAYRKLAMKYHPDRNPDDEDADHKFKEASEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++  A             G + FS++F  +FG I G GR  + +   
Sbjct: 61  SKRAAYDQFGHAGVDGSAGGGFG------GGGGASFSDIFGDVFGDIFGGGRGGRNTRG- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRY LE+ LEEA  GKTVQIR P   +C+TC G+GA+ G+ P  C  CNG G+V
Sbjct: 114 ----ADLRYTLELDLEEAVKGKTVQIRIPGHTECNTCDGTGAEKGSRPEACGTCNGMGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TCRG G+II +PC  CHG GRV EEK LSV VPPGVD G RIRLS
Sbjct: 170 -RMQQGFFTVQQACPTCRGEGKIIKNPCKSCHGAGRVQEEKTLSVKVPPGVDTGDRIRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  GV GG PGDLY+ ++V++H  F RDG +LYC VPISIV  ++GG  +V TLD   
Sbjct: 229 GEGEMGVQGGPPGDLYVQVAVREHSIFTRDGRNLYCEVPISIVDASLGGELEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-I 359
            ++ IP  TQTGK FRL+ KG+  +  G  GDL  +V VETP  L KRQ+ELLEEF++ +
Sbjct: 288 VKLKIPPETQTGKLFRLRNKGVSPVRGGPAGDLLCRVMVETPVNLTKRQKELLEEFQKTL 347

Query: 360 SSQDNN---PQSTGFFARMKDFFDSLK 383
              D N   P+ T +F  +K FFD +K
Sbjct: 348 DGGDGNQHGPRKTSWFEGVKSFFDEMK 374


>gi|114798754|ref|YP_759489.1| chaperone protein DnaJ [Hyphomonas neptunium ATCC 15444]
 gi|123028288|sp|Q0C454|DNAJ_HYPNA RecName: Full=Chaperone protein dnaJ
 gi|114738928|gb|ABI77053.1| chaperone protein DnaJ [Hyphomonas neptunium ATCC 15444]
          Length = 386

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 244/381 (64%), Gaps = 7/381 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R   ++ LK+A+R LAMKYHPDQN  D  A++KF ++ EAY +L DP
Sbjct: 1   MSKRDYYEVLGVERGVDEKALKSAYRKLAMKYHPDQNAGDTAAEDKFKEVGEAYAILSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G+           +  ++F+ +F  + G+G        +
Sbjct: 61  QKRAAYDRYGHGAFENGGMGGGS----PFGGQGGNPEDIFQDLFSQVFGAGGFAGGRRRS 116

Query: 121 G-EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           G + GADLRY+LEI+LEEAF GK   I  P AV C  C G+GA PGT P  C  C G GR
Sbjct: 117 GPQRGADLRYDLEITLEEAFYGKDETIHVPQAVACRPCEGTGAAPGTKPETCETCGGHGR 176

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C  C+G GQII  PC  C G G+V EE+ L V +P GV+ G RIRL
Sbjct: 177 V-RAQQGFFTMERTCHICQGRGQIIRKPCKTCGGHGQVKEERKLQVKIPAGVESGMRIRL 235

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG  G  GG  GDLYIF+ V +H  F+RDG +LYC  P+ + T A+GG  D+ T+D  
Sbjct: 236 SGEGEPGTSGGPKGDLYIFVEVVEHDIFERDGPNLYCRAPVPMTTAALGGEIDIPTIDGG 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINS-GRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
            +RV IPEG QTG++ RL+ KGMP + + G+ GDLYV++ VETPQ L  RQ++LL +F  
Sbjct: 296 RARVAIPEGAQTGRKLRLRSKGMPSVRANGQTGDLYVEMFVETPQNLTARQKDLLRQFCD 355

Query: 359 ISSQDNNPQSTGFFARMKDFF 379
            S  D +P+S GF  ++K F+
Sbjct: 356 CSGADCHPESEGFLGKIKRFW 376


>gi|163745059|ref|ZP_02152419.1| chaperone protein DnaJ [Oceanibulbus indolifex HEL-45]
 gi|161381877|gb|EDQ06286.1| chaperone protein DnaJ [Oceanibulbus indolifex HEL-45]
          Length = 383

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 254/385 (65%), Gaps = 5/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K A+RS     HPD+N+++P A+ +F ++ EAY+VL+  
Sbjct: 1   MAKRDYYEVLGVAKGASADEIKKAYRSKVKDLHPDRNKDNPNAEAQFKEVGEAYDVLKTD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G      GG   G  G+  S FS++F+ +FG  MG         
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGRPGGGMGGGQGDFSSAFSDVFDDLFGDFMGQRGGGGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                 ADLRYNL ISLE+AFSG    I  P +V+C +C GSGA+ G  P  C  C+G G
Sbjct: 121 RAARG-ADLRYNLRISLEDAFSGMQKSITVPASVQCDSCDGSGAEGGAEPSTCPTCSGMG 179

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC KC G GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 180 KVRAQ-QGFFTVERTCPTCSGMGQIVKNPCKKCRGAGRVEKERTLSVNIPAGVETGTRIR 238

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V  H+ F+RDG +L+C VP+S+ T A+GG  +V T+D 
Sbjct: 239 LAGEGEAGMRGGPSGDLYIFIEVADHELFERDGPNLFCRVPVSMSTAALGGNIEVPTIDG 298

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IP G+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL+EF  
Sbjct: 299 GRGRVQIPAGSQSGRQMRLRGKGMPPLRGGGVGDMIIELAVETPVNLTSRQKELLQEFAG 358

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
             +Q+NNP+S+ FF+ +K F+DS+K
Sbjct: 359 -EAQNNNPESSNFFSSVKSFWDSMK 382


>gi|254495629|ref|ZP_05108551.1| chaperone protein DnaJ (heat shock protein) [Legionella drancourtii
           LLAP12]
 gi|254355199|gb|EET13812.1| chaperone protein DnaJ (heat shock protein) [Legionella drancourtii
           LLAP12]
          Length = 378

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 260/388 (67%), Gaps = 16/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M++ D+Y++L ++R A+D ++K A+R LAMKYHPD+N +D  A+EKF +I  AY +L D 
Sbjct: 1   MEQRDYYELLEVNRTASDAEIKKAYRKLAMKYHPDRNPDDSSAEEKFKEIQNAYSILSDQ 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++   +       G        F ++FE IF G  G+GR      S 
Sbjct: 61  QKRAAYDQYGHAGVDPSMRGGPG--GGGFGGFGDVFEDIFENIFSGGRGAGRQ-----SR 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G+ GADL++N+ ++LEEA  GK V+I  P    C+ CSGSGAKPGT+P +C  CNG G+V
Sbjct: 114 GQRGADLQFNVTLTLEEAALGKEVEITVPRQGICTICSGSGAKPGTHPKNCETCNGMGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C +C G G+II  PCS CHGQGR+ E K L+V +P GVD+G R+RLS
Sbjct: 174 -RIQQGFFSIQQTCPSCHGEGKIITDPCSGCHGQGRIRESKKLTVKIPAGVDNGDRVRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++GG PGDLY+ I+VKKH  F+RD  DL+C VPIS +T AMGG+ +V TL+   
Sbjct: 233 GEGEAGMHGGGPGDLYVQINVKKHAIFERDDNDLHCEVPISFITAAMGGSIEVPTLEG-- 290

Query: 301 SRVT--IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
            RVT  IP+ TQTGK FRL+GKGM  +    +GDL  +V VETP  L++ Q++LL +  +
Sbjct: 291 -RVTLKIPDETQTGKVFRLRGKGMKSVRGHGQGDLLCKVVVETPVNLSREQKDLLTKLHE 349

Query: 359 I---SSQDNNPQSTGFFARMKDFFDSLK 383
               +  +++P+++ +FA +K FF+ +K
Sbjct: 350 SLENAKANHSPRTSSWFAGVKKFFEDMK 377


>gi|152984364|ref|YP_001350802.1| chaperone protein DnaJ [Pseudomonas aeruginosa PA7]
 gi|189083346|sp|A6VCL7|DNAJ_PSEA7 RecName: Full=Chaperone protein dnaJ
 gi|150959522|gb|ABR81547.1| chaperone protein DnaJ [Pseudomonas aeruginosa PA7]
          Length = 377

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 194/384 (50%), Positives = 249/384 (64%), Gaps = 9/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG++R A++  LK A+R LAMKYHPD+N  D EA++KF + +EAYEVL D 
Sbjct: 1   MAKRDFYEVLGVERGASEADLKKAYRRLAMKYHPDRNPGDKEAEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++               +G + FS++F  +F    G G     +   
Sbjct: 61  SKRAAYDQYGHAGVDPNMGGGAGA-----GFGGASFSDIFGDVFSDFFGGGGGRGGARGG 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRY L++ LEEA  G TV IR PT V C TC+GSGAKPGT P+ C  C G G+V
Sbjct: 116 AQRGADLRYTLDLDLEEAVRGTTVTIRVPTLVGCKTCNGSGAKPGTTPVTCTTCGGIGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G+G++I  PC  CHGQGRV E+K LSV VP GVD G RIRL+
Sbjct: 176 -RMQQGFFSVQQTCPRCHGTGKMISDPCGSCHGQGRVEEQKTLSVKVPAGVDTGDRIRLT 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ ++V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 235 GEGEAGSMGGPAGDLYVVVNVREHPIFQRDGKHLYCEVPISFADAALGGELEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPE TQTGK FRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF +  
Sbjct: 294 VKLKIPESTQTGKLFRLRGKGVAPVRGGGAGDLMCKVVVETPVNLDKRQRELLEEFRKSL 353

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  MK FFD L
Sbjct: 354 QSDTSHSPKASGWFEGMKRFFDDL 377


>gi|120556268|ref|YP_960619.1| chaperone protein DnaJ [Marinobacter aquaeolei VT8]
 gi|189083334|sp|A1U613|DNAJ_MARAV RecName: Full=Chaperone protein dnaJ
 gi|120326117|gb|ABM20432.1| chaperone protein DnaJ [Marinobacter aquaeolei VT8]
          Length = 374

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 200/387 (51%), Positives = 252/387 (65%), Gaps = 18/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLGI R+A ++++K A+R LAMKYHPD+N +D +A+ KF + SEAYE+L D 
Sbjct: 1   MAKRDYYEVLGISRDADEKEIKRAYRKLAMKYHPDRNPDDKDAETKFKEASEAYEILADS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH     G   Q  GGFG G    SD   +F  +FG I G G   + +   
Sbjct: 61  SKRAAYDQFGHA----GVDGQAGGGFGGGGASFSD---IFGDVFGDIFGGGGRGRTTRG- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRY LE+ LEEA  GKTV+I  P   +C  C GSGA+ G+ P  C  C G G+V
Sbjct: 113 ----ADLRYTLELDLEEAVKGKTVKINIPGHKECEACDGSGAEKGSRPETCGTCQGMGQV 168

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TCRGSGQII +PC  CHGQGRV +EK LSV VPPGVD G RIRLS
Sbjct: 169 -RMQQGFFTVQQACPTCRGSGQIIKNPCKSCHGQGRVRQEKTLSVKVPPGVDTGDRIRLS 227

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  GV GG PGDLY+ ++V++H  F RDG +LYC VPISIV   +GG  +V TLD   
Sbjct: 228 GEGEMGVDGGPPGDLYVQVAVREHSIFTRDGRNLYCEVPISIVDATLGGELEVPTLDG-R 286

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQTGK FRL+ KG+  +  G  GDL  +V VETP  L KRQ+ELLEEF+Q  
Sbjct: 287 VKLKIPPETQTGKLFRLRNKGVSPVRGGPAGDLLCRVIVETPVNLTKRQKELLEEFQQTL 346

Query: 361 SQDNN----PQSTGFFARMKDFFDSLK 383
             +N     P+ T +F  +K+FFD +K
Sbjct: 347 DGNNGTHHAPKKTSWFEGVKNFFDEMK 373


>gi|317046850|ref|YP_004114498.1| chaperone protein DnaJ [Pantoea sp. At-9b]
 gi|316948467|gb|ADU67942.1| chaperone protein DnaJ [Pantoea sp. At-9b]
          Length = 380

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+DFY++LG+ ++A +R++K A++ LAMKYHPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKSDFYEILGVSKSADEREIKKAYKRLAMKYHPDRNPGDKEAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G G  G +DFS++F  +FG I G GR  + +   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFG-GGGFGGGADFSDIFGDVFGDIFGGGRRQRAAR-- 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+G+G+V
Sbjct: 118 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV   K LSV +P GVD G RIRLS
Sbjct: 175 QMR-QGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVERSKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ +SVKKH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 234 GEGEAGEHGAPAGDLYVQVSVKKHPIFEREDNNLYCEVPINFAMAALGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G  GDL  +V VETP  LN +Q+ LL E E+  
Sbjct: 293 VKLKVPSETQTGKLFRMRGKGVKSVRGGAVGDLLCRVVVETPVSLNDKQKALLRELEESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 353 GGPTGEKNSPRSKSFFDGVKKFFDDL 378


>gi|163733014|ref|ZP_02140458.1| chaperone protein DnaJ [Roseobacter litoralis Och 149]
 gi|161393549|gb|EDQ17874.1| chaperone protein DnaJ [Roseobacter litoralis Och 149]
          Length = 384

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 261/385 (67%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+   +K  +R  A + HPD+N++DP A+ +F + +EAYEVL++ 
Sbjct: 1   MAKRDYYEVLGVSKGASSDDIKKGYRRKAKELHPDRNKDDPSAEAQFKEANEAYEVLKNA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+A YD+ GH A E G    G G  G G  GN DFS  F  +F  + G+     +    
Sbjct: 61  EKKAAYDRYGHAAFEGGMGGGGGGRPGGGFGGNQDFSSAFSDVFDDLFGNFAGGGQRGGG 120

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G+DLRYNL+ISLEEAF G    I  PT++ C+TC+GSGA+ G+ P  C  C+G G
Sbjct: 121 NRVSRGSDLRYNLQISLEEAFGGLQKTINVPTSIGCTTCNGSGAEGGSEPTSCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQII +PC  C G GRV +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCQGAGRVEKDRALSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V +H+ F+RDG +L+C VP+S+   A+GG+ +V T+D 
Sbjct: 240 LAGEGEAGMRGGPSGDLYIFIEVAEHELFQRDGTNLFCRVPVSMAKAALGGSIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EF++
Sbjct: 300 GRGRVQIPSGSQSGRQMRLRGKGMPALRGGSAGDMFIELAVETPVNLTSRQKELLAEFDE 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           + S++NNP+S+ FF+ +K F+DS+K
Sbjct: 360 L-SENNNPESSSFFSSVKSFWDSMK 383


>gi|296101194|ref|YP_003611340.1| chaperone Hsp40 [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295055653|gb|ADF60391.1| chaperone Hsp40 [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 381

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 254/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVPKTAEEREIKKAYKRLAMKFHPDRNQGDKEAEAKFKEIKEAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G      +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGGFGG-GADFSDIFGDVFGDIFGGGRGRQRAAR- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 119 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 176 -QMRQGFFAVQQACPHCHGRGTLIKDPCTKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLA 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 235 GEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL+E ++  
Sbjct: 294 VNLKIPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKELQESF 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 354 GGPTGEKNSPRSKSFFDGVKKFFDDL 379


>gi|16759006|ref|NP_454623.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16763403|ref|NP_459018.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29140556|ref|NP_803898.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|62178583|ref|YP_215000.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161612327|ref|YP_001586292.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167552158|ref|ZP_02345911.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167989860|ref|ZP_02570960.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230265|ref|ZP_02655323.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168234750|ref|ZP_02659808.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244484|ref|ZP_02669416.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168262329|ref|ZP_02684302.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168464463|ref|ZP_02698366.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168822157|ref|ZP_02834157.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194443702|ref|YP_002039241.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194451551|ref|YP_002043982.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194469219|ref|ZP_03075203.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194733969|ref|YP_002113022.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197250919|ref|YP_002144992.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197261782|ref|ZP_03161856.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|198243023|ref|YP_002213967.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|200386746|ref|ZP_03213358.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204927085|ref|ZP_03218287.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205351358|ref|YP_002225159.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207855528|ref|YP_002242179.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213052055|ref|ZP_03344933.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213426531|ref|ZP_03359281.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213616376|ref|ZP_03372202.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|213647263|ref|ZP_03377316.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213864898|ref|ZP_03387017.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|224581852|ref|YP_002635650.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238910770|ref|ZP_04654607.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289826140|ref|ZP_06545252.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|60392189|sp|P0A1G7|DNAJ_SALTY RecName: Full=Chaperone protein dnaJ
 gi|60392190|sp|P0A1G8|DNAJ_SALTI RecName: Full=Chaperone protein dnaJ
 gi|73919242|sp|Q57TP2|DNAJ_SALCH RecName: Full=Chaperone protein dnaJ
 gi|189083367|sp|A9MXI3|DNAJ_SALPB RecName: Full=Chaperone protein dnaJ
 gi|226735596|sp|B5F6Y9|DNAJ_SALA4 RecName: Full=Chaperone protein dnaJ
 gi|226735597|sp|B5FHA7|DNAJ_SALDC RecName: Full=Chaperone protein dnaJ
 gi|226735598|sp|B5R5I3|DNAJ_SALEP RecName: Full=Chaperone protein dnaJ
 gi|226735599|sp|B5RF09|DNAJ_SALG2 RecName: Full=Chaperone protein dnaJ
 gi|226735600|sp|B4TIB5|DNAJ_SALHS RecName: Full=Chaperone protein dnaJ
 gi|226735601|sp|B4T6D7|DNAJ_SALNS RecName: Full=Chaperone protein dnaJ
 gi|226735603|sp|B4TVZ6|DNAJ_SALSV RecName: Full=Chaperone protein dnaJ
 gi|254777974|sp|C0Q4F4|DNAJ_SALPC RecName: Full=Chaperone protein dnaJ
 gi|25296031|pir||AF0503 DnaJ protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|1389759|gb|AAB02911.1| DnaJ [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16418506|gb|AAL18977.1| heat shock protein DnaJ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16501296|emb|CAD01166.1| DnaJ protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29136180|gb|AAO67747.1| DnaJ protein [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|62126216|gb|AAX63919.1| heat shock protein, DnaJ and GrpE stimulates ATPase activity of
           DnaK [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161361691|gb|ABX65459.1| hypothetical protein SPAB_00015 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402365|gb|ACF62587.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194409855|gb|ACF70074.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194455583|gb|EDX44422.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194709471|gb|ACF88692.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633028|gb|EDX51482.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197214622|gb|ACH52019.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197240037|gb|EDY22657.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197292013|gb|EDY31363.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937539|gb|ACH74872.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199603844|gb|EDZ02389.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204323750|gb|EDZ08945.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205271139|emb|CAR35923.1| DnaJ protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205323117|gb|EDZ10956.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205331430|gb|EDZ18194.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205335216|gb|EDZ21980.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205336608|gb|EDZ23372.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205341422|gb|EDZ28186.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348796|gb|EDZ35427.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206707331|emb|CAR31603.1| DnaJ protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224466379|gb|ACN44209.1| DnaJ protein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|261245246|emb|CBG23031.1| DNAJ protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267991666|gb|ACY86551.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301156644|emb|CBW16114.1| DnaJ protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312910982|dbj|BAJ34956.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320089042|emb|CBY98798.1| Chaperone protein dnaJ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321222420|gb|EFX47492.1| Chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322615771|gb|EFY12691.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620619|gb|EFY17479.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322621752|gb|EFY18602.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322627478|gb|EFY24269.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322630784|gb|EFY27548.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322637996|gb|EFY34697.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641968|gb|EFY38582.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322645958|gb|EFY42476.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322651152|gb|EFY47537.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322656591|gb|EFY52879.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658750|gb|EFY55007.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322661807|gb|EFY58023.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322666446|gb|EFY62624.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672395|gb|EFY68507.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322676293|gb|EFY72364.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322679614|gb|EFY75659.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684325|gb|EFY80329.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322713031|gb|EFZ04602.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323128330|gb|ADX15760.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323191808|gb|EFZ77057.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198923|gb|EFZ84021.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323200989|gb|EFZ86058.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323209386|gb|EFZ94319.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323212925|gb|EFZ97727.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323216669|gb|EGA01394.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323219833|gb|EGA04312.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226101|gb|EGA10318.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323228754|gb|EGA12883.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236632|gb|EGA20708.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323239867|gb|EGA23914.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323242085|gb|EGA26114.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247474|gb|EGA31429.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323250575|gb|EGA34457.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323259305|gb|EGA42947.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263816|gb|EGA47337.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323265588|gb|EGA49084.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270034|gb|EGA53482.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326621709|gb|EGE28054.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326626377|gb|EGE32720.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332986964|gb|AEF05947.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 379

 Score =  365 bits (936), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 257/386 (66%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GGFG G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGFGGGFNGGADFSDIFGDVFGDIFGGGRGRQRAAR- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 117 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 174 -QMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL++ ++  
Sbjct: 292 VMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQKQLLKDLQESF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 352 GGPTGEKNSPRSKSFFDGVKKFFDDL 377


>gi|269137935|ref|YP_003294635.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Edwardsiella tarda EIB202]
 gi|267983595|gb|ACY83424.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Edwardsiella tarda EIB202]
 gi|304557985|gb|ADM40649.1| Chaperone protein DnaJ [Edwardsiella tarda FL6-60]
          Length = 378

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 252/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R A +R++K A++ LAMKYHPD+N+ D EA++KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAEDKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GG   G  G +DFS++F  +FG I G GR  + +   
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGGAGGFGGGADFSDIFGDVFGDIFGGGRRQRAAR-- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT V+C  C GSGAK G+ P+ C  C+G+G+V
Sbjct: 116 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLVECDVCHGSGAKKGSEPITCPTCHGAGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G II  PC+KCHG GR+ + K LSV +P GVD G RIRL+
Sbjct: 173 -QMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGVDTGDRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK H  F+R+  +L+C VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FR++G+G+  +  G +GDL  +V VETP  LN +Q++LL E E+  
Sbjct: 291 VKLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQKQLLRELEESF 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              +S  N+P+S  FF  +K FFD L
Sbjct: 351 GGPASDKNSPRSKRFFDGVKKFFDDL 376


>gi|261346449|ref|ZP_05974093.1| chaperone protein DnaJ [Providencia rustigianii DSM 4541]
 gi|282565435|gb|EFB70970.1| chaperone protein DnaJ [Providencia rustigianii DSM 4541]
          Length = 380

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 257/388 (66%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNR-NDPEAKEKFAQISEAYEVLRD 59
           M K DFY+VLG++RNATD+ +K A++ LAMK+HPD+N+ N  E++ KF +I EAYE+L D
Sbjct: 1   MAKRDFYEVLGLERNATDKDIKRAYKRLAMKHHPDRNQDNKDESEAKFKEIKEAYEILSD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF-SELFEGIFGGIMGSGRSYKRSS 118
            QKRA YDQ GH A E     QG  G G G +G  DF S++F  IFG I G GR  +R S
Sbjct: 61  EQKRAAYDQYGHAAFE-----QGGMGGGGGGFGGGDFNSDIFGDIFGDIFGGGRRQQRQS 115

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G+DL+YN+E++LEEA  G T +IR PT   C  C GSGAKPGT+   C+ C+G G
Sbjct: 116 R----GSDLQYNMELTLEEAVRGVTKEIRIPTLESCDVCHGSGAKPGTSADTCSTCHGMG 171

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V+   Q FFS+++ C TC G G++I  PC+KCHGQGRV + K LSV +P GVD G R+R
Sbjct: 172 QVHMR-QGFFSVQQPCPTCHGRGKVIKDPCNKCHGQGRVEKYKTLSVKIPAGVDTGDRVR 230

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG  G   GDL++ + V  H  F+RDG +L+C VPI+    A+GG  +V TLD 
Sbjct: 231 LSGEGEAGANGAPAGDLFVQMHVLPHDIFERDGNNLHCEVPINFAVAALGGEIEVPTLDG 290

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              ++ IP  TQTGK FR+KGKG+  +  G +GDL   + VETP KLN++Q+ELL+EF +
Sbjct: 291 -RVKLKIPAETQTGKTFRMKGKGVKSVRGGMQGDLMCHIVVETPVKLNEKQKELLKEFGE 349

Query: 359 ----ISSQDNNPQSTGFFARMKDFFDSL 382
                  + N+P+S  F   +K FFD L
Sbjct: 350 SLGGTGGEKNSPRSKRFLDGVKKFFDDL 377


>gi|197283925|ref|YP_002149797.1| chaperone protein DnaJ [Proteus mirabilis HI4320]
 gi|227358206|ref|ZP_03842547.1| chaperone protein DnaJ [Proteus mirabilis ATCC 29906]
 gi|226735588|sp|B4F2V6|DNAJ_PROMH RecName: Full=Chaperone protein dnaJ
 gi|194681412|emb|CAR40250.1| chaperone protein DnaJ [Proteus mirabilis HI4320]
 gi|227161542|gb|EEI46579.1| chaperone protein DnaJ [Proteus mirabilis ATCC 29906]
          Length = 378

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 253/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ + A ++++K A++ LAMKYHPD+N+ D +++ KF +I EAYEVL DP
Sbjct: 1   MAKRDFYEVLGLSKTADEKEIKRAYKRLAMKYHPDRNQGDKDSESKFKEIKEAYEVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G           G +G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGFGGQG----GGGFGGADFSDIFGDVFGDIFGGGRRQQRAAR- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DL+YN++++LEEA  G T +IR PT   C  C GSGAK GT+   C+ C+G+G+V
Sbjct: 116 ---GSDLQYNMDLTLEEAVRGITKEIRIPTLETCDKCHGSGAKEGTSAETCSTCHGAGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++ C TC G G++I  PCSKCHG GRV   K LSV +P GVD G RIRLS
Sbjct: 173 HLR-QGFFTVQQPCPTCHGRGKVIKEPCSKCHGDGRVERYKTLSVKIPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V++H  F+RDG +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGEQGAPAGDLYVQVHVRQHHIFERDGNNLYCEVPINFAVAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQTGK FR+KGKG+  + S   GDL  +V VETP KLN++Q++L+E+    F
Sbjct: 291 VKLKIPAETQTGKMFRMKGKGVKSVRSHGVGDLMCRVVVETPVKLNEKQKQLMEQLGESF 350

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                + N P+S  F   +K FFD L
Sbjct: 351 GGKGGEKNTPRSKSFLDGVKKFFDDL 376


>gi|146308638|ref|YP_001189103.1| chaperone protein DnaJ [Pseudomonas mendocina ymp]
 gi|189083348|sp|A4XYF5|DNAJ_PSEMY RecName: Full=Chaperone protein dnaJ
 gi|145576839|gb|ABP86371.1| chaperone protein DnaJ [Pseudomonas mendocina ymp]
          Length = 375

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 250/381 (65%), Gaps = 11/381 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R A++ +LK A+R LAMKYHPD+N +D  A+EKF + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGASEAELKKAYRRLAMKYHPDRNPDDKGAEEKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KR+ YDQ GH  ++      G        +G ++FS++F  +F    G       S   
Sbjct: 61  GKRSAYDQYGHAGVDPQMGGGGGA-----GFGGANFSDIFGDVFSDFFGG--GRGGSRGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE+ LEEA  G TV IR PT V C TC G+GAK GT+P+ C  C G G+V
Sbjct: 114 AQRGSDLRYTLELDLEEAVRGTTVTIRVPTLVGCKTCDGTGAKKGTSPVTCTTCGGIGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG++I  PC  CHGQGRV E K LSV VPPGVD G RIRLS
Sbjct: 174 -RMQQGFFSVQQTCPRCHGSGKMITDPCGSCHGQGRVEESKTLSVKVPPGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ ++V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 233 GEGEAGTHGGPAGDLYVVVNVREHAIFQRDGKHLYCEVPISFADAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGK FRL+GKG+  +  G  GDL  +V VETP  LNKRQRELL+EF +  
Sbjct: 292 VKLKIPEGTQTGKLFRLRGKGVAPVRGGAAGDLMCRVAVETPVNLNKRQRELLDEFRKSL 351

Query: 361 SQDN--NPQSTGFFARMKDFF 379
             D+  +P+++G+F  +K FF
Sbjct: 352 QGDDSHSPKASGWFEGVKRFF 372


>gi|297170566|gb|ADI21593.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [uncultured Oceanospirillales bacterium HF0130_06B06]
          Length = 372

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 255/386 (66%), Gaps = 18/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ R+A++ ++K A+R +AMK HPD+N ++ EA+++F + +EA+EVL D 
Sbjct: 1   MSKSDYYEILGVSRDASEAEIKKAYRRVAMKNHPDRNPDNKEAEDRFKEANEAFEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR  YDQ GH  +E G  SQG          ++DF ++F  IFG I G GR   RS   
Sbjct: 61  EKRTRYDQFGHAGVE-GQTSQG----------HADFGDIFGDIFGDIFGGGRGGSRSRVA 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLE+SLEEA  GKT +IR P+ V C  C+GSGAKPGT P+DC+ CNG G+V
Sbjct: 110 --KGADLRYNLELSLEEAVKGKTAKIRIPSTVNCEACNGSGAKPGTTPVDCSTCNGVGQV 167

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G+G++I  PC  C GQG V E K LSV VP GVD G RIRL+
Sbjct: 168 RMQ-QGFFSVQQTCPACHGAGKLIKDPCPNCRGQGFVEETKTLSVKVPAGVDTGDRIRLT 226

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG PGDLY+ + V+ HQ F+RDG DL+C +PIS V  A+GG  +V TLD   
Sbjct: 227 GEGQAGPRGGPPGDLYVEMHVQPHQIFQRDGRDLHCEIPISFVDAAIGGELEVPTLDG-R 285

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FRL+ KG+  I  G  GDL  +V +ETP  L  RQ+ELLEEF++I 
Sbjct: 286 VKLKIPAETQTGKLFRLRSKGVTSIRGGSPGDLLCRVVMETPVNLTNRQKELLEEFKEIY 345

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLK 383
               +  +P+   +F  +K F D L+
Sbjct: 346 ESQGKRQSPKRFSWFDGVKKFVDGLR 371


>gi|294634950|ref|ZP_06713468.1| chaperone protein DnaJ [Edwardsiella tarda ATCC 23685]
 gi|291091659|gb|EFE24220.1| chaperone protein DnaJ [Edwardsiella tarda ATCC 23685]
          Length = 377

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 253/386 (65%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R A +R++K A++ LAMKYHPD+N+ D EA++KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAEDKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G+   GA     G  G +DFS++F  +FG I G GR  + +   
Sbjct: 61  QKRAAYDQYGHAAFEQGSMGGGA----GGFGGGADFSDIFGDVFGDIFGGGRRQRAAR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+++SLEEA  G T +IR PT V+C  C GSGAK G+ P+ C  C+G+G+V
Sbjct: 115 ---GADLRYNMDLSLEEAVRGVTKEIRIPTLVECDVCHGSGAKKGSEPITCPTCHGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G II  PC+KCHG GR+ + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK H  F+R+  +L+C VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL E E+  
Sbjct: 290 VNLKIPAETQTGKMFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLNEKQKQLLRELEESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              +S  N+P+S  FF  +K FFD L
Sbjct: 350 GGPASDKNSPRSKRFFDGVKKFFDDL 375


>gi|227114261|ref|ZP_03827917.1| chaperone protein DnaJ [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 378

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 253/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ ++A +R++K A++ LAMKYHPD+N  D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYESLGVAKSADEREIKKAYKRLAMKYHPDRNPGDSEAEAKFKEIKEAYEILIDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GG G    G +DF ++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGGGGFGGGGADFGDIFGDVFGDIFGGGRRQRASR-- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G T +IR P   +C  C G+GAKPG++P+ C  C+G+G+V
Sbjct: 116 ---GSDLRYNMELTLEEAVRGVTKEIRIPALEECDVCHGNGAKPGSSPITCPTCHGNGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 173 -QMRQGFFTVQQACPHCHGRGKIIKDPCVKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGEHGAPSGDLYVQVQVKAHPIFQREENNLYCEVPINFAMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQR+LL+E ++  
Sbjct: 291 VKLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLNERQRQLLQELDESF 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 351 GGPSGERNSPRSKNFFDGVKKFFDDL 376


>gi|85705708|ref|ZP_01036805.1| chaperone protein DnaJ [Roseovarius sp. 217]
 gi|85669698|gb|EAQ24562.1| chaperone protein DnaJ [Roseovarius sp. 217]
          Length = 386

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 254/389 (65%), Gaps = 8/389 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+   +K A+R  A + HPD+N ++P+++ +F +  EAY+VL+D 
Sbjct: 1   MAKRDYYEVLGLSKGASADDIKKAYRKKAKELHPDRNSDNPDSERQFKEAGEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN-----SDFSELFEGIFGGIMGSGRSYK 115
           +K+A YD+ GH A E G  + GA   G           S FS++F+ +FG  MG G    
Sbjct: 61  EKKAAYDRFGHAAFEGGMGNGGARPGGYAGGAGQGDFASAFSDVFDDLFGDFMGGGGRGG 120

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                    ADLRYNL ++LEEA+SG    I+ P+AV C  C GSGA+ G  P  C  C+
Sbjct: 121 GRQRAARG-ADLRYNLRVTLEEAYSGLQKTIKVPSAVPCDACEGSGAEGGAQPTTCPTCS 179

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G G+V    Q FF++ER C TC G GQII +PC  C GQGRV +++ LSVN+P GV+ GT
Sbjct: 180 GMGKVRAQ-QGFFTVERTCPTCGGLGQIIKNPCKVCQGQGRVQKDRALSVNIPAGVETGT 238

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIRL+GEG AG+ GG  GDLYIFI V KH  F+RD  +L+C VP+S+   A+GG  +V T
Sbjct: 239 RIRLAGEGEAGMRGGPAGDLYIFIDVAKHDLFERDDTNLFCRVPVSMTKAALGGDIEVPT 298

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           +D   SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  RQ ELL E
Sbjct: 299 IDGGRSRVKIPPGSQSGRQMRLRAKGMPALRGGTHGDMFIEMAVETPVNLTARQTELLRE 358

Query: 356 FEQISSQDNNPQSTGFFARMKDFFDSLKN 384
           FE + S+DNNP+S  FF+ ++ F+DS+K+
Sbjct: 359 FEAL-SEDNNPESKSFFSSVRSFWDSMKS 386


>gi|261823086|ref|YP_003261192.1| chaperone protein DnaJ [Pectobacterium wasabiae WPP163]
 gi|261607099|gb|ACX89585.1| chaperone protein DnaJ [Pectobacterium wasabiae WPP163]
          Length = 378

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 253/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ ++A +R++K A++ LAMKYHPD+N  D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYESLGVAKSADEREIKKAYKRLAMKYHPDRNPGDSEAEAKFKEIKEAYEILIDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GG G    G +DF ++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGGGGFGGGGADFGDIFGDVFGDIFGGGRRQRASR-- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G T +IR P   +C  C G+GAKPG++P+ C  C+G+G+V
Sbjct: 116 ---GSDLRYNMELTLEEAVRGVTKEIRIPALEECDVCHGNGAKPGSSPVTCPTCHGNGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 173 -QMRQGFFTVQQACPHCHGRGKIIKDPCVKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGEHGAPSGDLYVQVQVKAHPIFQREENNLYCEVPINFAMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQR+LL+E ++  
Sbjct: 291 VKLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLNERQRQLLQELDESF 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 351 GGPSGERNSPRSKNFFDGVKKFFDDL 376


>gi|110677778|ref|YP_680785.1| chaperone protein DnaJ [Roseobacter denitrificans OCh 114]
 gi|123362353|sp|Q16D44|DNAJ_ROSDO RecName: Full=Chaperone protein dnaJ
 gi|109453894|gb|ABG30099.1| chaperone protein DnaJ [Roseobacter denitrificans OCh 114]
          Length = 384

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 260/385 (67%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+   +K  +R  A + HPD+N++DP A+ +F + +EAYEVL+D 
Sbjct: 1   MAKRDYYEVLGVSKGASSDDIKKGYRRKAKELHPDRNKDDPNAEAQFKEANEAYEVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YD+ GH A E G    G G  G G  G  DFS  F  +F  + G+     +    
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGGGRPGGGFGGGQDFSSAFSDVFDDLFGNFAGGGQRGGG 120

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
             A  G+DLRYNL+I+LE+AFSG    I  PT++ C TC+GSGA+ G+ P  C  C+G G
Sbjct: 121 NRASRGSDLRYNLQINLEDAFSGLQKTINVPTSIGCKTCNGSGAEGGSEPSSCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQII +PC  C G GRV +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCQGAGRVEKDRALSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V +H+ F+RDG +L+C VP+S+   A+GG+ +V T+D 
Sbjct: 240 LAGEGEAGMRGGPSGDLYIFIEVAEHELFQRDGTNLFCRVPVSMAKAALGGSIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EF++
Sbjct: 300 GRGRVQIPSGSQSGRQMRLRGKGMPALRGGSSGDMFIELAVETPVNLTSRQKELLAEFDE 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           + S++NNP+S+ FF+ +K F+DS+K
Sbjct: 360 L-SENNNPESSSFFSSVKSFWDSMK 383


>gi|73666638|ref|YP_302654.1| heat shock protein DnaJ [Ehrlichia canis str. Jake]
 gi|123615215|sp|Q3YT99|DNAJ_EHRCJ RecName: Full=Chaperone protein dnaJ
 gi|72393779|gb|AAZ68056.1| Heat shock protein DnaJ [Ehrlichia canis str. Jake]
          Length = 382

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 271/385 (70%), Gaps = 5/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ +NAT  ++K A+R +A+KYHPD N  + EA+EKF ++SEAY+VL D 
Sbjct: 1   MSKSDYYELLGVSKNATSEEIKKAYRKMALKYHPDTNPGNKEAEEKFKELSEAYDVLIDQ 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A + GA  +G   F +G  G  DFS++F  +FGG  GS      S  +
Sbjct: 61  DKRAAYDKYGHNAFD-GAAGRGGFDFNSGFSG--DFSDIFNDLFGGGFGSRGGRGSSRRS 117

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
            G AG+DLR+++EI+LE++F+GK V I + T VKCS+CSGSG++     + CN C+G+G 
Sbjct: 118 EGAAGSDLRFDVEITLEDSFNGKKVPISYVTYVKCSSCSGSGSEGSAKSVQCNTCHGAGS 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V  T Q FF+IER C  C G G+II + C KC G GRV +E  L V +P G++ G +IRL
Sbjct: 178 V-RTQQGFFTIERTCHVCNGEGEIIQNKCKKCSGSGRVRDEVNLLVTIPKGIESGNKIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +G+G AG  G   GDLY++ +++KH+FF R G DLYCTVPI +   A+GG  ++ ++D T
Sbjct: 237 NGKGEAGYRGARSGDLYVYSNIQKHKFFTRSGPDLYCTVPIKMTLAALGGHIEMPSIDGT 296

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            ++V +PEG+Q+G + RLK KGMPVINS ++GD+Y+Q+ VETP KL K+Q+ELL++F+  
Sbjct: 297 WTKVKVPEGSQSGDKLRLKEKGMPVINSSKRGDMYIQITVETPVKLTKKQKELLQKFDDE 356

Query: 360 SSQDNNPQSTGFFARMKDFFDSLKN 384
            + D NPQSTGFF ++K F+  +++
Sbjct: 357 PNVDCNPQSTGFFQKVKSFWKDIRS 381


>gi|56478149|ref|YP_159738.1| chaperone protein DnaJ [Aromatoleum aromaticum EbN1]
 gi|62900070|sp|Q5P1H7|DNAJ2_AZOSE RecName: Full=Chaperone protein dnaJ 2
 gi|56314192|emb|CAI08837.1| Chaperone protein DnaJ [Aromatoleum aromaticum EbN1]
          Length = 376

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 248/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A+D ++K A+R LAMK+HPD+N ++ ++++ F +   AYE+L D 
Sbjct: 1   MAKRDYYEVLGVNRDASDNEIKKAYRKLAMKHHPDRNPDNKDSEDHFKEAKNAYEILSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH  ++    S GAG  G G  G   F++ F  IFG I G      R  S 
Sbjct: 61  QKRAAYDRYGHAGVD---PSAGAGPGGQGFDG---FADAFSDIFGDIFGGAGGAGRGRSN 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEISLEEA  G    IR PT  +C TC GSGAKPGT P  C  C G+G+V
Sbjct: 115 VYRGADLRYNLEISLEEAARGADKTIRIPTVEECETCHGSGAKPGTQPKPCPTCGGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C G+G+IIP PC  C G GRV  +K L V +P G+D+G R+R +
Sbjct: 175 RIQ-QGFFSIQQTCPKCHGTGRIIPDPCRDCGGAGRVKRQKTLEVKIPAGIDEGMRLRHA 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  GV GG PGDLY+ I ++ H  F+RD  DL+C +PISI T A+GG  ++ TL+   
Sbjct: 234 GHGEPGVNGGPPGDLYVEIHIRAHPVFQRDHDDLHCEMPISITTAALGGEIEIPTLEGM- 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+ IP  TQ+GK FRL+GKG+  + S   GDL   V VETP  L +RQ+ELL EFE++S
Sbjct: 293 ARLKIPAETQSGKVFRLRGKGIRNVRSQAHGDLMCHVVVETPVNLTERQKELLREFEEVS 352

Query: 361 SQD---NNPQSTGFFARMKDFF 379
           S D   +NP++  +  ++KDFF
Sbjct: 353 SSDADRHNPKAKSWMDKVKDFF 374


>gi|292489411|ref|YP_003532298.1| chaperone protein dnaJ [Erwinia amylovora CFBP1430]
 gi|292898371|ref|YP_003537740.1| chaperone protein [Erwinia amylovora ATCC 49946]
 gi|291198219|emb|CBJ45325.1| chaperone protein (heat shock protein J) [Erwinia amylovora ATCC
           49946]
 gi|291554845|emb|CBA22722.1| Chaperone protein dnaJ [Erwinia amylovora CFBP1430]
 gi|312173576|emb|CBX81830.1| Chaperone protein dnaJ [Erwinia amylovora ATCC BAA-2158]
          Length = 381

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 253/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMK+HPD+N+ D E++ KF +I EAYE+L D 
Sbjct: 1   MAKRDYYEILGVAKSADEREIKKAYKRLAMKFHPDRNQGDKESEGKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G    +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGHGGFGGGG-GADFSDIFGDVFGDIFGGGRRQQRAAR- 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G + +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 119 ---GADLRYNMELSLEEAVRGVSKEIRIPTLEECGVCHGSGAKAGTKPQTCSTCHGAGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC+ CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 176 -QMRQGFFTVQQACPACHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V+KH  F+R+  +LYC VPI+ V  A+GG  +V TLD   
Sbjct: 235 GEGEAGEQGAPAGDLYVQVQVRKHHIFEREENNLYCEVPINFVMAALGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q+ LL E ++  
Sbjct: 294 VNLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVSLNEKQKALLRELDESF 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 354 GGPSGEKNSPRSKTFFDGVKKFFDDL 379


>gi|253690019|ref|YP_003019209.1| chaperone protein DnaJ [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645278|sp|C6DF09|DNAJ_PECCP RecName: Full=Chaperone protein dnaJ
 gi|251756597|gb|ACT14673.1| chaperone protein DnaJ [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 378

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 252/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ ++A +R++K A++ LAMKYHPD+N  D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYESLGVAKSADEREIKKAYKRLAMKYHPDRNPGDSEAEAKFKEIKEAYEILIDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    G  G    G +DF ++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGSGGGFGGGGADFGDIFGDVFGDIFGGGRRQRASR-- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G T +IR P   +C  C G+GAKPG++P+ C  C+G+G+V
Sbjct: 116 ---GSDLRYNMELTLEEAVRGVTKEIRIPALEECDVCHGNGAKPGSSPITCPTCHGNGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 173 -QMRQGFFTVQQACPHCHGRGKIIKDPCVKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 GEGEAGEHGAPSGDLYVQVQVKAHPIFQREENNLYCEVPINFAMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQR+LL+E ++  
Sbjct: 291 VKLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLNERQRQLLQELDESF 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 351 GGPSGERNSPRSKSFFDGVKKFFDDL 376


>gi|50122802|ref|YP_051969.1| chaperone protein DnaJ [Pectobacterium atrosepticum SCRI1043]
 gi|62899951|sp|Q6D0B8|DNAJ_ERWCT RecName: Full=Chaperone protein dnaJ
 gi|49613328|emb|CAG76779.1| chaperone protein DnaJ [Pectobacterium atrosepticum SCRI1043]
          Length = 379

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 253/386 (65%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ ++A DR++K A++ LAMKYHPD+N  D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYESLGVAKSADDREIKKAYKRLAMKYHPDRNPGDSEAEAKFKEIKEAYEILIDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G GG      G +DF ++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGGG--GFGGGGADFGDIFGDVFGDIFGGGRRQRASR-- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G T +IR P   +C  C G+GAKPG++P+ C  C+G+G+V
Sbjct: 117 ---GSDLRYNMELSLEEAVRGVTKEIRIPALEECDVCHGNGAKPGSSPITCPTCHGNGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 174 -QMRQGFFTVQQACPHCHGRGKIIKDPCIKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGDHGAPSGDLYVQVQVKAHPIFQREENNLYCEVPINFAMAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQR+LL+E ++  
Sbjct: 292 VKLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLNERQRQLLQELDESF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 352 GGPSGERNSPRSKNFFDGVKKFFDDL 377


>gi|332532976|ref|ZP_08408848.1| chaperone protein DnaJ [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037642|gb|EGI74094.1| chaperone protein DnaJ [Pseudoalteromonas haloplanktis ANT/505]
          Length = 379

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 249/385 (64%), Gaps = 11/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ ++A++R +K A++ LAMKYHPD+   D E + KF ++ EAYE+L DP
Sbjct: 1   MSKRDYYEALGVSKDASERDIKKAYKRLAMKYHPDRTAGDKELETKFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR +YDQ GH A E G      G  G        F ++F  IFG          R  S 
Sbjct: 61  QKRQMYDQHGHAAFEQGGGGGHGGFGGGHGDFGDVFGDVFGDIFG------GGGGRRQSR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+++SLEEA  GK V+I+ PT V C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 115 QQRGSDLRYNMDLSLEEAVRGKEVEIKVPTWVGCEPCDGSGAKAGSKPKTCTTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC+G GQII  PC+KCHGQGRV + K LSV +P GVD G RIRL+
Sbjct: 175 -QMRQGFFAVQQTCPTCQGQGQIISDPCNKCHGQGRVEKTKTLSVKIPAGVDTGDRIRLT 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G   GDLY+ +SV++H+ F R+  +LYC VPIS  T  +GG   V TLD   
Sbjct: 234 GEGEAGMHGAPSGDLYVQVSVREHEIFVREANNLYCEVPISFTTAGLGGEIQVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
           +++ IP  TQTGK FR++GKG+  + SG +GDL  +V +ETP  LN+RQRELL+E ++  
Sbjct: 293 AKLKIPSETQTGKMFRMRGKGVKSVRSGAQGDLICKVVIETPVNLNERQRELLQELDESM 352

Query: 359 -ISSQDNNPQSTGFFARMKDFFDSL 382
              S  N P+  GFF  +K FFD L
Sbjct: 353 GTDSSKNRPKEQGFFDGVKKFFDDL 377


>gi|220934149|ref|YP_002513048.1| chaperone protein DnaJ [Thioalkalivibrio sp. HL-EbGR7]
 gi|254777979|sp|B8GNX2|DNAJ_THISH RecName: Full=Chaperone protein dnaJ
 gi|219995459|gb|ACL72061.1| chaperone protein DnaJ [Thioalkalivibrio sp. HL-EbGR7]
          Length = 377

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 247/386 (63%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ +NA++ +LK AFR LAMK+HPD+N  D E++EKF +  EAYE+L DP
Sbjct: 1   MAKRDYYEILGVAKNASEAELKKAFRRLAMKHHPDRNPGDKESEEKFKEAKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A             G + FS++FE IFG I       +   S 
Sbjct: 61  QKRAAYDQFGHAGVDPSAGGG--------ARGGASFSDIFEDIFGDIF---GGGRGGGSR 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DL+YNLE++LEEA  G  V+IR P+ V+C  C GSGA+ GT P  C  C G G+V
Sbjct: 110 VYRGSDLQYNLELTLEEAVFGTEVKIRVPSLVECGECHGSGAEKGTTPETCGTCGGVGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G+G++I HPC  CHGQGRV E K LSV VP GVD G RIRLS
Sbjct: 170 RMQ-QGFFSVQQTCPRCHGTGKMITHPCKACHGQGRVEEHKTLSVKVPAGVDSGDRIRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG PGDLY+ I VK H+ F R G DL C VPIS  T A+GG  ++ TLD   
Sbjct: 229 GEGEAGINGGPPGDLYVQIHVKAHKLFTRKGNDLMCEVPISFATAALGGELEIPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + IPE TQ+G+ FRL+ KG+  ++ G +GDL  +V VETP  L KRQ+ELL+E ++  
Sbjct: 288 VNLKIPEETQSGRLFRLRAKGVKSVHGGAQGDLICRVSVETPVNLTKRQKELLKELDETM 347

Query: 361 S---QDNNPQSTGFFARMKDFFDSLK 383
                 ++PQ  G+   +K FF+ LK
Sbjct: 348 KAGGTRHSPQEEGWLDGVKGFFEDLK 373


>gi|56412288|ref|YP_149363.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197361225|ref|YP_002140860.1| chaperone protein DnaJ [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|62899928|sp|Q5PDJ4|DNAJ_SALPA RecName: Full=Chaperone protein dnaJ
 gi|226735602|sp|B5BLH9|DNAJ_SALPK RecName: Full=Chaperone protein dnaJ
 gi|56126545|gb|AAV76051.1| DnaJ protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|197092700|emb|CAR58120.1| DnaJ protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
          Length = 375

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 253/386 (65%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G           G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMG-------GGFNGGADFSDIFGDVFGDIFGGGRGRQRAAR- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 113 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 170 -QMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 229 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL++ ++  
Sbjct: 288 VMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQKQLLKDLQESF 347

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 348 GGPTGEKNSPRSKSFFDGVKKFFDDL 373


>gi|114769787|ref|ZP_01447397.1| chaperone protein DnaJ [alpha proteobacterium HTCC2255]
 gi|114549492|gb|EAU52374.1| chaperone protein DnaJ [alpha proteobacterium HTCC2255]
          Length = 377

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 181/380 (47%), Positives = 253/380 (66%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ + A++ ++K  FR  AM+ HPD+N++DP A+ KF + +EAY+VL+D 
Sbjct: 1   MSKRDYYETLGLSKGASESEIKKGFRKKAMELHPDRNQDDPSAESKFKEANEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGA-GGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
            K+A YDQ GH A E G    G+   FG G   NS FS++F+ +FG   G  R     +S
Sbjct: 61  DKKAAYDQYGHAAFEGGMGGGGSRSPFGGGGDFNSAFSDVFDDLFGNFGGGQRGGPPGAS 120

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
            G   +DLRYNL++SL +A++GK   +   ++V C  CSGSGA  G+ P  C  C+G G+
Sbjct: 121 RG---SDLRYNLKVSLSDAYNGKQETVSVNSSVSCDGCSGSGAAAGSEPARCPTCSGMGK 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C TC G G+ I +PC  C+G G    E+ LSVN+P GV+ GTRIRL
Sbjct: 178 VRAQ-QGFFTVERTCPTCSGRGETITNPCKVCNGTGATQRERSLSVNIPAGVERGTRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLYIFI +  H+ F+R+G +L+  VP+S+ T A+GG  DV  +D  
Sbjct: 237 SGEGEAGQRGGPTGDLYIFIDIDDHELFEREGNNLFLRVPVSMATAALGGEIDVPNIDGN 296

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            SRV +P G Q GKQ RLKGKGMP +    KGDLY+++ VETP  L+ +Q+ELL+EFE++
Sbjct: 297 TSRVKVPMGAQAGKQMRLKGKGMPALRGSGKGDLYLEIAVETPVNLSSKQKELLKEFEEL 356

Query: 360 SSQDNNPQSTGFFARMKDFF 379
           S+ D+NP+S  FF+++K F+
Sbjct: 357 SA-DSNPESKNFFSKVKSFW 375


>gi|188532853|ref|YP_001906650.1| Chaperone protein DnaJ [Erwinia tasmaniensis Et1/99]
 gi|226735570|sp|B2VGS0|DNAJ_ERWT9 RecName: Full=Chaperone protein dnaJ
 gi|188027895|emb|CAO95752.1| Chaperone protein DnaJ [Erwinia tasmaniensis Et1/99]
          Length = 380

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMK+HPD+N+ D E++ KF +I EAYE+L D 
Sbjct: 1   MAKRDYYEILGVAKSADEREIKKAYKRLAMKFHPDRNQGDKESEGKFKEIKEAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G    G    G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG--HGGFGGGGADFSDIFGDVFGDIFGGGRRQQRAAR- 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G + +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 118 ---GADLRYNMELTLEEAVRGVSKEIRIPTLEECGVCHGSGAKAGTKPQTCSTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V+KH  F+R+  +LYC VPI+ V  A+GG  +V TLD   
Sbjct: 234 GEGEAGEQGAPAGDLYVQVQVRKHHIFEREENNLYCEVPINFVMAALGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q+ LL E ++  
Sbjct: 293 VNLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVSLNEKQKTLLRELDESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 353 GGPSGEKNSPRSKTFFDGVKKFFDDL 378


>gi|126724640|ref|ZP_01740483.1| Chaperone, DnaJ [Rhodobacterales bacterium HTCC2150]
 gi|126705804|gb|EBA04894.1| Chaperone, DnaJ [Rhodobacterales bacterium HTCC2150]
          Length = 384

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 176/385 (45%), Positives = 256/385 (66%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A    +K AFR+ A + HPD+N ++P+A+ +F + +EA+++L+DP
Sbjct: 1   MAKRDYYDVLGLSKGADPAAIKKAFRTKAKELHPDRNTDNPDAEAQFKEANEAHDILKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMG--SGRSYKRSS 118
           +K+A YD+ GH A E G  +    G   G +G  DF+  F  +F  + G  SG       
Sbjct: 61  EKKAAYDRYGHAAFEGGTGASAGHGQRGGFHGGGDFASAFSDVFDDLFGDFSGGRGGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G+DLRYN+ ++LEEAF+G+   I  PT+V C  C+G+GA+ G  P++C  C+G G
Sbjct: 121 QRATRGSDLRYNMRVTLEEAFAGQQKTISVPTSVSCDGCNGTGAEGGAEPVNCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQII +PC  C G GRV +E+ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGVGQIIKNPCRSCSGAGRVQKERSLSVNIPGGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG+ GG  GDLYIF+ VK+H  FKR+   L+C VP+S+   A+GG  +V  +D 
Sbjct: 240 LSGEGEAGMRGGPSGDLYIFMDVKEHSIFKRESEHLFCEVPVSMAAAALGGEVEVPIIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  +Q+EL+EEF++
Sbjct: 300 GRSRVKIPAGSQSGRQMRLRNKGMPHLRGGGSGDMFIELAVETPVNLTAKQKELMEEFQE 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           + S+DNNP  + FF+ +K F+D++K
Sbjct: 360 L-SKDNNPGVSKFFSSVKSFWDTMK 383


>gi|311280998|ref|YP_003943229.1| chaperone protein DnaJ [Enterobacter cloacae SCF1]
 gi|308750193|gb|ADO49945.1| chaperone protein DnaJ [Enterobacter cloacae SCF1]
          Length = 380

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 255/386 (66%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVSKTAEEREIKKAYKRLAMKFHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G   FG G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG--FGGGFNGGADFSDIFGDVFGDIFGGGRGRQRAAR- 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 118 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKSGTQPQTCPTCHGSGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 175 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLA 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 234 GEGEAGEHGAPAGDLYVQVQVKQHAIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q+ LL+E ++  
Sbjct: 293 VNLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKHLLKELQESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 353 GGPTGEKNSPRSKSFFDGVKKFFDDL 378


>gi|194434140|ref|ZP_03066408.1| chaperone protein DnaJ [Shigella dysenteriae 1012]
 gi|194417577|gb|EDX33678.1| chaperone protein DnaJ [Shigella dysenteriae 1012]
 gi|320177662|gb|EFW52651.1| Chaperone protein DnaJ [Shigella boydii ATCC 9905]
 gi|332095297|gb|EGJ00320.1| chaperone protein DnaJ [Shigella boydii 5216-82]
 gi|332097964|gb|EGJ02937.1| chaperone protein DnaJ [Shigella dysenteriae 155-74]
          Length = 376

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 254/386 (65%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G         G +DF ++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG------FGGGADFGDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN++Q++LL+E ++  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESF 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|16124267|ref|NP_418831.1| DnaJ family protein [Caulobacter crescentus CB15]
 gi|221232950|ref|YP_002515386.1| chaperone protein DnaJ [Caulobacter crescentus NA1000]
 gi|13637789|sp|P22305|DNAJ_CAUCR RecName: Full=Chaperone protein dnaJ
 gi|13421099|gb|AAK21999.1| dnaJ protein [Caulobacter crescentus CB15]
 gi|220962122|gb|ACL93478.1| chaperone protein DnaJ [Caulobacter crescentus NA1000]
          Length = 385

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 246/385 (63%), Gaps = 12/385 (3%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++LG+ R   +  LK+AFR LAM++HPD+N     A  +F +I+EAY VL DPQKRA
Sbjct: 3   DYYEILGVTRTIDEAGLKSAFRKLAMEHHPDRNGGCENAAGRFKEINEAYSVLSDPQKRA 62

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH  +       G  G       +  F+++F  +FG + G GR   R S+  + G
Sbjct: 63  AYDRFGHAGVNGPQGGPGGFGGQG-FDASDIFNDVFGDVFGEMFGGGR---RQSNAPQRG 118

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
            DLRY+LEI+LE+A++G  V+I  P A+ C  C GSGAKPGT+P  C  C G+GRV  T 
Sbjct: 119 QDLRYDLEITLEQAYAGAEVEITVPAAMTCEVCEGSGAKPGTSPSVCGTCGGAGRVRAT- 177

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF++ER C  C GSG+++  PCS CHG G+V  E++LSV +P GVDDG RIRL+GEG 
Sbjct: 178 QGFFAVERGCPRCGGSGRLVLDPCSNCHGHGQVRRERILSVRIPAGVDDGARIRLAGEGD 237

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS--- 301
           AG  GG  GDLYIF+SV  H+ F+RDG DL CTVP+ + T A+GG  D   L    S   
Sbjct: 238 AGARGGPRGDLYIFLSVTPHELFERDGLDLLCTVPVPMTTAALGGEIDAPCLLGGESCDG 297

Query: 302 ----RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               +V +PEG QTGK  RLKGKGMP + S ++GDL V++ VETP  L+ RQ+EL+ E  
Sbjct: 298 ECKVKVHVPEGAQTGKTVRLKGKGMPSLRSRQRGDLVVELFVETPTHLSARQKELMRELA 357

Query: 358 QISSQDNNPQSTGFFARMKDFFDSL 382
            +  +  NP+S  F  + K F++ +
Sbjct: 358 GLCGEKQNPKSANFVGKAKRFWEEV 382


>gi|161504854|ref|YP_001571966.1| chaperone protein DnaJ [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189083366|sp|A9MR76|DNAJ_SALAR RecName: Full=Chaperone protein dnaJ
 gi|160866201|gb|ABX22824.1| hypothetical protein SARI_02979 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 375

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 253/386 (65%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A +R++K A++ LAMKYHPD+N+ D EA+ KF +I  AYEVL D 
Sbjct: 1   MAKRDYYEVLGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKAAYEVLTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G           G  G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMG-------GGFNGGADFSDIFGDVFGDIFGGGRGRQRAAR- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK GT P  C  C+GSG+V
Sbjct: 113 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 170 -QMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 229 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL++ ++  
Sbjct: 288 VKLKVPSETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVGLSEKQKQLLKDLQESF 347

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 348 GGPTGEKNSPRSKSFFDGVKKFFDDL 373


>gi|149912941|ref|ZP_01901475.1| chaperone protein DnaJ [Roseobacter sp. AzwK-3b]
 gi|149813347|gb|EDM73173.1| chaperone protein DnaJ [Roseobacter sp. AzwK-3b]
          Length = 385

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 262/389 (67%), Gaps = 9/389 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLGI R A+  ++K A+R+ A + HPD+N+++P A+ +F +  EAY+VL+DP
Sbjct: 1   MAKRDYYEVLGISRGASADEIKKAYRTKAKELHPDRNKDNPNAETQFKEAGEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN-----SDFSELFEGIFGGIMGSGRSYK 115
            K+A YD+ GH A + G    G    G           S FS++F+ +FG  MG   S  
Sbjct: 61  DKKAAYDRFGHAAFDGGMGGGGPRPGGGFGGAGQGDFASAFSDVFDDLFGDFMGGRGSGG 120

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
           R  +    GADLRYNL ++LE+A+ G    I  PT+V C  C+G+GA+ G+ P  C  C+
Sbjct: 121 RQRAA--RGADLRYNLRVTLEDAYKGIQKTINVPTSVACGECNGTGAEGGSEPTTCPTCS 178

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G G+V    Q FF++ER C TC G GQII +PC+ CHGQGRV +++ L+VN+P GV+ GT
Sbjct: 179 GMGKVRAQ-QGFFTVERTCPTCSGLGQIIKNPCNACHGQGRVDKDRALNVNIPAGVETGT 237

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIRL+GEG AG+ GG PGDLYIFI V KH+ F+R+  +L+C VP+S+   A+GG  +V T
Sbjct: 238 RIRLAGEGEAGMRGGPPGDLYIFIEVAKHEIFEREETNLFCRVPVSMTAAALGGDIEVPT 297

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           +D   SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  RQ+ELL E
Sbjct: 298 IDGGRSRVKIPAGSQSGRQMRLRNKGMPALRGGATGDMFIELAVETPVNLTSRQKELLRE 357

Query: 356 FEQISSQDNNPQSTGFFARMKDFFDSLKN 384
           FE + S+DNNP+S  FF+ +K F+DS+K+
Sbjct: 358 FEAL-SEDNNPESKSFFSSVKSFWDSMKS 385


>gi|300715257|ref|YP_003740060.1| Chaperone protein DnaJ [Erwinia billingiae Eb661]
 gi|299061093|emb|CAX58200.1| Chaperone protein DnaJ [Erwinia billingiae Eb661]
          Length = 379

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 252/386 (65%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMK HPD+N  D E++ KF ++ EAYE+L D 
Sbjct: 1   MAKQDYYEILGVSKSADEREIKKAYKRLAMKLHPDRNPGDKESEAKFKEVKEAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    GG G    G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFE---QGGMGGGGGGFGGGGADFSDIFGDVFGDIFGGGRRQQRAAR- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G + +IR PT  +C  C GSGAK GT P  C  C+G G+V
Sbjct: 117 ---GADLRYNMELTLEEAVRGVSKEIRIPTLEECEVCDGSGAKAGTKPQTCGTCHGQGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G +I  PC+ CHG GRV + K LSV +P GVD G RIRL+
Sbjct: 174 QMR-QGFFTVQQACPTCHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLT 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + V+KH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGEHGAPAGDLYVQVQVRKHPIFEREENNLYCEVPINFAMAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++ KG+  +  G +GDL  +V VETP  LN++Q+ LL+E E+  
Sbjct: 292 VKLKVPAETQTGKLFRMRSKGVKSVRGGAQGDLLCRVVVETPVSLNEKQKALLQELEESF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 352 GGPSGEKNSPRSKSFFDGVKKFFDDL 377


>gi|56479584|ref|NP_705974.2| chaperone protein DnaJ [Shigella flexneri 2a str. 301]
 gi|62899991|sp|Q7UDU1|DNAJ_SHIFL RecName: Full=Chaperone protein dnaJ
 gi|56383135|gb|AAN41681.2| chaperone with DnaK; heat shock protein [Shigella flexneri 2a str.
           301]
          Length = 376

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 252/386 (65%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D 
Sbjct: 1   MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRGRQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V
Sbjct: 114 ---GADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+KCHG GRV   K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VET   L+++ ++LL E  +  
Sbjct: 289 VKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETQIGLDEKDKQLLHELHESY 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 349 GGPTGEHNSPRSKSFFDGVKKFFDDL 374


>gi|119468696|ref|ZP_01611748.1| Chaperone protein dnaJ (Heat shock protein J) (HSP40), co-chaperone
           with DnaK [Alteromonadales bacterium TW-7]
 gi|119447752|gb|EAW29018.1| Chaperone protein dnaJ (Heat shock protein J) (HSP40), co-chaperone
           with DnaK [Alteromonadales bacterium TW-7]
          Length = 379

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 248/385 (64%), Gaps = 11/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A++R +K A++ LAMKYHPD+   D E + KF ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVSKDASERDIKKAYKRLAMKYHPDRTAGDKELETKFKEVKEAYEILTDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR +YDQ GH A E G      G  G        F ++F  IFG          R  S 
Sbjct: 61  QKRQMYDQYGHAAFEQGGGGGHGGFGGGHGDFGDVFGDVFGDIFG------GGGGRRQSR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN++++LEEA  GK V+I+ PT V C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 115 QQRGSDLRYNMDLTLEEAVRGKEVEIKVPTWVSCDPCDGSGAKAGSKPKTCTTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC+G GQII  PC+ CHGQGRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFAVQQTCPTCQGQGQIISDPCNSCHGQGRVEKTKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV+G   GDLY+ +SV++H  F R+G +LYC VPIS  T  +GG   V TLD   
Sbjct: 234 GEGEAGVHGAPAGDLYVQVSVREHDIFVREGNNLYCEVPISFTTSGLGGEIQVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
           +++ IP  TQTGK FR++GKG+  + SG +GDL  +V +ETP  LN+RQRELL+E E+  
Sbjct: 293 AKLKIPSETQTGKMFRMRGKGVKSVRSGAQGDLICKVVIETPVNLNERQRELLKELEESM 352

Query: 359 -ISSQDNNPQSTGFFARMKDFFDSL 382
              S  N P+  GFF  +K FFD L
Sbjct: 353 GTDSSKNRPKEQGFFDGVKKFFDDL 377


>gi|56460093|ref|YP_155374.1| DnaJ molecular chaperone [Idiomarina loihiensis L2TR]
 gi|62899929|sp|Q5QXL2|DNAJ_IDILO RecName: Full=Chaperone protein dnaJ
 gi|56179103|gb|AAV81825.1| DnaJ molecular chaperone [Idiomarina loihiensis L2TR]
          Length = 384

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 252/389 (64%), Gaps = 10/389 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFYQVLG+ ++A +R +K A++ +AMKYHPD+   D + + KF +I +AYEVL DP
Sbjct: 1   MATQDFYQVLGVSKDANERDIKKAYKRMAMKYHPDRTEGDKDMEIKFKEIKQAYEVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR +YDQ GHEA E   Q     G G    G +DF+++F  +FG I G GR   R  + 
Sbjct: 61  QKRQMYDQYGHEAFEQARQGGAGHGAGGFGGGGADFADIFGDVFGDIFGGGR---RQQAR 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYNL++SLEEA  GKTV++  PT V+C  C+GSGAK G+ P  C  C+GSG++
Sbjct: 118 AQRGADLRYNLDMSLEEAVRGKTVELEIPTLVECRDCNGSGAKKGSKPQTCGHCHGSGQI 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  CRG+G II  PC  CHG GR  E K LSV +P GVD G RIRL+
Sbjct: 178 -QMRQGFFAVQQTCPQCRGTGTIIKDPCRTCHGHGRKEETKTLSVKIPAGVDTGDRIRLA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG +G   GDLY+ + V++H  F RDG +L+C VP+S    A+GG  +V TL+   
Sbjct: 237 NEGEAGEHGAPAGDLYVQVHVREHPIFARDGNNLFCEVPVSFTKAALGGDIEVPTLEGK- 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-I 359
            ++ +P+ TQTGK FRL+GKG+  + +G  GDL  +V +ETP  L+ +QR++LEE E  +
Sbjct: 296 VKLKVPKETQTGKHFRLRGKGVKSVRTGEVGDLICKVMIETPVNLSSKQRDMLEELEDSM 355

Query: 360 SSQDN----NPQSTGFFARMKDFFDSLKN 384
            + D      P+  GFF  +K FFD L++
Sbjct: 356 GTGDEAAKFRPKEKGFFDGVKQFFDDLRS 384


>gi|237653705|ref|YP_002890019.1| chaperone protein DnaJ [Thauera sp. MZ1T]
 gi|237624952|gb|ACR01642.1| chaperone protein DnaJ [Thauera sp. MZ1T]
          Length = 374

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 187/382 (48%), Positives = 252/382 (65%), Gaps = 13/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A D ++K A+R LAMK+HPD+N ++ EA+EKF +  EAYE+L DP
Sbjct: 1   MSKRDYYEVLGVNRDAGDDEIKKAYRKLAMKFHPDRNPDNKEAEEKFKEAKEAYEMLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YD+ GH  ++    S GAG    G  G   F++ F  IFG + G G    RS+  
Sbjct: 61  QKKAAYDRYGHAGVD---PSMGAG---PGAQGFDGFADAFGDIFGDLFGGGGRGGRSNVY 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEI+LEEA  G    IR PT  +C TC GSGAKPGT+P  C  C G G+V
Sbjct: 115 --RGADLRYNLEITLEEAARGAEKTIRIPTVEECGTCHGSGAKPGTHPKPCPTCQGHGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C GSG+IIP PC  C G GR  ++K L V +P G+DDG R+R +
Sbjct: 173 -RVQQGFFSIQQTCPKCHGSGKIIPDPCRDCGGAGRTKKQKTLEVKIPAGIDDGMRLRHA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I ++KH  F+RD  DL+C +PISI T A+GG  ++ TL+   
Sbjct: 232 GHGEPGLNGGPPGDLYVEIHIRKHAVFERDHDDLHCEMPISITTAALGGEIEIPTLEGM- 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+ IP  TQ+GK FRL+GKG+  + S   GDL   V VETP  L +RQ+ELL EFE+ +
Sbjct: 291 ARLKIPAETQSGKVFRLRGKGIKNVRSHVHGDLMCHVVVETPVNLTERQKELLREFEESA 350

Query: 361 SQD---NNPQSTGFFARMKDFF 379
           S +   +NP++ G+  +++DFF
Sbjct: 351 SGNATRHNPKAQGWMDKVRDFF 372


>gi|85712936|ref|ZP_01043976.1| DnaJ molecular chaperone [Idiomarina baltica OS145]
 gi|85693242|gb|EAQ31200.1| DnaJ molecular chaperone [Idiomarina baltica OS145]
          Length = 382

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 255/385 (66%), Gaps = 11/385 (2%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+YQ+LG+ ++A +R +K A++ +AMKYHPD+ + D E + KF +I +AYEVL DPQKR 
Sbjct: 4   DYYQILGVGKDANERDIKKAYKRMAMKYHPDRTKGDKELEAKFKEIKQAYEVLSDPQKRQ 63

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
           +YDQ GHEA +  A+  G  G G    G +DF+++F  +FG I G GR   R  +  + G
Sbjct: 64  MYDQYGHEAFQQ-ARQGGGAGSGGFGGGGADFADIFGDVFGDIFGGGR---RQQARPQRG 119

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRYNLE+SLE+A  GK V+++ PT V+C  C GSGAK GT P  C+ C+GSG++    
Sbjct: 120 ADLRYNLEMSLEDAVKGKEVELQIPTMVECEDCDGSGAKKGTRPETCSHCHGSGQI-QMR 178

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF++++AC  CRG+G II  PC+ CHGQGRV + K LSV +P GVD G RIRL+ EG 
Sbjct: 179 QGFFAVQQACPHCRGTGSIIKDPCNTCHGQGRVEKTKKLSVKIPAGVDTGDRIRLANEGE 238

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG  G   GDLY+ + V++H  F RDG +LYC VP+S    A+GG  +V TL+    ++ 
Sbjct: 239 AGEKGAPAGDLYVQVHVREHPIFARDGNNLYCEVPVSFTKAALGGEIEVPTLEGK-VKLK 297

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           +P+ TQTGK FRL+GKG+  + +G  GDL  +V +ETP  L+ RQRELLEE E      +
Sbjct: 298 VPKETQTGKHFRLRGKGVKSVRTGAVGDLICKVVIETPVNLSSRQRELLEELESSMGHGD 357

Query: 365 N-----PQSTGFFARMKDFFDSLKN 384
                 P+  GFF  +K FFD L++
Sbjct: 358 EAAKFRPKEKGFFDGVKQFFDDLRS 382


>gi|253988025|ref|YP_003039381.1| chaperone protein DnaJ [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253779475|emb|CAQ82636.1| chaperone with dnak; heat shock protein [Photorhabdus asymbiotica]
          Length = 376

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 250/386 (64%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D Y+VLG+ + A ++++K A++ LAMKYHPD+N+ D +A+ KF ++ EAYE+L D 
Sbjct: 1   MAKRDCYEVLGVSKTADEKEIKKAYKRLAMKYHPDRNQGDKDAESKFKEVKEAYEILTDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R S  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRRQQRQSR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++E++LEEA  G T +IR PT   C  C GSGAK GT+P+ C+ C G+G+V
Sbjct: 114 ---GADLRYSMELTLEEAVRGVTKEIRIPTLETCDACHGSGAKAGTSPVTCSTCQGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++ C  C G GQII   C+KC G GRV + K LSV +P GVD G R+RLS
Sbjct: 171 HMR-QGFFTVQQPCPHCHGRGQIIKDSCNKCRGHGRVEKYKTLSVKIPAGVDTGDRVRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+R+  +LYC VP++    A+GG  +V TLD   
Sbjct: 230 GEGEAGSNGAPAGDLYVQVQVKRHHIFEREENNLYCEVPVNFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR+KGKG+  I  G +GDL  +V VETP KLN+RQ+ELL E  +  
Sbjct: 289 VKLKVPAETQTGKMFRMKGKGVKSIRGGAQGDLLCRVVVETPVKLNERQKELLRELGESL 348

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
                + N+P+S  FF  +K FFD L
Sbjct: 349 GGTGGETNSPRSKSFFDGVKKFFDDL 374


>gi|183600969|ref|ZP_02962462.1| hypothetical protein PROSTU_04583 [Providencia stuartii ATCC 25827]
 gi|188019300|gb|EDU57340.1| hypothetical protein PROSTU_04583 [Providencia stuartii ATCC 25827]
          Length = 378

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 253/389 (65%), Gaps = 17/389 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP-EAKEKFAQISEAYEVLRD 59
           M K DFY+VLG+++NA+D+ +K A++ LAMKYHPD+N++   EA+ +F +I EAYEVL D
Sbjct: 1   MAKRDFYEVLGLEKNASDKDIKRAYKRLAMKYHPDRNQDKKDEAEAQFKEIKEAYEVLSD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
            QKRA YDQ GH A E G    G  G GA      DFS++F  +FG I G GR  +R S 
Sbjct: 61  EQKRAAYDQYGHAAFEQGGMGGGGFGGGA------DFSDIFGDVFGDIFGGGRRQQRPSR 114

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G+DL+YN+E++LEEA  G T +IR P    C  C G+GAKPGT+   C  C+G G+
Sbjct: 115 ----GSDLQYNMELTLEEAVRGVTKEIRIPALETCDVCHGNGAKPGTSVDTCPTCHGMGQ 170

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V+   Q FFS+++ C TC G G+II  PC+KCHG GRV   K LSV +P GVD G R+RL
Sbjct: 171 VHMR-QGFFSVQQPCPTCHGRGKIIKDPCNKCHGHGRVERYKTLSVKIPAGVDTGDRVRL 229

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  G   GDL++ + V  H  F+RDG +L+C VPI+    A+GG  +V TLD  
Sbjct: 230 SGEGEAGENGAPAGDLFVQVRVLPHSIFERDGNNLHCEVPINFAVAALGGEIEVPTLDG- 288

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ- 358
             ++ IP  TQTGK FR+KGKG+  +  G +GDL   + VETP KLN++Q+ELL+EF + 
Sbjct: 289 RVKLKIPAETQTGKIFRMKGKGVKSVRGGMQGDLMCHIVVETPVKLNEKQKELLKEFGES 348

Query: 359 ---ISSQDNNPQSTGFFARMKDFFDSLKN 384
               S + N+P+S  F   +K FFD L N
Sbjct: 349 LGGTSGEKNSPRSKSFLDGVKKFFDDLTN 377


>gi|320540434|ref|ZP_08040084.1| chaperone Hsp40, co-chaperone with DnaK [Serratia symbiotica str.
           Tucson]
 gi|320029365|gb|EFW11394.1| chaperone Hsp40, co-chaperone with DnaK [Serratia symbiotica str.
           Tucson]
          Length = 370

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 251/386 (65%), Gaps = 22/386 (5%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ +  A+  F Q  EAYEVL D 
Sbjct: 1   MAKKDYYEILGVSKTADEREIKKAYKRLAMKYHPDRNQEEG-AETLFKQSKEAYEVLTDS 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH A E G      GG GA      DFS++F  +FG I G GR  KR++  
Sbjct: 60  RKRAAYDQYGHAAFEQGHM----GGSGA------DFSDIFGDVFGDIFGGGRR-KRATR- 107

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEE   G T +IR P  V+C  C GSGAKPG++P+ C  C+G G+V
Sbjct: 108 ---GSDLRYNLELSLEETVRGVTKEIRIPVLVECDACHGSGAKPGSSPITCPTCHGQGQV 164

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++AC  C G GQII  PC+KCH  GRV + K LSV +P GVD G RIRL+
Sbjct: 165 -QMRQGFFSVQQACPHCHGRGQIINDPCNKCHSHGRVEKSKTLSVKIPAGVDTGDRIRLA 223

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G + GDLY+ + VK H  F+R+G +LYC VPIS    A+GG  +V TLD   
Sbjct: 224 GEGEAGEHGASAGDLYVQVQVKAHPIFEREGNNLYCEVPISFAMAALGGEIEVPTLDG-R 282

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQT K FR++ KG+  +  G +GDL  +V VETP  LN +Q++LL+E E   
Sbjct: 283 VKLKIPAETQTAKLFRMRDKGIKSVRGGSQGDLLCRVVVETPVNLNDKQKQLLKELEASL 342

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S  +N+P+S  FF  +K+FFD L
Sbjct: 343 GGPSGDNNSPRSKSFFDGVKNFFDDL 368


>gi|270263898|ref|ZP_06192166.1| chaperone protein DnaJ [Serratia odorifera 4Rx13]
 gi|270042091|gb|EFA15187.1| chaperone protein DnaJ [Serratia odorifera 4Rx13]
          Length = 376

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 252/386 (65%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N+ + +A+ +F ++ EAYEVL D 
Sbjct: 1   MAKKDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQ-EKDAEAQFKEVKEAYEVLTDE 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G         G +DFS++F  +FG I G GR  + S   
Sbjct: 60  QKRAAYDQYGHAAFEQGGMGGGG----GFGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G G+V
Sbjct: 114 ---GSDLRYNMELSLEEAVRGVTKEIRIPTLEECGVCHGSGAKPGSSPVTCPTCHGQGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+ CHG GRV + K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFTVQQACPHCHGRGQIIKDPCNSCHGHGRVEKAKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL+E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVNLNDKQKQLLKELEESL 348

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S   N+P+S  FF  +K FFD L
Sbjct: 349 GGPSGDKNSPRSKTFFDGVKKFFDDL 374


>gi|148554170|ref|YP_001261752.1| chaperone protein DnaJ [Sphingomonas wittichii RW1]
 gi|148499360|gb|ABQ67614.1| chaperone protein DnaJ [Sphingomonas wittichii RW1]
          Length = 380

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 249/378 (65%), Gaps = 5/378 (1%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++L ++R A D+ LKT+FR LAM+YHPD+N  D  A+ KF  I+EAY+ L+DPQKRA
Sbjct: 6   DYYELLEVERTADDKVLKTSFRRLAMQYHPDRNPGDHAAEAKFKAINEAYDCLKDPQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ G  A     Q+ G G  G G  G   FS++FE IFG  MG GR      S+   G
Sbjct: 66  AYDRFGKAAF----QNGGPGAGGFGGGGFEGFSDIFENIFGEFMGGGRGGGGQRSSVRRG 121

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRY+LEI+LEEA++GK   I    A +C TC GSGAKPGT    C  C G G+V    
Sbjct: 122 ADLRYDLEITLEEAYAGKQASITVDVAAQCDTCDGSGAKPGTGTQHCKTCGGHGKVRAQ- 180

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF +ER C +C G+GQ+I  PC  CHG+GR+ + K L V VP GVD+GTRIRL+GEG 
Sbjct: 181 QGFFVVERTCPSCHGAGQVISDPCDACHGEGRIEKTKTLDVGVPAGVDEGTRIRLTGEGE 240

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG  GG PGDLYIFI +++H  F+RDG  L+   PIS  T A+GGT +V  LD     + 
Sbjct: 241 AGARGGPPGDLYIFIHLREHGIFERDGTTLFARAPISFTTAALGGTIEVPGLDKKRHEIR 300

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           IP G Q+GKQ R +G GMPV+N    GDL +Q+ VETP +L+ RQ+ELLEEF    + + 
Sbjct: 301 IPAGIQSGKQIRQRGAGMPVLNGRGHGDLVIQIDVETPTRLSARQKELLEEFRSTETGEE 360

Query: 365 NPQSTGFFARMKDFFDSL 382
            PQS+GFFAR+K  ++ L
Sbjct: 361 CPQSSGFFARLKGMWEDL 378


>gi|84500638|ref|ZP_00998887.1| chaperone protein DnaJ [Oceanicola batsensis HTCC2597]
 gi|84391591|gb|EAQ03923.1| chaperone protein DnaJ [Oceanicola batsensis HTCC2597]
          Length = 381

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 177/384 (46%), Positives = 256/384 (66%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A + ++K A+R  A + HPD+N ++P+A+E+F +++EAY+ L+D 
Sbjct: 1   MAKRDYYDVLGLSKGAGEDEIKKAYRKKAKELHPDRNADNPKAEEQFKEVNEAYDCLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGS-GRSYKRSSS 119
            ++A YD+ GH A E G       G        S FS++F+ +FG  MG  G    R  +
Sbjct: 61  DRKAAYDRFGHAAFEGGMGGGARRGGPNQGDFASAFSDVFDDLFGDFMGQRGPGGARQRA 120

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           T   G+DLRYN+ +SLE+A+ G    I+ PT+V+C+ C GSGA+ G+ P  C  C+G G+
Sbjct: 121 T--RGSDLRYNMRVSLEDAYEGLQKTIQVPTSVQCTQCDGSGAEGGSEPATCPTCSGMGK 178

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C TC G+GQII +PC  C G GRV  ++ LSVN+P GV+ GTRIRL
Sbjct: 179 VRAQ-QGFFTVERTCPTCSGAGQIIKNPCKACGGMGRVERDRSLSVNIPAGVETGTRIRL 237

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
            GEG AG+ GG  GDLYIFI V+ H+ F+RDG +L+C VP+S+ T A+GG  +V T+D  
Sbjct: 238 GGEGEAGMRGGPAGDLYIFIEVEPHKIFERDGPNLFCRVPVSMTTAALGGDIEVPTIDGG 297

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            SRV IPEG+Q+G+Q RL+ KGMP +  G  GD+ +++ VETP  L  RQ+ELL EF  +
Sbjct: 298 RSRVKIPEGSQSGRQMRLRSKGMPALRGGGTGDMMIELAVETPVNLTARQKELLREFNDL 357

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
            S++N+P++  F   ++ F+DS+K
Sbjct: 358 -SEENSPENKDFLKSVRGFWDSMK 380


>gi|310765130|gb|ADP10080.1| Chaperone protein DnaJ [Erwinia sp. Ejp617]
          Length = 380

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMK+HPD+N+ D E++ KF +I EAYE+L D 
Sbjct: 1   MAKRDYYEILGVAKSADEREIKKAYKRLAMKFHPDRNQGDKESEGKFKEIKEAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G    G    G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG--QGGFGGGGADFSDIFGDVFGDIFGGGRRQQRAAR- 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G + +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 118 ---GADLRYNMELSLEEAVRGVSKEIRIPTLDECGVCHGSGAKAGTKPQTCSTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC+ CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFTVQQACPACHGRGSVIKDPCNACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V+KH  F+R+  +LYC VPI+ V  A+GG  +V TLD   
Sbjct: 234 GEGEAGEQGAPAGDLYVQVQVRKHHIFEREENNLYCEVPINFVMAALGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q+ LL E ++  
Sbjct: 293 VNLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVSLNDKQKALLRELDESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 353 GGPSGEKNSPRSKTFFDGVKKFFDDL 378


>gi|226941654|ref|YP_002796728.1| chaperone protein DnaJ [Laribacter hongkongensis HLHK9]
 gi|254777962|sp|C1DD87|DNAJ_LARHH RecName: Full=Chaperone protein dnaJ
 gi|226716581|gb|ACO75719.1| DnaJ [Laribacter hongkongensis HLHK9]
          Length = 380

 Score =  362 bits (928), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 192/382 (50%), Positives = 249/382 (65%), Gaps = 7/382 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY VLG++R+A+D  +K A+R LAMKYHPD+N +  +A+EKF +  EAYE+L D 
Sbjct: 1   MSKKDFYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPDSKDAEEKFKEAKEAYEILSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A   GAGG          F+++F  IFGG   +G    R++  
Sbjct: 61  QKRAAYDQYGHAGVDPQAGFGGAGGQQGFGGFGDAFADIFGDIFGGGARAGGGGGRNAVY 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLEI+LEEA  G   QIR PT  +CS C GSGAKPGT P  C  C G+G+V
Sbjct: 121 --RGSDLRYNLEITLEEAARGCEKQIRIPTMEECSHCHGSGAKPGTEPKTCPTCGGAGQV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C TC GSG+ I  PC+ CHG GRV  +K L+V +P GVDDG RIRLS
Sbjct: 179 RMQ-QGFFSIQQTCPTCHGSGKQITDPCNICHGAGRVKSQKTLNVKIPAGVDDGDRIRLS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G  GG  GDLY+   +K H  F+RDG DL+C +PIS  T A+GG  ++ TLD   
Sbjct: 238 GEGEPGTNGGPAGDLYVVTHIKPHAVFERDGMDLHCEMPISFATAALGGEIEIPTLDGA- 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQ+G+ FRL+GKG+  + + + GDL   VQVETP KL  RQ+ELL EF+ IS
Sbjct: 297 AKLRIPAETQSGQVFRLRGKGIKALRASQHGDLMCHVQVETPVKLTDRQKELLREFDAIS 356

Query: 361 S---QDNNPQSTGFFARMKDFF 379
                 +NP++  F  ++KDFF
Sbjct: 357 QGAPAKHNPKAQSFMDKLKDFF 378


>gi|26991409|ref|NP_746834.1| chaperone protein DnaJ [Pseudomonas putida KT2440]
 gi|62900010|sp|Q88DU3|DNAJ_PSEPK RecName: Full=Chaperone protein dnaJ
 gi|24986479|gb|AAN70298.1|AE016670_8 dnaJ protein [Pseudomonas putida KT2440]
 gi|313500635|gb|ADR62001.1| DnaJ [Pseudomonas putida BIRD-1]
          Length = 375

 Score =  362 bits (928), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 247/384 (64%), Gaps = 11/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R AT+  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVERGATEADLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA +DQ GH  ++      GA       +G ++FS++F  +F    G           
Sbjct: 61  SKRAAFDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG-GGRGGGRGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 114 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC+ CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 174 -RMQQGFFSVQQTCPRCHGQGKIITDPCTSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ ISV++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 233 GEGEAGTHGGPTGDLYVVISVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 292 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 351

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 352 EGDSSHSPKASGWFDGVKRFFGDL 375


>gi|255262019|ref|ZP_05341361.1| chaperone protein DnaJ [Thalassiobium sp. R2A62]
 gi|255104354|gb|EET47028.1| chaperone protein DnaJ [Thalassiobium sp. R2A62]
          Length = 383

 Score =  361 bits (927), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 255/385 (66%), Gaps = 5/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LGI + A+  ++K A+R+ A + HPD+N ++P ++ +F +  EAYEVL+D 
Sbjct: 1   MAKRDYYETLGIAKGASADEIKKAYRTKAKELHPDRNTDNPNSEAQFKEAGEAYEVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
            K+A YD+ GH A E G      GG G    G+  S FS++F+ +FG  MG  R      
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGRPGGGGFSGQGDFASAFSDVFDDLFGDFMGGQRGGGGRG 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                 +DLRYNL I+LE+AFSG    +  PTAV CS+C G+GA+  + P  C  C+G G
Sbjct: 121 RAARG-SDLRYNLRITLEDAFSGLQKTVNIPTAVTCSSCDGNGAEGNSEPATCPTCSGMG 179

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQ I +PC+ CHGQGRV +E+ L+VN+P GV+ GTRIR
Sbjct: 180 KVRAQ-QGFFTVERTCPTCNGMGQTIQNPCNVCHGQGRVEKERALNVNIPAGVETGTRIR 238

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIF+ V +H+ F+R+G  L+C VP+S+   AMGG  +V T+D 
Sbjct: 239 LAGEGEAGMRGGPTGDLYIFVEVDEHELFQREGNHLFCRVPVSMTNAAMGGDIEVPTIDG 298

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRV IP G+Q+G+Q RL+ KGMP +     GD+++++ VETP  L  +Q+ELL EFE+
Sbjct: 299 GRSRVKIPAGSQSGRQMRLRAKGMPALRGAGTGDMFIEMAVETPVNLTSKQKELLREFEK 358

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           + S++NNP+ + FF  +K F+D +K
Sbjct: 359 L-SEENNPEGSTFFNSVKSFWDKMK 382


>gi|291464001|gb|ADE05543.1| DnaJ [Yersinia sp. MH-1]
          Length = 376

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 259/386 (67%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ + +A+ KF ++ EAYE+L D 
Sbjct: 1   MAKRDYYEILGVPKTADEREIKKAYKRLAMKFHPDRNQ-EQDAEGKFKEVKEAYEILTDA 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  +R+S  
Sbjct: 60  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGGGRRQQRASR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G+G+V
Sbjct: 114 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPITCPTCHGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 171 -QMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESF 348

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 349 GGAAGEKNSPRSKSFLDGVKKFFDDL 374


>gi|257092143|ref|YP_003165784.1| chaperone protein DnaJ [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257044667|gb|ACV33855.1| chaperone protein DnaJ [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 373

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 246/382 (64%), Gaps = 15/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY +LG++R+A D ++K A+R LAMKYHPD+N ++P+A++ F ++ EAYEVL DP
Sbjct: 1   MAKRDFYDILGVNRDAADDEIKKAYRKLAMKYHPDRNPDNPKAEDHFKEVKEAYEVLTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A          G  G   FS+ F GIF  I G GR+ +   S 
Sbjct: 61  QKRAAYDQYGHAGIDPQAGM-------GGAAGAGGFSDAFGGIFDEIFGGGRAGR---SN 110

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLE++LE+A  G   +IR PT   C +C GSGAK GT P  C  C GSG+V
Sbjct: 111 IYRGADLRYNLEVTLEQAAFGTETKIRIPTMEVCDSCRGSGAKAGTQPKTCPTCQGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C G+G+ I  PC+ CHG GRV + K L+V +P GVD+G RIRLS
Sbjct: 171 -RLQQGFFSIQQTCPKCHGTGRFIAEPCAACHGAGRVKQHKTLAVKIPAGVDEGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G+ GG  GDLY+ I +K H  F+R+  DL+C +PIS  T A+GG  D+ TLD   
Sbjct: 230 GEGEHGINGGPSGDLYVQIHLKAHPVFQREQNDLHCEMPISFTTAALGGEIDIPTLDGA- 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ +P  TQ+GK FRL+GKG+  + S   GDL   V VETP  L +RQ+ELL E E+ S
Sbjct: 289 AKIRVPAETQSGKTFRLRGKGIKGVRSHTHGDLLCHVVVETPVHLTERQKELLRELEESS 348

Query: 361 ---SQDNNPQSTGFFARMKDFF 379
              S  +NP++  +  R++DFF
Sbjct: 349 RENSDQHNPRAKSWMDRVRDFF 370


>gi|238755519|ref|ZP_04616858.1| hypothetical protein yruck0001_25240 [Yersinia ruckeri ATCC 29473]
 gi|238706275|gb|EEP98653.1| hypothetical protein yruck0001_25240 [Yersinia ruckeri ATCC 29473]
          Length = 377

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 256/386 (66%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A +R++K A++ LAMK+HPD+N+ + +A+ KF ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVPKTADEREIKKAYKRLAMKFHPDRNQ-EQDAEGKFKEVKEAYEILIDA 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G         G +DFS++F  +FG I G GR  +R+S  
Sbjct: 60  QKRAAYDQYGHAAFEQGGMGGGG----GFGGGGADFSDVFGDVFGDIFGGGRRQQRASR- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G+G+V
Sbjct: 115 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPITCPTCHGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPSGDLYVQVQVKSHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++QR+LL E E+  
Sbjct: 290 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQRQLLRELEESF 349

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  F   +K FFD L
Sbjct: 350 VGAAGEKNSPRSKSFLDGVKKFFDDL 375


>gi|254440039|ref|ZP_05053533.1| chaperone protein DnaJ [Octadecabacter antarcticus 307]
 gi|198255485|gb|EDY79799.1| chaperone protein DnaJ [Octadecabacter antarcticus 307]
          Length = 380

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 256/383 (66%), Gaps = 4/383 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K  +R  A + HPD+N ++P+A+ +F ++ EAYE+L+  
Sbjct: 1   MSKRDYYEVLGLSKGASADEIKKGYRQKAKELHPDRNTDNPKAESQFKEVGEAYEILKSA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YD+ GH A E G    G    G      S FS++F+ +FG + G+     +S ++
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGRPSGGGQGDFGSAFSDIFDDLFGNMGGARGGGGQSRAS 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G DLRYNL ++LEEA++G    +  PTAV C +C G+GA+ G+ P  C  C+G G+V
Sbjct: 121 --RGNDLRYNLRVTLEEAYAGLQKTVTVPTAVGCGSCKGTGAEGGSEPQTCPTCSGMGKV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ER C TC G GQ I +PC +C G GRV +EK LSVN+P GV+ GTRIRL+
Sbjct: 179 RAQ-QGFFTVERTCPTCNGMGQTIKNPCHECRGAGRVEKEKSLSVNIPAGVETGTRIRLA 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIF+ V+ H  F+R+  +L+C VP+S+ T A+GG  +V T+D   
Sbjct: 238 GEGEAGMRGGPTGDLYIFLEVRDHDLFEREVNNLFCRVPVSMATAALGGDIEVPTIDGGR 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  +QRELL EFE ++
Sbjct: 298 SRVKIPAGSQSGRQMRLRAKGMPALRGGGPGDMFIEMAVETPVNLTGKQRELLREFEDLA 357

Query: 361 SQDNNPQSTGFFARMKDFFDSLK 383
           S DNNPQS+ FF  +K F++S+K
Sbjct: 358 S-DNNPQSSNFFKSVKSFWESMK 379


>gi|295687462|ref|YP_003591155.1| chaperone protein DnaJ [Caulobacter segnis ATCC 21756]
 gi|295429365|gb|ADG08537.1| chaperone protein DnaJ [Caulobacter segnis ATCC 21756]
          Length = 385

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 248/385 (64%), Gaps = 12/385 (3%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++LG+ R   +  LK+AFR LAM++HPD+N     A  +F +I+EAY VL DPQKRA
Sbjct: 3   DYYEILGVTRTVDEAGLKSAFRKLAMEHHPDRNGGCENATGRFKEINEAYSVLSDPQKRA 62

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH  +       G  G       +  F+++F  +FG + G GR   R S+  + G
Sbjct: 63  AYDRFGHAGVNGPQGGPGGFGGQG-FDASDIFNDVFGDVFGEMFGGGR---RQSNGPQRG 118

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
            DLRY+LEISLE+A++G  V+I  P A+ C  C GSGAKPGT+P  C  C G+GRV  T 
Sbjct: 119 QDLRYDLEISLEQAYAGAEVEITVPAAMTCEVCEGSGAKPGTSPTVCGTCGGAGRVRAT- 177

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF++ER C  C GSG+++  PC+ C+G G+V  E++LSV +P GVDDG RIRL+GEG 
Sbjct: 178 QGFFAVERGCPRCGGSGRLVLDPCANCNGHGQVRRERVLSVRIPAGVDDGARIRLAGEGD 237

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS--- 301
           AG  GG  GDLYIF+SV  H+ F+RDG DL CTVP+ + T A+GG  D   L    +   
Sbjct: 238 AGARGGPRGDLYIFLSVTPHELFERDGLDLLCTVPVPMTTAALGGDIDAPCLLGGENCDG 297

Query: 302 ----RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               +VT+PEG QTGK  RLKG+GMP + S ++GDL V++ VETP  L+ RQ+ELL+E  
Sbjct: 298 NCKVKVTVPEGAQTGKTVRLKGRGMPSLRSRQRGDLVVELFVETPTHLSARQKELLKELA 357

Query: 358 QISSQDNNPQSTGFFARMKDFFDSL 382
            +  +  NP+S  F  + K F++ +
Sbjct: 358 GLCGEKQNPKSANFVGKAKRFWEEV 382


>gi|157368938|ref|YP_001476927.1| chaperone protein DnaJ [Serratia proteamaculans 568]
 gi|189083370|sp|A8G9K9|DNAJ_SERP5 RecName: Full=Chaperone protein dnaJ
 gi|157320702|gb|ABV39799.1| chaperone protein DnaJ [Serratia proteamaculans 568]
          Length = 375

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 255/386 (66%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ + +A+ +F +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVSKTAEEREIKKAYKRLAMKFHPDRNQ-EQDAEARFKEIKEAYEILTDA 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G ++FS++F  +FG I G GR  + S   
Sbjct: 60  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGAEFSDIFGDVFGDIFGGGRRQRASR-- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G G+V
Sbjct: 113 ---GSDLRYNMELSLEEAVRGVTKEIRIPTLEECGVCHGSGAKPGSSPVTCPTCHGQGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+ CHG GRV + K LSV +P GVD G RIRL+
Sbjct: 170 -QMRQGFFTVQQACPHCHGRGQIIKDPCNSCHGHGRVEKAKTLSVKIPAGVDTGDRIRLA 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 229 GEGEAGEHGAPAGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q++LL+E E+  
Sbjct: 288 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVNLNDKQKQLLKELEESL 347

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S   N+P+S  FF  +K FFD L
Sbjct: 348 GGPSGDKNSPRSKSFFDGVKKFFDDL 373


>gi|315123367|ref|YP_004065373.1| chaperone protein dnaJ (heat shock protein J) (HSP40), co-chaperone
           with DnaK [Pseudoalteromonas sp. SM9913]
 gi|108744033|gb|ABG02288.1| DnaJ [Pseudoalteromonas sp. SM9913]
 gi|315017127|gb|ADT70464.1| chaperone protein dnaJ (heat shock protein J) (HSP40), co-chaperone
           with DnaK [Pseudoalteromonas sp. SM9913]
          Length = 379

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 250/385 (64%), Gaps = 11/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A++R +K A++ LAMKYHPD+   D + + KF ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVSKDASERDIKKAYKRLAMKYHPDRTAGDKDLETKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR +YDQ GH A E G      G  G        F ++F  IFG          R  S 
Sbjct: 61  QKRQMYDQYGHAAFEQGGGGGHGGFGGGQGDFGDIFGDVFGDIFG------GGGGRRQSR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+++SLEEA  GK V+I+ PT V C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 115 QQRGSDLRYNMDLSLEEAVRGKDVEIKVPTWVSCEPCDGSGAKAGSKPKTCTTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G GQII  PC+KCHGQGRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFAVQQTCPTCHGQGQIISDPCNKCHGQGRVEKTKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G   GDLY+ +SV++H+ F R+  +LYC VPIS  T  +GG  +V TLD   
Sbjct: 234 GEGEAGMHGAPAGDLYVQVSVREHKIFVREANNLYCEVPISFTTAGLGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQTGK FR++GKG+  + SG +GDL  +V +ETP  LN+RQR+LL+E ++  
Sbjct: 293 AKLKIPSETQTGKMFRMRGKGVKSVRSGAQGDLICKVVIETPVNLNERQRDLLKELDESM 352

Query: 361 SQD---NNPQSTGFFARMKDFFDSL 382
            +D   N P+  GFF  +K FFD L
Sbjct: 353 GKDSSKNRPKEQGFFDGVKKFFDDL 377


>gi|259907370|ref|YP_002647726.1| Chaperone protein DnaJ [Erwinia pyrifoliae Ep1/96]
 gi|224962992|emb|CAX54475.1| Chaperone protein DnaJ [Erwinia pyrifoliae Ep1/96]
 gi|283477200|emb|CAY73107.1| Chaperone protein dnaJ [Erwinia pyrifoliae DSM 12163]
          Length = 380

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 251/386 (65%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMK+HPD+N+ D E++ KF +I EAYE+L D 
Sbjct: 1   MAKRDYYEILGVAKSADEREIKKAYKRLAMKFHPDRNQGDKESEGKFKEIKEAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G      G +DFS++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGQG--GFGGGGADFSDIFGDVFGDIFGGGRRQQRAAR- 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G + +IR PT  +C  C GSGAK GT P  C+ C+G+G+V
Sbjct: 118 ---GADLRYNMELSLEEAVRGVSKEIRIPTLDECGVCHGSGAKAGTKPQTCSTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G +I  PC  CHG GRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFTVQQACPACHGRGSVIKDPCYACHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V+KH  F+R+  +LYC VPI+ V  A+GG  +V TLD   
Sbjct: 234 GEGEAGEQGAPAGDLYVQVQVRKHHIFEREENNLYCEVPINFVMAALGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN +Q+ LL E ++  
Sbjct: 293 VNLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVSLNDKQKALLRELDESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 353 GGPSGEKNSPRSKTFFDGVKKFFDDL 378


>gi|119385034|ref|YP_916090.1| chaperone protein DnaJ [Paracoccus denitrificans PD1222]
 gi|189083343|sp|A1B4F0|DNAJ_PARDP RecName: Full=Chaperone protein dnaJ
 gi|119374801|gb|ABL70394.1| chaperone protein DnaJ [Paracoccus denitrificans PD1222]
          Length = 384

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 253/388 (65%), Gaps = 10/388 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R A+  ++K A+R+ A + HPD+N++   ++  F +++EAYE L+D 
Sbjct: 1   MAKRDYYEVLGVARGASADEIKKAYRAKAKQLHPDRNKDCKVSEAAFKEVNEAYECLKDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YD+ GH A E G    G G         S F+++FE +FG +MG        S  
Sbjct: 61  QKKAAYDRFGHAAFENGGGGFGRGNGHGDF--GSAFADVFEDLFGDMMGRRAGGGGRSRA 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                DLRYNL +SLEEA++G    I  P +V C+ C+G+GA+    P  C  C+G G+V
Sbjct: 119 SRG-QDLRYNLRVSLEEAYNGAQKTINVPGSVACAACNGTGAEGAVEPATCPTCSGMGKV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T Q FF++ER C TC G GQI+ +PC +C G GRV +E+ LSVN+P GV+ GTRIRL+
Sbjct: 178 RAT-QGFFTVERTCPTCSGHGQIVKNPCQECRGAGRVQKERTLSVNIPAGVETGTRIRLA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG  GDLYIFI V++H  F RDG  L C VP+S+ T A+GG  +V T+D   
Sbjct: 237 GEGDAGMRGGPAGDLYIFIEVREHPIFMRDGRMLACQVPVSMTTAALGGEIEVPTIDGGR 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVIN-----SGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           SRV +P GTQ+GKQ RL+GKGMP +      +G  GD+ +++ VETP  L  RQ+ELL E
Sbjct: 297 SRVKVPPGTQSGKQLRLRGKGMPPLRHGPGLNGEAGDMLIELAVETPVNLTARQKELLRE 356

Query: 356 FEQISSQDNNPQSTGFFARMKDFFDSLK 383
           FE I++ DNNPQ+ GFF ++K F+D +K
Sbjct: 357 FEAINA-DNNPQTQGFFQKIKGFWDEMK 383


>gi|260432007|ref|ZP_05785978.1| chaperone protein DnaJ [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415835|gb|EEX09094.1| chaperone protein DnaJ [Silicibacter lacuscaerulensis ITI-1157]
          Length = 379

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 175/367 (47%), Positives = 246/367 (67%), Gaps = 5/367 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K  +Y+VLG+ + A+  ++K AFR  A + HPD+N+++PEA+  F + +EAY++LRD 
Sbjct: 1   MSKRCYYEVLGVSKGASAEEIKKAFRRKAKELHPDRNKDNPEAETLFKEANEAYDILRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YD+ GH A E G      GG       +S FS++F+ +FG  M      +     
Sbjct: 61  DKKAAYDRFGHAAFENGTGGARPGGGYGSGDFSSAFSDVFDDLFGDFM---GGRQGGGRR 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNL ++LEEA+SG    I  PTAV CS C G+GA+ G  P  C  C+G G+V
Sbjct: 118 AARGSDLRYNLRVTLEEAYSGLQKTINVPTAVACSACEGTGAEGGVEPTTCPTCSGMGKV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ER+C TC G GQII +PC  CHG GRV +E+ LSVN+P GV+ GTRIRL+
Sbjct: 178 RAQ-QGFFTVERSCPTCAGLGQIIKNPCKSCHGSGRVEKERALSVNIPAGVETGTRIRLA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG PGDLYIF+ V  H+ F+RDG +LYC VP+S+   A+GG+ +V T+D   
Sbjct: 237 GEGEAGMRGGPPGDLYIFVEVTPHKLFERDGTNLYCRVPVSMAKAALGGSIEVPTIDGGR 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            RV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL+EF+++ 
Sbjct: 297 GRVQIPAGSQSGRQMRLRGKGMPALRGGGVGDMFIELAVETPVNLTARQKELLKEFDEL- 355

Query: 361 SQDNNPQ 367
            +DN+P+
Sbjct: 356 GEDNHPE 362


>gi|297181543|gb|ADI17729.1| dnaJ-class molecular chaperone with C-terminal Zn finger
           domain-protein [uncultured Oceanospirillales bacterium
           HF0130_25G24]
          Length = 372

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 254/386 (65%), Gaps = 18/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LG+ R+A++ ++K A+R +AMK HPD+N ++ EA+++F + +EA+EVL D 
Sbjct: 1   MPKSDYYEILGVSRDASEAEIKKAYRRVAMKNHPDRNPDNKEAEDRFKEANEAFEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  +E G  SQG          ++DF ++F  IFG I G GR   RS   
Sbjct: 61  EKRARYDQFGHAGVE-GQTSQG----------HADFGDIFGDIFGDIFGGGRGGSRSRVA 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLE+SLEEA  GKT +IR P+   C  C+GSGAKPGT P+DC+ CNG G+V
Sbjct: 110 --KGADLRYNLELSLEEAVKGKTAKIRIPSTANCEACNGSGAKPGTTPVDCSTCNGVGQV 167

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G+G++I  PC  C GQG V E K LSV VP GVD G RIRL+
Sbjct: 168 RMQ-QGFFSVQQTCPACHGAGKLIKDPCPNCRGQGFVEETKTLSVKVPAGVDTGDRIRLT 226

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ + V+ HQ F+RDG DL+C +PIS V  A+GG  +V TLD   
Sbjct: 227 GEGQAGPRGGPSGDLYVEMHVQPHQIFQRDGRDLHCEIPISFVDAAIGGELEVPTLDG-R 285

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FRL+ KG+  I  G  GDL  +V +ETP  L  RQ+ELLEEF++I 
Sbjct: 286 VKLKIPAETQTGKLFRLRSKGVTSIRGGSPGDLLCRVVMETPVNLTNRQKELLEEFQEIY 345

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLK 383
               +  +P+   +F  +K F D L+
Sbjct: 346 ESQGKRQSPKRFSWFDGVKKFVDGLR 371


>gi|260771329|ref|ZP_05880255.1| chaperone protein DnaJ [Vibrio furnissii CIP 102972]
 gi|260613645|gb|EEX38838.1| chaperone protein DnaJ [Vibrio furnissii CIP 102972]
 gi|315180929|gb|ADT87843.1| chaperone protein DnaJ [Vibrio furnissii NCTC 11218]
          Length = 382

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 252/386 (65%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYE+L DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDASAADKFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR    +   
Sbjct: 61  QKKAAYDQYGHAAFE---QGGGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGAPRP 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+E++LEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 118 -QRGADLRYNMELTLEEAVRGCSKEIEVPTLVHCEACDGSGAKKGTSAQTCGTCHGHGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRL+
Sbjct: 177 QMR-QGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKSKTLNVKIPAGVDTGDRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 236 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDG-R 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +PE TQTG+ FR++GKG+  +  G  GDL V++ VETP KL+ RQ+ELL E E+  
Sbjct: 295 VNLKVPEETQTGRMFRMRGKGVKSVRGGAIGDLIVKLVVETPVKLSARQKELLRELEESC 354

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 355 GGEAANKHKPKSEGFFNGVKKFFDDL 380


>gi|304311949|ref|YP_003811547.1| chaperone protein [gamma proteobacterium HdN1]
 gi|301797682|emb|CBL45904.1| chaperone protein [gamma proteobacterium HdN1]
          Length = 382

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 251/385 (65%), Gaps = 7/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+++ A+ + LK AFR LAMK+HPD+N +D  A+ KF +I+EAYEVL D 
Sbjct: 1   MAKRDFYEVLGVEKGASQQDLKKAFRKLAMKHHPDRNPDDKSAEAKFKEINEAYEVLSDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH  ++  A   G GGFG G     +FS++F  +FG I G G++     + 
Sbjct: 61  QKRAAYDRFGHAGVDPSAGGGGFGGFGGGGGAGPNFSDIFGDVFGDIFGQGQARGGGRNN 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY LE+ LE+A  G TV IR P+ V+C TC GSGAKPG+ P++C  C G G++
Sbjct: 121 --RGADLRYTLELDLEDAVKGATVDIRIPSHVECETCHGSGAKPGSTPINCTTCGGVGQI 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  CRGSG+II  PC  C GQGR  ++K LSV +P GVD G RIRL+
Sbjct: 179 RMQ-QGFFSVQQTCPACRGSGKIIKDPCRDCSGQGRKEKKKTLSVKIPAGVDTGDRIRLA 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ ++V+ H  F+R+G DLY  VPIS    A+GG  DV TLD   
Sbjct: 238 GEGEAGTQGGPAGDLYVQVAVRDHALFRREGRDLYTEVPISFSDAALGGDLDVPTLDG-R 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQTGK FRL+GKG+  +  G  GDL  +V VETP  L KRQ+ELL EF    
Sbjct: 297 VKLKIPAETQTGKMFRLRGKGVTPVRGGPAGDLLCKVVVETPVNLTKRQKELLREFHDTL 356

Query: 361 SQDN---NPQSTGFFARMKDFFDSL 382
            +D+   +P+   +F  +K FFD +
Sbjct: 357 DKDDQHQSPRKQSWFEGVKKFFDDM 381


>gi|118594548|ref|ZP_01551895.1| Heat shock protein DnaJ [Methylophilales bacterium HTCC2181]
 gi|118440326|gb|EAV46953.1| Heat shock protein DnaJ [Methylophilales bacterium HTCC2181]
          Length = 369

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 181/378 (47%), Positives = 247/378 (65%), Gaps = 18/378 (4%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y+VLG++R A+   +K AF+ LAMKYHPD+N ++P+A+E F +   AY++L D QK+A
Sbjct: 6   DYYEVLGVNRGASADDIKKAFKKLAMKYHPDRNPDNPKAEESFKEAKAAYDILSDSQKKA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YDQ GH  +    Q+ G+G          DF + F  IFG I G GRS KRS+     G
Sbjct: 66  AYDQYGHAGVN---QNMGSG--------PGDFGDAFGDIFGDIFGGGRSNKRSNVY--RG 112

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRYN+EI+L++A+ G   +IR P    C  CSG G K GT+P  C  C G G+V    
Sbjct: 113 ADLRYNMEITLDQAYKGTETKIRIPVMSSCKVCSGKGTKKGTDPTTCGTCQGHGQV-RMQ 171

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FFS+++AC  C+GSG+ I +PC  C G GR  E K LSV +P GVDDG RIRLSGEG 
Sbjct: 172 QGFFSVQQACPKCQGSGKEIKNPCDDCSGSGRKQENKTLSVKIPAGVDDGDRIRLSGEGE 231

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AGV GG  GDLY+ +S+K H  F+RDG +L+C +PIS  T A+GG   V TLD + +++ 
Sbjct: 232 AGVNGGPTGDLYVVVSLKSHDIFERDGGNLHCEMPISFSTAALGGEITVPTLDGS-AKIK 290

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQD- 363
           IP  TQ+G  FRL+GKG+  I   + GDL+  V VETP KLN+ Q++LL E E+++ +D 
Sbjct: 291 IPAETQSGAVFRLRGKGIKPIRENQHGDLHCHVVVETPIKLNENQKKLLRELEKLNQEDS 350

Query: 364 --NNPQSTGFFARMKDFF 379
             ++P+S  +  ++KDFF
Sbjct: 351 GKHSPRSETWIDKVKDFF 368


>gi|319792563|ref|YP_004154203.1| chaperone protein dnaj [Variovorax paradoxus EPS]
 gi|315595026|gb|ADU36092.1| chaperone protein DnaJ [Variovorax paradoxus EPS]
          Length = 379

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 180/383 (46%), Positives = 245/383 (63%), Gaps = 14/383 (3%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND--PEAKEKFAQISEAYEVLRDP 60
           K D+Y+ LG+ +NA D ++K A+R LAMK+HPD+N  D   +A+ KF ++ EAYE+L D 
Sbjct: 4   KRDYYETLGVPKNANDDEIKKAYRKLAMKHHPDRNHGDTSKDAEAKFKEVKEAYEMLSDG 63

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++   +            G   F+E F  IFG + G  R  ++S   
Sbjct: 64  QKRAAYDQYGHAGVDPNMRGGPG------AEGFGGFAEAFGDIFGDVFGGARGGRQSGGR 117

Query: 121 GE-AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G+DL Y +E++LEEA  GK  QIR P+   C TC GSGAKPGT P+ C  C+G+G 
Sbjct: 118 QVFRGSDLSYAMEVTLEEAAEGKEAQIRIPSWDNCDTCKGSGAKPGTKPITCTTCHGAGA 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C TC GSG+IIP PC+ CHGQG++   K L V +P G+DDG RIR 
Sbjct: 178 V-QMRQGFFSVQQTCPTCHGSGKIIPEPCTVCHGQGKIKNNKTLEVKIPAGIDDGMRIRS 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +G G  G  GG PGDLYI I +KKH+ F+RDG DL+C VP+S+ T A+GG   V TL   
Sbjct: 237 TGNGEPGTNGGPPGDLYIEIRLKKHELFERDGDDLHCVVPVSVTTAALGGEISVPTLKGA 296

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            + + IP+GTQ+GKQFRL+GKG+  + S   GDLY  V+VETP KL + QR+LL+E ++ 
Sbjct: 297 -AAIDIPDGTQSGKQFRLRGKGIKGVRSSYPGDLYCHVRVETPVKLTEHQRKLLKELDES 355

Query: 360 SSQ---DNNPQSTGFFARMKDFF 379
             +    ++P   G+F + K+FF
Sbjct: 356 LKKGGDKHSPTDKGWFDKAKEFF 378


>gi|197103522|ref|YP_002128899.1| chaperone protein DnaJ [Phenylobacterium zucineum HLK1]
 gi|196476942|gb|ACG76470.1| chaperone protein DnaJ [Phenylobacterium zucineum HLK1]
          Length = 387

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 244/386 (63%), Gaps = 13/386 (3%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++LG++R   D  LK AFR LAM++HPD+N    EA  +F +I+EAY VL DPQKRA
Sbjct: 4   DYYEILGVNRGCDDAALKAAFRKLAMEHHPDRNGGCEEAAGRFKEINEAYSVLSDPQKRA 63

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSD-FSELFEGIFGGIMGSGRSYKRSSSTGEA 123
            YD+ GH  +         G   A  +   D F+E+F  +FG + G GR+          
Sbjct: 64  AYDRFGHAGVNGMNGGGPGG---AQFHDVHDIFNEVFGDVFGDMFG-GRARGSHRGGPAR 119

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTT 183
           GADLRY+LEI+LE+A++G  V+I  P  + C TC GSGAKPGT+P  C  C G+GR+  T
Sbjct: 120 GADLRYDLEITLEQAYAGAEVEITVPATLTCETCEGSGAKPGTSPTTCTTCQGAGRIRAT 179

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
            Q FFSIERAC  C GSG ++  PC+ CHG G+V  E+ L+V +PPGVDDG RIRL+GEG
Sbjct: 180 -QGFFSIERACPRCGGSGTMVLDPCTDCHGMGQVRRERTLAVRIPPGVDDGARIRLAGEG 238

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS-- 301
            +G  GG  GDLYIF+SV+ H+ F+RDG DL CTVP+ +   A+GG  +   L    +  
Sbjct: 239 DSGARGGPRGDLYIFLSVRPHELFERDGLDLLCTVPVPMCVAALGGEIEAPCLLGGENCD 298

Query: 302 -----RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
                 V +PEG QTGK  R+KG+GMP + S  +GDL V++ VETP +L  RQ+EL+ E 
Sbjct: 299 GNCKITVKVPEGAQTGKTLRVKGRGMPSLRSRERGDLVVELFVETPTRLTVRQKELMREL 358

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
             +  +  +P+S  F  + K F+D +
Sbjct: 359 AGLCGEQQHPKSASFIGKAKRFWDEV 384


>gi|221134951|ref|ZP_03561254.1| Chaperone protein dnaJ [Glaciecola sp. HTCC2999]
          Length = 378

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 256/387 (66%), Gaps = 12/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++AT+R++K A++ LAMKYHPD+ + D   +EKF +I EA+E+L D 
Sbjct: 1   MSKRDYYEVLGVSKSATEREIKKAYKKLAMKYHPDRTQGDKGMEEKFKEIQEAHEILTDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YDQ GH A +        GG GA      DF ++F  +FG I G GRS    +  
Sbjct: 61  QKRGAYDQYGHAAFDQSRGGYQGGGGGA------DFGDIFGDVFGDIFGGGRSGGGRARA 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYNLE+SLEEA  GK V+IR PT V+C  C+GSGAK GT+   C+ C+G+G+V
Sbjct: 115 RSG-SDLRYNLELSLEEAVKGKEVEIRVPTMVECEPCNGSGAKKGTSAKTCSTCHGNGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G++I  PCS C GQGRV E K LSV +PPGVD G RIRLS
Sbjct: 174 -QMRQGFFAVQQACPTCGGKGKVIGDPCSPCRGQGRVEETKTLSVKIPPGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ ++V++H+ F+RDG +LYC VP+S  T A+GG  +V TLD   
Sbjct: 233 GEGEAGEQGAPAGDLYVQVNVREHKIFQRDGNNLYCEVPLSFTTAALGGEIEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +   TQTG+ FRL+GKG+  + S   GDL  +V +ETP  L+ RQ+ELLEEF++  
Sbjct: 292 VKLKVSSETQTGRMFRLRGKGVKSVRSSSVGDLMCKVVIETPVNLSSRQKELLEEFDKSM 351

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
             S + + P+  GFF  +K FFD L N
Sbjct: 352 GDSIKKHRPKEQGFFDGVKKFFDDLTN 378


>gi|57238743|ref|YP_179879.1| chaperone protein DnaJ [Ehrlichia ruminantium str. Welgevonden]
 gi|58579622|ref|YP_197834.1| chaperone DnaJ [Ehrlichia ruminantium str. Welgevonden]
 gi|62899922|sp|Q5HCG4|DNAJ_EHRRW RecName: Full=Chaperone protein dnaJ
 gi|57160822|emb|CAH57720.1| chaperone protein DnaJ [Ehrlichia ruminantium str. Welgevonden]
 gi|58418248|emb|CAI27452.1| Chaperone protein dnaJ [Ehrlichia ruminantium str. Welgevonden]
          Length = 382

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 184/384 (47%), Positives = 267/384 (69%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y +LG+ +NAT  ++K A+R +A+KYHPD+N  D  A+EKF ++SEAY+VL D 
Sbjct: 1   MSKSDYYDLLGLSKNATPEEIKKAYRKMALKYHPDKNPGDKAAEEKFKELSEAYDVLIDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A   G+   G GGF      ++DFS++F  +FGG    GRS  +    
Sbjct: 61  DKRAAYDRYGHSAFSDGS---GRGGFDFNSGFSTDFSDIFNDLFGGGFRGGRSSSKRQDG 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G  G+DLR ++EI+LE++F+G  V I + T VKCS+CSGSG++     + CN C+G+G +
Sbjct: 118 GTVGSDLRLDIEITLEDSFNGTKVPINYVTHVKCSSCSGSGSEGSVKSVQCNTCHGAGNI 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T Q FF+IER C  C G G+II + C KC G GRV +E  L V VP G++ G +IRL+
Sbjct: 178 -RTQQGFFTIERTCHVCNGEGEIIKNKCKKCSGSGRVRDEVNLLVTVPKGIESGDKIRLN 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  G   GDLY++ ++KKH+FF R+GADLYC VPI ++   +GG  ++ ++D T 
Sbjct: 237 GKGEAGYRGAQSGDLYVYPNIKKHKFFTRNGADLYCNVPIKMILATLGGHIEMPSIDGTW 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF-EQI 359
           ++V +PEG+Q G + RLK KGMPVINS R+GD+Y+Q+ VETP  L K+Q+ELL++F E+ 
Sbjct: 297 TKVKVPEGSQNGDKLRLKEKGMPVINSSRRGDMYIQITVETPINLTKQQKELLKKFDEEP 356

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
           ++ + NPQSTGFF ++K F++ ++
Sbjct: 357 NTVECNPQSTGFFQKVKSFWNDIR 380


>gi|157376540|ref|YP_001475140.1| chaperone protein DnaJ [Shewanella sediminis HAW-EB3]
 gi|189083380|sp|A8FYT9|DNAJ_SHESH RecName: Full=Chaperone protein dnaJ
 gi|157318914|gb|ABV38012.1| chaperone protein DnaJ [Shewanella sediminis HAW-EB3]
          Length = 378

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 252/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VL + R+A++R++K A++ LAMK+HPD+N  D +A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLSVSRDASEREIKKAYKRLAMKFHPDRNPGDKQAEANFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         GN+DF ++F  +FG I G GR        
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGF-------GGNADFGDVFGDVFGDIFGGGRRGGGQRQA 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYNLE+SLEEA  G T ++R PT   C +C GSGAK GT+P  C  C+G G+V
Sbjct: 114 ARG-SDLRYNLELSLEEAVKGLTKELRIPTLAACDSCDGSGAKKGTSPTTCGTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+KCHG+GRV + K LSV +P GVD+G RIRLS
Sbjct: 173 -QMRQGFFAVQQACPTCHGRGKIIKDPCNKCHGEGRVEKSKTLSVKIPAGVDNGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGEFGAPPGDLYVQVSVREHTIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGK- 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP KLN+RQ+ELL EF++  
Sbjct: 291 VNLKIPAETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVKLNERQKELLREFDETL 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              SS+ ++P++ GFF  +K FF  L
Sbjct: 351 TGSSSKKHSPKAEGFFDGVKKFFQDL 376


>gi|104780013|ref|YP_606511.1| chaperone protein DnaJ [Pseudomonas entomophila L48]
 gi|189083347|sp|Q1IF58|DNAJ_PSEE4 RecName: Full=Chaperone protein dnaJ
 gi|95109000|emb|CAK13696.1| Chaperone protein DnaJ [Pseudomonas entomophila L48]
          Length = 375

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 247/384 (64%), Gaps = 11/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG++R A++  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MAKRDFYEVLGVERGASEGDLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDT 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      GA       +G ++FS++F  +F    G        S  
Sbjct: 61  SKRAAYDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG-GRGGSRSGG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 114 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCKPCDGSGAKKGSTPSTCPTCGGIGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC+ CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 174 -RMQQGFFAVQQTCPRCHGQGKIITDPCNSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ I+V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 233 GEGEAGTHGGPTGDLYVVINVREHDIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 292 VKLKIPEGTQTGKQFRLRGKGVAPVRGGAAGDLLCRVAVETPVNLSRRQRELLEELRDSL 351

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 352 EGDSSHSPKASGWFEGVKRFFGDL 375


>gi|238918616|ref|YP_002932130.1| chaperone protein DnaJ, [Edwardsiella ictaluri 93-146]
 gi|259534088|sp|C5B7L8|DNAJ_EDWI9 RecName: Full=Chaperone protein dnaJ
 gi|238868184|gb|ACR67895.1| chaperone protein DnaJ, putative [Edwardsiella ictaluri 93-146]
          Length = 377

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 249/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R A +R++K A++ LAMKYHPD+N+ D EA++KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAEDKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G      G  G +DFS++F  +FG I G GR  + +   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----GGFGGGADFSDIFGDVFGDIFGGGRRQRAAR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN++++LEEA  G T +IR PT  +C  C GSGAK G+ P+ C  C+G+G+V
Sbjct: 115 ---GADLRYNMDLTLEEAVRGVTKEIRIPTLAECDVCHGSGAKKGSEPITCPTCHGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G II  PC+KCHG GR+ + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK H  F+R+  +L+C VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTGK FR++G+G+  +  G +GDL  +V VETP  LN +Q++LL E E+  
Sbjct: 290 VNLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQKQLLRELEESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              +S  N+P+S  FF  +K FFD L
Sbjct: 350 GGPASDKNSPRSKRFFDGVKKFFDDL 375


>gi|91762501|ref|ZP_01264466.1| Chaperone protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718303|gb|EAS84953.1| Chaperone protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 376

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 251/379 (66%), Gaps = 5/379 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY VLG+ ++A+  +LK+A+R LA+KYHPD+N  D  +++KF +  EAY +L D 
Sbjct: 1   MAKRDFYDVLGVSKSASPEELKSAYRKLAVKYHPDKNPGDKASEDKFKEAGEAYGILSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+  YD  GH A E G   QG G    G +G +DFS++FE  FG   G G+S  R   T
Sbjct: 61  EKKQNYDNFGHAAFEGGGGRQGGGF--GGGFGGADFSDIFEDFFGD-FGGGQSRGRRK-T 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY+L I+LEEA+ GK   I+F T  KC+TCSG+G+KPG +P  C +C G+G+V
Sbjct: 117 NNRGSDLRYDLSITLEEAYEGKKQDIKFSTTEKCNTCSGNGSKPGHSPDRCTVCGGNGKV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
            +  Q FF++++ C  C GSG+ I +PC+ C+GQG     K +SV +P GVDDGTRIRL+
Sbjct: 177 RSN-QGFFTVQQTCPQCAGSGEEITNPCTDCNGQGNKQASKKISVTIPKGVDDGTRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  GGA GDLY+F++V  H  FKR   +L+   PISI   A+G T ++ T+D   
Sbjct: 236 GKGEAGSKGGANGDLYLFVNVHSHDLFKRSDENLFFEFPISIADAALGTTIEIPTIDGGK 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP+GTQ GKQFRLKGKGMP +     GDLYVQV  E P  LNK Q+ LLE+F +I 
Sbjct: 296 AKIKIPDGTQNGKQFRLKGKGMPYMRGSGNGDLYVQVNTEVPISLNKEQKALLEKFREIE 355

Query: 361 SQDNNPQSTGFFARMKDFF 379
           ++ +NP    FF + K F+
Sbjct: 356 NEKSNPSIKQFFQKAKSFW 374


>gi|239814717|ref|YP_002943627.1| chaperone protein DnaJ [Variovorax paradoxus S110]
 gi|239801294|gb|ACS18361.1| chaperone protein DnaJ [Variovorax paradoxus S110]
          Length = 378

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 243/382 (63%), Gaps = 13/382 (3%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND--PEAKEKFAQISEAYEVLRDP 60
           K D+Y+ LG+ +NA++ ++K A+R LAMK+HPD+N  D   +A+ KF ++ EAYE+L D 
Sbjct: 4   KRDYYETLGVPKNASEEEIKKAYRKLAMKHHPDRNHGDTTKDAETKFKEVKEAYEMLSDA 63

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++   +            G   F+E F  IFG + G  R        
Sbjct: 64  QKRAAYDQYGHAGVDPNMRGGPG------AEGFGGFAEAFGDIFGDVFGGARGRTSGGRQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DL Y +E++LEEA  GK  QIR P+   C TC G+GAKPGT P+ C  C+G+G V
Sbjct: 118 VFRGSDLSYAMEVTLEEAAEGKEAQIRIPSWDDCGTCKGTGAKPGTKPITCTTCHGAGAV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C TC GSG+IIP PC+ CHGQG++   K L V +P G+DDG RIR +
Sbjct: 178 -QMRQGFFSVQQTCPTCHGSGKIIPEPCTVCHGQGKIKNNKTLEVKIPAGIDDGMRIRST 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G  GG PGDLYI I +KKH+ F+RDG DL+C VP+S+ T A+GG   V TL    
Sbjct: 237 GNGEPGTNGGPPGDLYIEIRLKKHELFERDGDDLHCVVPVSMTTAALGGEISVPTLKGA- 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           + + IP+GTQ+GKQFRL+GKG+  + S   GDLY  V+VETP KL + QR+LL+E ++  
Sbjct: 296 AAIDIPDGTQSGKQFRLRGKGIKGVRSSYPGDLYCHVRVETPVKLTEHQRKLLKELDESL 355

Query: 361 SQ---DNNPQSTGFFARMKDFF 379
            +    ++P   G+F + K+FF
Sbjct: 356 KKGGDKHSPTDKGWFDKAKEFF 377


>gi|68171951|ref|ZP_00545263.1| DnaJ central region:Heat shock protein DnaJ, N-terminal:Chaperone
           DnaJ, C-terminal [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657578|ref|YP_506858.1| chaperone protein DnaJ [Ehrlichia chaffeensis str. Arkansas]
 gi|123494081|sp|Q2GI75|DNAJ_EHRCR RecName: Full=Chaperone protein dnaJ
 gi|67998630|gb|EAM85371.1| DnaJ central region:Heat shock protein DnaJ, N-terminal:Chaperone
           DnaJ, C-terminal [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599035|gb|ABD44504.1| chaperone protein DnaJ [Ehrlichia chaffeensis str. Arkansas]
          Length = 380

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 266/383 (69%), Gaps = 5/383 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y +LG+ ++AT  ++K A+R +A+KYHPD+N  + EA+EKF ++SEAY+VL D 
Sbjct: 1   MSKSDYYDLLGVSKSATPEEIKKAYRKMALKYHPDKNPGNKEAEEKFKELSEAYDVLIDQ 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A +    S G GGF      + DFS++F  +FGG    GR   R   +
Sbjct: 61  DKRAAYDKYGHNAFD----SSGRGGFDFNSGFSGDFSDIFNDLFGGGFRGGRGSSRRHDS 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G  G+DLR+++EI+LE++F+GK V I + T VKCS+CSGSG++     + C+ C+G G V
Sbjct: 117 GAVGSDLRFDIEITLEDSFNGKKVPISYVTYVKCSSCSGSGSEGSAKSVQCSTCHGVGNV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T Q FF+IER C  C G G+II + C KC G GRV +E  L V +P G++ G +IRL+
Sbjct: 177 -RTQQGFFTIERTCHVCNGEGEIIQNKCKKCSGSGRVRDEVNLLVTIPKGIESGNKIRLN 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  G   GDLY++ +++KH+FF R+G+DLYC VPI +   A+GG  ++ ++D T 
Sbjct: 236 GKGEAGYRGARSGDLYVYSNIQKHKFFTRNGSDLYCNVPIKMTLAALGGHIEMPSIDGTW 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           ++V +PEG+Q G + RLK KGMP+INS ++GD+Y+Q+ VETP KL K+Q+ELL++F+   
Sbjct: 296 TKVKVPEGSQNGDKLRLKEKGMPIINSSKRGDMYIQITVETPVKLTKKQKELLQKFDDEP 355

Query: 361 SQDNNPQSTGFFARMKDFFDSLK 383
           + D NPQSTGFF ++K F+  ++
Sbjct: 356 NVDCNPQSTGFFQKVKSFWKDIR 378


>gi|85374039|ref|YP_458101.1| chaperone protein DnaJ [Erythrobacter litoralis HTCC2594]
 gi|84787122|gb|ABC63304.1| DnaJ molecular chaperone [Erythrobacter litoralis HTCC2594]
          Length = 369

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 180/377 (47%), Positives = 239/377 (63%), Gaps = 13/377 (3%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           + D Y++LG+DR A    +K+A+R LAMKYHPD+N  D +A+  F  +  AYEVL+DPQK
Sbjct: 4   ETDLYKLLGVDRGADAAAIKSAYRKLAMKYHPDRNPGDADAETHFKAVGAAYEVLKDPQK 63

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH A + G       G GAG     D  ++FE IFG   G G   ++      
Sbjct: 64  RAAYDRYGHAAFQNG-------GGGAGQPDFGDIGDIFETIFGSAFGGGGRQRQRRG--- 113

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
             ADLRY+++I+L+EAF GK  QI    +  C TCSGSGA+PGT    CN+CNG G+V  
Sbjct: 114 --ADLRYDMQITLDEAFHGKDTQIEIEVSATCDTCSGSGAEPGTGTRGCNLCNGYGKVRA 171

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
             Q FF +ER C  C G G+++   C  C G+GRV +E+ L V VPPGVD GTRIRLSG+
Sbjct: 172 Q-QGFFMVERPCPNCHGRGEVLEEACHSCRGEGRVDKEQALKVEVPPGVDTGTRIRLSGK 230

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG  G  PGDLYIF+ VK H+ F+RDG  L   VP+S  T A+GG   +  LD + + 
Sbjct: 231 GEAGPRGAPPGDLYIFLHVKPHEVFERDGTSLVTRVPVSFTTAALGGCVTIPDLDGSTNA 290

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           + IP G Q+GKQ R +G GMPV+    +GDL V+V VETP +L+K Q+ +LE+F +  + 
Sbjct: 291 IDIPAGIQSGKQLRKRGAGMPVLQGRGRGDLVVEVLVETPTRLSKDQKAILEQFRETETG 350

Query: 363 DNNPQSTGFFARMKDFF 379
           D  PQS GFF ++K+ F
Sbjct: 351 DECPQSRGFFDKIKEAF 367


>gi|159046110|ref|YP_001534904.1| chaperone protein DnaJ [Dinoroseobacter shibae DFL 12]
 gi|189083318|sp|A8LQ63|DNAJ_DINSH RecName: Full=Chaperone protein dnaJ
 gi|157913870|gb|ABV95303.1| chaperone protein DnaJ [Dinoroseobacter shibae DFL 12]
          Length = 383

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 249/387 (64%), Gaps = 7/387 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ + A+  ++K  FR  A + HPD+N ++P A+ +F + +EAY++L+DP
Sbjct: 1   MAKRDYYDVLGVSKGASPDEIKKGFRKKAKELHPDRNSDNPNAEAQFKEANEAYDILKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN---SDFSELFEGIFGGIMGSGRSYKRS 117
            K+A YD+ GH A E G+      G   G       S FS++FE +FG  MG        
Sbjct: 61  DKKAAYDRYGHAAFENGSGGPRGPGGFGGQGQGDFASAFSDVFEDLFGDFMGG--QRGGG 118

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 G+DLRYNL I+LE+AF G    I  P  V CS C G+GA+ G  P+ C  C+G 
Sbjct: 119 RQRAARGSDLRYNLRITLEQAFMGMQKTISVPGTVSCSACEGTGAEGGAEPVVCPTCSGM 178

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF+IE+ C TC G GQII +PC  C G GR  + + LSVN+P GV+ GTRI
Sbjct: 179 GKVRAQ-QGFFTIEKTCPTCSGMGQIIKNPCQACRGAGREEKTRALSVNIPAGVETGTRI 237

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RL+GEG AGV GG  GDLYIFI V++H+ F+R+G DLYC VP+S+ + A+GG  +V T++
Sbjct: 238 RLAGEGDAGVRGGPSGDLYIFIEVEEHRIFQREGLDLYCRVPVSMTSAALGGDVEVPTIE 297

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
              SRV IP G+Q+G+Q RL+GKGMP +     GD+++++ VETP  L  RQRELL EFE
Sbjct: 298 GGRSRVKIPSGSQSGRQMRLRGKGMPALRGAGTGDMFIELAVETPVNLTMRQRELLREFE 357

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLKN 384
              SQDN P+++ FF  +K F+D +K+
Sbjct: 358 A-ESQDNQPETSKFFKTVKSFWDGMKS 383


>gi|325276147|ref|ZP_08141954.1| chaperone protein DnaJ [Pseudomonas sp. TJI-51]
 gi|324098723|gb|EGB96762.1| chaperone protein DnaJ [Pseudomonas sp. TJI-51]
          Length = 374

 Score =  358 bits (920), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 192/384 (50%), Positives = 246/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R AT+  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVERGATEADLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA +DQ GH  ++      G G  GA      +FS++F  +F    G           
Sbjct: 61  SKRAAFDQYGHAGVDPSMGGGGPGFGGA------NFSDIFGDVFSDFFGG--GRGGGRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC+ CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIITDPCTSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ ISV++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGTHGGPTGDLYVVISVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLRIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 351 EGDSSHSPKASGWFDGVKRFFGDL 374


>gi|330888674|gb|EGH21335.1| chaperone protein DnaJ [Pseudomonas syringae pv. mori str. 301020]
          Length = 380

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 250/385 (64%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSESDLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR        
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRGGGGGGRG 117

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRY LE++LEEA  G  V IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTNVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 356 LENDESHSPKASGWFEGVKRFFGDL 380


>gi|307728535|ref|YP_003905759.1| chaperone protein DnaJ [Burkholderia sp. CCGE1003]
 gi|307583070|gb|ADN56468.1| chaperone protein DnaJ [Burkholderia sp. CCGE1003]
          Length = 378

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 184/383 (48%), Positives = 246/383 (64%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G      R+   
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGAQGFGGFADAFGDIFGDIFGQAAGGAARGGRAGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+GSG V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCSGSGAV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGAGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++FE+  
Sbjct: 296 ASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTESQRDLLKQFEKAL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
            +    ++PQS  +F R+K FFD
Sbjct: 356 VEGGARHSPQSKSWFDRVKSFFD 378


>gi|320329989|gb|EFW85976.1| chaperone protein DnaJ [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330875237|gb|EGH09386.1| chaperone protein DnaJ [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 380

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 249/385 (64%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G G    G  G ++FS++F  +F    G GR        
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGCGFGGGAGGANFSDIFGDVFSDFFGGGRGGGGGGRG 117

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRY LE++LEEA  G  V IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTNVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 356 LENDESHSPKASGWFEGVKRFFGDL 380


>gi|257482275|ref|ZP_05636316.1| dnaJ protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289646947|ref|ZP_06478290.1| chaperone protein DnaJ [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488442|ref|ZP_07006473.1| Chaperone protein DnaJ [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298157067|gb|EFH98156.1| Chaperone protein DnaJ [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320322542|gb|EFW78635.1| chaperone protein DnaJ [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|330868232|gb|EGH02941.1| chaperone protein DnaJ [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330950321|gb|EGH50581.1| chaperone protein DnaJ [Pseudomonas syringae Cit 7]
 gi|330987041|gb|EGH85144.1| chaperone protein DnaJ [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011484|gb|EGH91540.1| chaperone protein DnaJ [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 380

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 250/385 (64%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR        
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRGGGGGGRG 117

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRY LE++LEEA  G  V IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTNVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 356 LENDESHSPKASGWFEGVKRFFGDL 380


>gi|71083073|ref|YP_265792.1| chaperone protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|123647167|sp|Q4FNQ0|DNAJ_PELUB RecName: Full=Chaperone protein dnaJ
 gi|71062186|gb|AAZ21189.1| Chaperone protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 376

 Score =  358 bits (920), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 251/379 (66%), Gaps = 5/379 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY VLG+ ++A+  +LK+A+R LA+KYHPD+N  D  +++KF +  EAY VL D 
Sbjct: 1   MAKRDFYDVLGVSKSASPEELKSAYRKLAVKYHPDKNPGDKASEDKFKEAGEAYGVLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+  YD  GH A E G   QG G    G +G +DFS++FE  FG   G G+S  R   T
Sbjct: 61  EKKQNYDNFGHAAFEGGGGRQGGGF--GGGFGGADFSDIFEDFFGD-FGGGQSRGRRK-T 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY+L I+LEEA+ GK   I+F T  KC+TC+G+G+KPG +P  C +C G+G+V
Sbjct: 117 NNRGSDLRYDLSITLEEAYEGKKQDIKFSTTEKCNTCNGNGSKPGHSPDRCTVCGGNGKV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
            +  Q FF++++ C  C GSG+ I +PC+ C+GQG     K +SV +P GVDDGTRIRL+
Sbjct: 177 RSN-QGFFTVQQTCPQCAGSGEEITNPCTDCNGQGNKQASKKISVTIPKGVDDGTRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  GGA GDLY+F++V  H  FKR   +L+   PISI   A+G T ++ T+D   
Sbjct: 236 GKGEAGSKGGANGDLYLFVNVHSHDLFKRSDENLFFEFPISIADAALGTTIEIPTIDGGK 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP+GTQ GKQFRLKGKGMP +     GDLYVQV  E P  LNK Q+ LLE+F +I 
Sbjct: 296 AKIKIPDGTQNGKQFRLKGKGMPYMRGSGNGDLYVQVNTEVPISLNKEQKALLEKFREIE 355

Query: 361 SQDNNPQSTGFFARMKDFF 379
           ++ +NP    FF + K F+
Sbjct: 356 NEKSNPSIKQFFQKAKSFW 374


>gi|71737230|ref|YP_276325.1| chaperone protein DnaJ [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|123635183|sp|Q48E63|DNAJ_PSE14 RecName: Full=Chaperone protein dnaJ
 gi|71557783|gb|AAZ36994.1| dnaJ protein [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 380

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 249/385 (64%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR        
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRGGGGGGRG 117

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRY LE++LEEA  G  V IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTNVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL   V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCHVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 356 LENDESHSPKASGWFEGVKRFFGDL 380


>gi|58617677|ref|YP_196876.1| chaperone DnaJ [Ehrlichia ruminantium str. Gardel]
 gi|62899920|sp|Q5FGQ8|DNAJ_EHRRG RecName: Full=Chaperone protein dnaJ
 gi|58417289|emb|CAI28402.1| Chaperone protein dnaJ [Ehrlichia ruminantium str. Gardel]
          Length = 382

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 184/384 (47%), Positives = 266/384 (69%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y +LG+ +NAT  ++K A+R +A+KYHPD+N  D  A+EKF ++SEAY+VL D 
Sbjct: 1   MSKSDYYDLLGLSKNATPEEIKKAYRKMALKYHPDKNPGDKAAEEKFKELSEAYDVLIDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A   G+   G GGF      ++DFS++F  +FGG    GRS  +    
Sbjct: 61  DKRAAYDRYGHSAFSDGS---GRGGFDFNSGFSTDFSDIFNDLFGGGFRGGRSSSKRQDG 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G  G+DLR ++EI+LE++F+G  V I + T VKCS+CSGSG++     + CN C+G+G  
Sbjct: 118 GTVGSDLRLDIEITLEDSFNGTKVPINYVTHVKCSSCSGSGSEGSVKSVQCNTCHGAGNT 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T Q FF+IER C  C G G+II + C KC G GRV +E  L V VP G++ G +IRL+
Sbjct: 178 -RTQQGFFTIERTCHVCNGEGEIIKNKCKKCSGSGRVRDEVNLLVTVPKGIESGDKIRLN 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  G   GDLY++ ++KKH+FF R+GADLYC VPI ++   +GG  ++ ++D T 
Sbjct: 237 GKGEAGYRGAQSGDLYVYPNIKKHKFFTRNGADLYCNVPIKMILATLGGHIEMPSIDGTW 296

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF-EQI 359
           ++V +PEG+Q G + RLK KGMPVINS R+GD+Y+Q+ VETP  L K+Q+ELL++F E+ 
Sbjct: 297 TKVKVPEGSQNGDKLRLKEKGMPVINSSRRGDMYIQITVETPINLTKQQKELLKKFDEEP 356

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
           ++ + NPQSTGFF ++K F++ ++
Sbjct: 357 NTVECNPQSTGFFQKVKSFWNDIR 380


>gi|134294825|ref|YP_001118560.1| chaperone protein DnaJ [Burkholderia vietnamiensis G4]
 gi|189083306|sp|A4JBS2|DNAJ_BURVG RecName: Full=Chaperone protein dnaJ
 gi|134137982|gb|ABO53725.1| chaperone protein DnaJ [Burkholderia vietnamiensis G4]
          Length = 378

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 243/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N ++ +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    +    G          F ++F  IFG   G      R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMAGAGGQGFGGFADAFGDIFGDIFGQAAGGAARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQGTV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+  
Sbjct: 296 ASFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEKSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F RMK FF+
Sbjct: 356 AEGGARHSPQSKSWFDRMKSFFE 378


>gi|148549794|ref|YP_001269896.1| chaperone protein DnaJ [Pseudomonas putida F1]
 gi|189083349|sp|A5W9A2|DNAJ_PSEP1 RecName: Full=Chaperone protein dnaJ
 gi|148513852|gb|ABQ80712.1| chaperone protein DnaJ [Pseudomonas putida F1]
          Length = 374

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 247/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R AT+  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVERGATEADLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA +DQ GH  ++      GA       +G ++FS++F  +F    G           
Sbjct: 61  SKRAAFDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG--GRGGGRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC+ CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIITDPCTSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ ISV++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGTHGGPTGDLYVVISVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 351 EGDSSHSPKASGWFDGVKRFFGDL 374


>gi|167643979|ref|YP_001681642.1| chaperone protein DnaJ [Caulobacter sp. K31]
 gi|167346409|gb|ABZ69144.1| chaperone protein DnaJ [Caulobacter sp. K31]
          Length = 382

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 249/386 (64%), Gaps = 17/386 (4%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++LG+DR+  +  LK AFR +AM++HPD+N     A  +F +I+EAY VL D QKRA
Sbjct: 3   DYYEILGVDRSTDEAGLKAAFRKMAMEHHPDRNGGCENASSRFKEINEAYSVLSDAQKRA 62

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTG-EA 123
            YD+ GH  ++     QG     AG   N  F ++F  +FGG        +R SS G + 
Sbjct: 63  AYDRFGHAGVQGAQGGQGGFSGDAGDIFNDVFGDVFGEMFGG--------RRQSSNGPQR 114

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTT 183
           G DLRY+LEI+LE+A++G  V+I+ P A+ C  C GSGAKPGT+P  C  C G+GRV  T
Sbjct: 115 GQDLRYDLEITLEQAYAGAEVEIKVPAAITCEVCDGSGAKPGTSPTVCGSCGGAGRVRAT 174

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
            Q FF++ERAC  C GSG+++  PC  CHG G+V  E++LSV +P GVDDG RIRL+GEG
Sbjct: 175 -QGFFAVERACPRCGGSGRLVLDPCVNCHGHGQVRRERVLSVRIPAGVDDGARIRLAGEG 233

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL---DATH 300
            AG  GG  GDLY+F+SV  H+ F+RDG DL CTVP+ +   A+GG  +   L   +A  
Sbjct: 234 DAGARGGPRGDLYLFLSVIPHELFERDGLDLLCTVPVPMTVAALGGDIEAPCLLGGEACD 293

Query: 301 SR----VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
            +    V +PEG QTG+  RLKGKGMP + S ++GDL V++ VETP  L+ RQ+ELL E 
Sbjct: 294 GKCRITVKVPEGAQTGRTVRLKGKGMPSLRSRQRGDLVVELFVETPTHLSARQKELLAEL 353

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
             + S+  NP+S  F  + K F++ +
Sbjct: 354 AGLCSEKQNPKSANFVGKAKRFWEEV 379


>gi|254491268|ref|ZP_05104449.1| chaperone protein DnaJ [Methylophaga thiooxidans DMS010]
 gi|224463781|gb|EEF80049.1| chaperone protein DnaJ [Methylophaga thiooxydans DMS010]
          Length = 374

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 188/383 (49%), Positives = 252/383 (65%), Gaps = 12/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLGI R AT+ ++K A+R +AMKYHPD+N +D EA+ KF +  EAYE+L D 
Sbjct: 1   MAKRDFYEVLGISRTATEAEIKKAYRRMAMKYHPDRNPDDAEAESKFKEAKEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YDQ GH+ ++     Q  GG      G   FS++F  +F  I G+G +  R  + 
Sbjct: 61  QKRTAYDQFGHDGVD-----QSMGGGFGRGGGAGGFSDIFGDVFNDIFGAGGAGGRQQAY 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY L++SLEEA +G T +IR P  V+C TC GSGAK GT P+ C  C G G+V
Sbjct: 116 --RGADLRYRLDLSLEEAVAGTTAKIRIPVNVECKTCDGSGAKKGTEPVTCTTCGGHGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G+G++I  PC+ CHG+G V E K LSV VP GVD G RIRL 
Sbjct: 174 RIQ-QGFFTMQQACPHCGGTGKMIKDPCTDCHGEGFVQENKTLSVKVPAGVDTGDRIRLQ 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ +SVK+H  F RDG +L+C VP+S VT A+GG  +V TL+   
Sbjct: 233 GEGEAGSHGAPAGDLYVEVSVKRHDVFTRDGTNLFCDVPLSFVTAALGGDVEVPTLEG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE--- 357
           + + IPEGTQTG+QFRL+GKG+  +  G  GDL  +V +ETP KL+K+Q+ELL+E E   
Sbjct: 292 ANLKIPEGTQTGQQFRLRGKGIQSVRGGAIGDLMCRVIIETPVKLSKKQKELLQELEDTM 351

Query: 358 QISSQDNNPQSTGFFARMKDFFD 380
           Q     +NP+ + +   +K FF+
Sbjct: 352 QGGGDKHNPKHSSWLDAVKRFFE 374


>gi|291614589|ref|YP_003524746.1| chaperone protein DnaJ [Sideroxydans lithotrophicus ES-1]
 gi|291584701|gb|ADE12359.1| chaperone protein DnaJ [Sideroxydans lithotrophicus ES-1]
          Length = 374

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 243/382 (63%), Gaps = 13/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A++ ++K A+R LAMK+HPD+N ++P+A+E F +  EAYE L D 
Sbjct: 1   MSKRDYYEVLGVNRDASEEEIKKAYRKLAMKHHPDRNPDNPKAEEHFKEAKEAYETLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G      G  G  DF ++F  IF          +   S 
Sbjct: 61  QKRAAYDQYGHSAFEAGGMGGGNPFGAGGAQG-FDFGDIFGDIF-------GGGRGGRSQ 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+EI+LEEA  G   QIR P   +C TCSGSGAKPGT+   C  C G G+V
Sbjct: 113 AHRGADLRYNMEITLEEAARGAEKQIRIPVMEECETCSGSGAKPGTSATTCQTCAGHGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG+ I  PC  CHG GRV ++K L + +P G+D G R+R S
Sbjct: 173 RMQ-QGFFSVQQTCPRCHGSGKQISSPCKDCHGTGRVKKQKTLEIKIPAGIDSGMRLRHS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G AG +G   GDLY+ I +K+H  F+RDG DL+C +PIS  T A+GG  ++ TLD   
Sbjct: 232 GHGEAGSHGAPHGDLYVEIHIKQHSVFQRDGDDLHCEMPISFATAALGGEIEIPTLDGA- 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+ IP  TQ+GKQFRL+GKG+  + +   GDL+  V VETP  L  RQ+ELL EF+ IS
Sbjct: 291 ARIKIPAETQSGKQFRLRGKGIKGMRTHTHGDLHCHVVVETPSNLTDRQKELLREFDAIS 350

Query: 361 SQD---NNPQSTGFFARMKDFF 379
            QD   ++P++  +  ++K+FF
Sbjct: 351 QQDSARHSPRAKSWMGKVKEFF 372


>gi|312795192|ref|YP_004028114.1| chaperone protein dnaJ [Burkholderia rhizoxinica HKI 454]
 gi|312166967|emb|CBW73970.1| Chaperone protein dnaJ [Burkholderia rhizoxinica HKI 454]
          Length = 375

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 245/383 (63%), Gaps = 11/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG+ +NA+D  +K A+R LAMKYHPD+N  + +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYDVLGVAKNASDDDIKKAYRKLAMKYHPDRNPGNKDAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + GA G          F ++F  IFG   G GR   R+   
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGAAGAQGFGGFADAFGDIFGDIFGQAAGGGR---RAGPQ 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G G+V
Sbjct: 115 VYRGADLRYSMEITLEQAAHGYETQIRVPSWASCQVCRGSGAKPGTKPETCPTCHGQGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++AC  C G+G  +P PC+ CHG G+V E K L V +P G+D+G RIR +
Sbjct: 175 -RMSQGFFSIQQACPKCHGTGTYVPEPCAHCHGVGKVKENKTLEVKIPAGIDEGMRIRSA 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI+  T A+GG  +V TL A  
Sbjct: 234 GNGEPGINGGPNGDLYVEIHIKPHTVFERDGDDLHCQMPIAFTTAALGGEIEVPTL-AGK 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL   QR+LL +FE+  
Sbjct: 293 ASFTVPEGTQSGKTFRLRGKGLKGLRSSLPGDLYVHVQVETPVKLTDTQRDLLRQFEKSL 352

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
            +    ++PQS G+F R+K FF+
Sbjct: 353 VEGGGRHSPQSKGWFDRVKSFFE 375


>gi|254483106|ref|ZP_05096340.1| chaperone protein DnaJ [marine gamma proteobacterium HTCC2148]
 gi|214036628|gb|EEB77301.1| chaperone protein DnaJ [marine gamma proteobacterium HTCC2148]
          Length = 378

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 248/385 (64%), Gaps = 12/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A  +++K A+R +AMKYHPD+N +DP+A EKF + +EAY+VL D 
Sbjct: 1   MSKRDYYEVLGVGKSADSKEVKKAYRRVAMKYHPDRNPDDPDADEKFKEATEAYDVLMDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  ++             G  G  +FS++F  +FG I G G   +   + 
Sbjct: 61  EKRAAYDQYGHAGVDPNMGG-------GGFGGGGNFSDIFGDVFGDIFGGGGGGRGGRAG 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY L+ISLE+A  G TV+IR P+   C TC GSGAK G++P+ C  C G+G+V
Sbjct: 114 PQRGSDLRYTLDISLEDAVKGTTVEIRVPSLSGCETCDGSGAKKGSSPVTCGTCGGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q  F +++ C  CRG GQ I  PC  CHGQGRV + + LSV VPPGVD G RIRLS
Sbjct: 174 -RMQQGLFQVQQTCPACRGQGQTISDPCGTCHGQGRVEKTRTLSVKVPPGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDL++ +SVK+H  F+RDG +LYC VPI+ V  A+GG  +V TLD   
Sbjct: 233 GEGEAGPQGGPSGDLFVQMSVKQHNIFERDGKNLYCEVPITFVDAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + IP  TQTGK FRL+GKG+  +  G  GDL  +  +ETP  LNKRQ+ELLEE +Q  
Sbjct: 292 VNLKIPAETQTGKLFRLRGKGVKPVRGGSVGDLLCRAVLETPVNLNKRQKELLEELQQTL 351

Query: 361 SQD---NNPQSTGFFARMKDFFDSL 382
            +D    +P+   +F  +K FFD +
Sbjct: 352 GEDGKRQSPRQHSWFEGVKSFFDDM 376


>gi|161170283|gb|ABX59253.1| DnaJ class molecular chaperone [uncultured marine bacterium
           EB000_55B11]
 gi|297183811|gb|ADI19934.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 377

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 250/380 (65%), Gaps = 6/380 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ + A++ ++K  FR  AM+ HPD+N++DP A+ KF + +EAY+VL+D 
Sbjct: 1   MSKRDYYETLGLSKGASESEIKKGFRKKAMELHPDRNQDDPSAESKFKEANEAYDVLKDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSSS 119
            K+A YDQ GH A E G    G      G    NS FS++F+ +FG   G  R     +S
Sbjct: 61  DKKAAYDQYGHAAFEGGMGGGGGRSPFGGGGDFNSAFSDVFDDLFGNFGGGQRGGPPGAS 120

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
            G   +DLRYNL++SL +A++GK   +   ++V C  CSGSGA  G+ P  C  C+G G+
Sbjct: 121 RG---SDLRYNLKVSLSDAYNGKQETVSVNSSVSCDGCSGSGAAAGSEPARCPTCSGMGK 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C TC G G+ I +PC  C+G G    E+ LSVN+P GV+ GTRIRL
Sbjct: 178 VRAQ-QGFFTVERTCPTCSGRGETITNPCKVCNGTGATQRERSLSVNIPAGVERGTRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLYIFI +  H+ F+R+G +L+  VP+S+ T A+GG  DV  +D  
Sbjct: 237 SGEGEAGQRGGPTGDLYIFIDIDDHELFEREGNNLFLRVPVSMATAALGGEIDVPNIDGN 296

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            SRV +P G Q GKQ RLKGKGMP +    KGDLY+++ VETP  L+ +Q+ELL+EFE++
Sbjct: 297 TSRVKVPMGAQAGKQMRLKGKGMPALRGSGKGDLYLEIAVETPVNLSSKQKELLKEFEEL 356

Query: 360 SSQDNNPQSTGFFARMKDFF 379
           S+ D+NP+S  FF+++K F+
Sbjct: 357 SA-DSNPESKNFFSKVKSFW 375


>gi|32491047|ref|NP_871301.1| hypothetical protein WGLp298 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|62900287|sp|Q8D2Q6|DNAJ_WIGBR RecName: Full=Chaperone protein dnaJ
 gi|25166254|dbj|BAC24444.1| dnaJ [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 374

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 257/388 (66%), Gaps = 18/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y +LGI +NA+DR++KTA++ LA+K+HPD+N  + EA+ KF +I EAYEVL DP
Sbjct: 1   MAKSDYYDILGISKNASDREIKTAYKRLAVKFHPDRNPGNLEAESKFKEIKEAYEVLLDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA Y+Q GH A + G+ +            N+DFS++F  +FG I G+ R  KRS+  
Sbjct: 61  KKRAAYNQYGHTAFDQGSSN-------TEFTSNADFSDIFGDVFGDIFGNNRR-KRSNR- 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DL+YN+ +SLEEA  G + +I  P   +C+ CSG G +PGT+  +C+ CNG G++
Sbjct: 112 ---GSDLQYNINLSLEEAVKGISKEITIPKLERCNICSGKGMQPGTSAQNCSTCNGQGQI 168

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C +CRG  +II  PC  C GQGRV   K +S+ +P GVD+G +IRLS
Sbjct: 169 -QMRQGFFSVQQTCPSCRGKCKIIRFPCRNCSGQGRVERSKNISIRIPAGVDNGDKIRLS 227

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG+ GDLY+ ISVK+H  FKR+  +LYC VPI+    A+GG  +V  LD   
Sbjct: 228 GEGEAGKLGGSSGDLYVKISVKEHPIFKREEHNLYCEVPINFAMAALGGDIEVPALDG-R 286

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQTG+ FR++GKG+  I SG +GDL  +V VETP +L+++Q+ LL+E    F
Sbjct: 287 VKLRIPAETQTGRLFRMRGKGVKSIRSGHQGDLLCRVVVETPVRLSEKQKSLLKELGISF 346

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSLKN 384
              +   N+P+S  FF  +K FFD L N
Sbjct: 347 VGRTGMYNSPRSKSFFDGVKKFFDGLTN 374


>gi|238026301|ref|YP_002910532.1| chaperone protein DnaJ [Burkholderia glumae BGR1]
 gi|237875495|gb|ACR27828.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Burkholderia glumae BGR1]
          Length = 378

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 244/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E+F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEERFKEVKEAYEMLSDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G      R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGAQGFGGFADAFGDIFGDIFGQAAGGAARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYETQIRVPSWVSCEICHGSGAKPGTKPDTCPTCHGQGSV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPSGDLYVEIHIKSHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQ+ETP KL   QR+LL++FEQ  
Sbjct: 296 ASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQIETPVKLTDVQRDLLKQFEQSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 356 AEGGGRHSPQSKSWFDRVKSFFE 378


>gi|170703503|ref|ZP_02894264.1| chaperone protein DnaJ [Burkholderia ambifaria IOP40-10]
 gi|171320257|ref|ZP_02909313.1| chaperone protein DnaJ [Burkholderia ambifaria MEX-5]
 gi|170131588|gb|EDT00155.1| chaperone protein DnaJ [Burkholderia ambifaria IOP40-10]
 gi|171094486|gb|EDT39544.1| chaperone protein DnaJ [Burkholderia ambifaria MEX-5]
          Length = 378

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 243/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEVKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G      R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGGQGFGGFADAFGDIFGDIFGQAAGGAARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQGTV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPPGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+  
Sbjct: 296 ASFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEKSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 356 AEGGARHSPQSKSWFDRVKSFFE 378


>gi|94676848|ref|YP_588982.1| chaperone protein DnaJ [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|94219998|gb|ABF14157.1| chaperone protein DnaJ [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 372

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 248/386 (64%), Gaps = 20/386 (5%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y +LG+ +NA +R++K A++ LAMK+HPD+N  + EA+ KF +I EAYE+L D 
Sbjct: 1   MAKSDYYHILGVPKNADEREIKKAYKRLAMKFHPDRNPGNAEAEVKFKEIKEAYEILTDV 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G  S G G         +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHMAFESGNSSMGGG---------TDFSDIFGEVFGDIFGGGRRQRASR-- 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E++LEEA  G T +I  P   +C TC GSGAKPGT+ + C  C+G  +V
Sbjct: 110 ---GADLRYNIELTLEEAVRGVTREICIPVLGECQTCHGSGAKPGTSSITCPTCHGQCQV 166

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G++I  PC KC+G GR+ + K LSV +P GVD G RIRLS
Sbjct: 167 -QIRQGFFTVQQACPTCNGQGKVIKDPCVKCNGNGRLKKSKTLSVKIPSGVDTGDRIRLS 225

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG YG   GDLY+ + V+KH  F+R+  +LYC VPI+    A+GG  +V T+D   
Sbjct: 226 GEGEAGEYGAQAGDLYVQVKVRKHLIFEREDNNLYCEVPINFAMAALGGEIEVPTIDG-K 284

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTG+  R++GKG+  + SG  GDL  +V VETP KLN+RQ++LL + E   
Sbjct: 285 LKLKVPAETQTGRILRIRGKGVKSMRSGSYGDLLCRVVVETPVKLNERQKQLLLDLEDSF 344

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S   N+P+   F   +K FFD L
Sbjct: 345 GGPSGNKNSPRLKNFLDGVKKFFDDL 370


>gi|21328691|gb|AAM48697.1| dnaJ protein [uncultured marine proteobacterium]
          Length = 382

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 256/383 (66%), Gaps = 4/383 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LGI + AT  ++K A+R  A + HPD+N ++P ++  F + +EAYEVL+D 
Sbjct: 1   MSKRDYYETLGISKGATAEEIKKAYRRKAKELHPDRNADNPASEGLFKEANEAYEVLKDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YD+ GH A E G    G G  G     +S FS++F+ +FG  MG           
Sbjct: 61  NKKAAYDRYGHAAFEGGMGGGGGGRPGGQGDFSSAFSDVFDDLFGDFMGG--RGGGGRQR 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+ ++LEEAF G    I  PTAV C+ CSG+GA  G+ P  C  C+G G+V
Sbjct: 119 AARGADLRYNMHVTLEEAFRGLQKTINVPTAVSCANCSGTGAASGSAPATCGTCSGMGKV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ER C +C G+GQ+I +PCS CHG GRV +++ LSVN+P GV+ GTRIRLS
Sbjct: 179 RAQ-QGFFTVERTCPSCSGAGQVIKNPCSSCHGAGRVEKDRALSVNIPAGVETGTRIRLS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYIFI V  HQ F+R+G +L+C VP+S+ + A+GG  +V  +D   
Sbjct: 238 GEGEAGARGGPQGDLYIFIEVADHQIFEREGNNLFCNVPVSMTSAALGGDIEVPNIDGGR 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++QVETP  L  RQ+E+L+EFE +S
Sbjct: 298 SRVKIPSGSQSGRQMRLRSKGMPSVRGGGVGDMFIELQVETPVNLTARQKEILKEFEALS 357

Query: 361 SQDNNPQSTGFFARMKDFFDSLK 383
           S DN+P+S GFF ++K F+D +K
Sbjct: 358 S-DNSPESQGFFKKVKRFWDGVK 379


>gi|83644087|ref|YP_432522.1| chaperone protein DnaJ [Hahella chejuensis KCTC 2396]
 gi|123534487|sp|Q2SMM7|DNAJ_HAHCH RecName: Full=Chaperone protein dnaJ
 gi|83632130|gb|ABC28097.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Hahella chejuensis KCTC 2396]
          Length = 375

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 252/386 (65%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+   +++K A+R LAMKYHPD+N  D  A+E F + +EAY+VL D 
Sbjct: 1   MAKRDYYEVLGVSRDVDGKEVKKAYRRLAMKYHPDRNPGDASAEEMFKEATEAYDVLSDD 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A +        G  G + FS++F  +FG I G G   +  ++ 
Sbjct: 61  QKRAAYDQFGHAGVDGNAGA-------GGFGGGASFSDIFGDVFGDIFGGGGGGRTRANR 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G   +DLRY L++ LEEA  G TV+IR P+ V+C +CSGSGA+ GT P  C  CNG+G+V
Sbjct: 114 G---SDLRYTLDLDLEEAVRGTTVKIRVPSQVECKSCSGSGAEKGTQPETCGTCNGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  CRG+G+I+ +PC  CHG G V E+K LSV VP GVD G RIRLS
Sbjct: 171 -RMQQGFFSIQQTCPRCRGAGKIVRNPCRSCHGSGYVEEQKTLSVKVPAGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  GV GG PGDLY+ ++V++H+ F RDG +LYC VPIS V  A+GG  +V TLD   
Sbjct: 230 GEGEPGVNGGPPGDLYVQVAVREHKIFTRDGRNLYCEVPISFVDAALGGELEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE--- 357
            ++ IPE TQTG+ FRL+GKG+  +  G  GDL  +V VETP  L K+Q++LL EF+   
Sbjct: 289 VKLKIPEETQTGRLFRLRGKGVTPVRGGAPGDLLCRVVVETPVNLTKKQKDLLREFQTSM 348

Query: 358 QISSQDNNPQSTGFFARMKDFFDSLK 383
           + S     P+   +F  +K FFD +K
Sbjct: 349 EESGGQQAPKKHSWFEGVKSFFDDMK 374


>gi|167035718|ref|YP_001670949.1| chaperone protein DnaJ [Pseudomonas putida GB-1]
 gi|189083350|sp|B0KIS4|DNAJ_PSEPG RecName: Full=Chaperone protein dnaJ
 gi|166862206|gb|ABZ00614.1| chaperone protein DnaJ [Pseudomonas putida GB-1]
          Length = 374

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 190/384 (49%), Positives = 247/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R A++  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVERGASEADLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA +DQ GH  ++      GA       +G ++FS++F  +F    G           
Sbjct: 61  SKRAAFDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG--GRGGGRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC+ CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIITDPCTSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ ISV++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGTHGGPTGDLYVVISVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 351 EGDSSHSPKASGWFDGVKRFFGDL 374


>gi|239996001|ref|ZP_04716525.1| Chaperone protein dnaJ [Alteromonas macleodii ATCC 27126]
          Length = 376

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 191/387 (49%), Positives = 256/387 (66%), Gaps = 14/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+D++A +R++K A++ LAMKYHPD+ + D   ++KF +I EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVDKSAGEREIKKAYKKLAMKYHPDRTQGDKGLEDKFKEIQEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    ++G GGFG G      F ++F  IFGG  G  +S  R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNRGGGGFGGGADFGDIFGDVFGDIFGGGRGGRQSRARQ--- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE++LEEA  GK+V IR PT V+C  C GSGAK G++P  C  C+G+G+V
Sbjct: 115 ---GSDLRYNLELTLEEAVRGKSVDIRVPTLVECEVCDGSGAKKGSSPKTCPTCHGNGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHG GR  + K L+V +P GVD G RIRLS
Sbjct: 172 -QMRQGFFAVQQTCPTCSGKGKIIEDPCNSCHGHGRKEKTKTLNVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G  PGDLY+ + V++H  FKRDG +LYC VP+S  T A+GG  +V TLD   
Sbjct: 231 GEGEAGENGAPPGDLYVQVHVREHDIFKRDGNNLYCEVPLSFTTAALGGELEVPTLDGKV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
                PE TQTG+ FRL+GKG+  + SG  GDL  +V VETP  L+ RQ+ELL+E E+  
Sbjct: 291 KLKISPE-TQTGRMFRLRGKGVKSVRSGAMGDLMCKVVVETPVNLSSRQKELLQELEESM 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
             +S  ++P++ GFF  +K FFD L N
Sbjct: 350 GKASSKHSPKAQGFFDGVKKFFDDLTN 376


>gi|121607966|ref|YP_995773.1| chaperone protein DnaJ [Verminephrobacter eiseniae EF01-2]
 gi|121552606|gb|ABM56755.1| chaperone protein DnaJ [Verminephrobacter eiseniae EF01-2]
          Length = 381

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 241/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE--AKEKFAQISEAYEVLR 58
           M K DFY++LG+ +NA+D ++K A+R LAMK+HPD+N+      A+EKF +  EAYE+L 
Sbjct: 3   MSKRDFYEILGVPKNASDEEIKKAYRKLAMKHHPDRNQGSTAKPAEEKFKEAKEAYEMLS 62

Query: 59  DPQKRALYDQGGHEALE---YGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYK 115
           DPQKRA YDQ GH  ++    G  S GA GFG        F+E F  IFG + G      
Sbjct: 63  DPQKRAAYDQYGHAGVDPNMRGPSSAGAEGFGG-------FAEAFGDIFGDMFGQQGGRG 115

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
           R       G+DL Y +EISLEEA  GK  QIR P    C TC GSGAKPGT+   C  C 
Sbjct: 116 RGGRQVYRGSDLSYAMEISLEEAARGKDAQIRIPAWESCDTCHGSGAKPGTSAKVCGTCR 175

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG V    Q  FS+++ C  CRG+G+IIP PC  CHGQG++ ++K L V +P G+D G 
Sbjct: 176 GSGTVQMR-QGVFSVQQTCPHCRGTGKIIPEPCMTCHGQGKIKKQKTLEVRIPAGIDGGM 234

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G  GG PGDLYI I +KKH  F+RDG DL+C VP+S +T A+GG  +V T
Sbjct: 235 RIRSTGNGEHGTNGGPPGDLYIEIRLKKHDIFERDGDDLHCQVPVSFITAALGGEIEVPT 294

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L A  + + IPEGTQ GKQFRL+GKG+  + +   GDLY  + VETP KL + QR+LL E
Sbjct: 295 L-AGKAAIDIPEGTQAGKQFRLRGKGIKGVRASYPGDLYCHIAVETPVKLTEHQRKLLRE 353

Query: 356 FE---QISSQDNNPQSTGFFARMKDFF 379
            E   +     ++P    +  R+K+ F
Sbjct: 354 LEDSLKKGGARHSPSGESWTDRLKNLF 380


>gi|227329322|ref|ZP_03833346.1| chaperone protein DnaJ [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 377

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 250/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ +NA +R++K A++ LAMKYHPD+N+ D  A+ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYESLGVAKNADEREIKKAYKRLAMKYHPDRNQGDSAAEAKFKEIKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G G  G G      F ++F  IFGG    GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGGFGGGGADFGDIFGDVFGDIFGG----GRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G T +IR P   +C  C G+GAKPG++P+ C  C+G+G+V
Sbjct: 115 ---GSDLRYNMELTLEEAVRGVTKEIRIPALEECDVCHGNGAKPGSSPITCPTCHGNGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRLS
Sbjct: 172 -QMRQGFFTVQQACPHCHGRGKIIKDPCVKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPSGDLYVQVQVKAHPIFQREENNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN+RQR+LL+E ++  
Sbjct: 290 VKLKVPAETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLNERQRQLLQELDESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  FF  +K FFD L
Sbjct: 350 GGPSGERNSPRSKNFFDGVKKFFDDL 375


>gi|153207466|ref|ZP_01946166.1| chaperone protein DnaJ [Coxiella burnetii 'MSU Goat Q177']
 gi|154705757|ref|YP_001424729.1| chaperone protein DnaJ [Coxiella burnetii Dugway 5J108-111]
 gi|165918940|ref|ZP_02219026.1| chaperone protein DnaJ [Coxiella burnetii RSA 334]
 gi|212218703|ref|YP_002305490.1| chaperone protein DnaJ [Coxiella burnetii CbuK_Q154]
 gi|189083314|sp|A9KG87|DNAJ_COXBN RecName: Full=Chaperone protein dnaJ
 gi|226735554|sp|B6J7U6|DNAJ_COXB1 RecName: Full=Chaperone protein dnaJ
 gi|120576597|gb|EAX33221.1| chaperone protein DnaJ [Coxiella burnetii 'MSU Goat Q177']
 gi|154355043|gb|ABS76505.1| chaperone protein [Coxiella burnetii Dugway 5J108-111]
 gi|165917337|gb|EDR35941.1| chaperone protein DnaJ [Coxiella burnetii RSA 334]
 gi|212012965|gb|ACJ20345.1| chaperone protein [Coxiella burnetii CbuK_Q154]
          Length = 375

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 252/384 (65%), Gaps = 13/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++RNAT+ ++K AFR LAMKYHPD+N  D +A+ KF +  EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNRNATEAEVKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYEVLCDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  +E     Q  GG GAG +G  D  ++F+ IFG I G  R      + 
Sbjct: 61  RKRASYDQFGHAGVE-----QTFGGAGAGGFGFGDLGDIFDDIFGDIFGGARG---GQAR 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL Y L +SLEEA  G +  I+ PT + C TC+GSGAK G++P  C  CNGSG++
Sbjct: 113 EQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSGAKKGSSPATCPRCNGSGQM 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
                 F  +++ CS CRG GQ+I  PC+ CHGQGR  + K LSV +PPG+D G RIRL+
Sbjct: 173 -RMQHGFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQTKTLSVKIPPGIDTGDRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G  PGDLY+ + VK H  F R+G DL+  VPI   T A+GG  ++ TLD + 
Sbjct: 232 GEGEAGLFGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPIDFTTAALGGEMEIPTLDGS- 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            R+TIP  TQ GKQFRL+GKG+  + SG  GDL   + VETP KL+  Q++ L++F ++ 
Sbjct: 291 VRLTIPPETQGGKQFRLRGKGVKALRSGAVGDLICHIVVETPVKLSPEQKDYLKQFAELL 350

Query: 361 SQD---NNPQSTGFFARMKDFFDS 381
            +D   ++P++  +F  +KDFF S
Sbjct: 351 KKDEKNHSPRTRNWFDSVKDFFTS 374


>gi|237798549|ref|ZP_04587010.1| chaperone protein DnaJ [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021402|gb|EGI01459.1| chaperone protein DnaJ [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 379

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 194/385 (50%), Positives = 248/385 (64%), Gaps = 9/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH     G      GG   G  G ++FS++F  +F    G GR+       
Sbjct: 61  SKRAAYDQYGHA----GVDPGMGGGGFGGGAGGANFSDIFGDVFSDFFGGGRAGGGGGRG 116

Query: 121 GEAG-ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           G    +DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P+ C  C G G+
Sbjct: 117 GAQRGSDLRYTLELNLEEAVRGTTVNIRVPTLVNCKPCDGSGAKKGSAPVTCPTCGGIGQ 176

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 177 V-RMQQGFFSVQQTCPRCHGQGKIISDPCDSCHGEGRVEEYKTLSVKVPPGVDTGDRIRL 235

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AGV GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 236 SGEGEAGVQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 294

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 295 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 354

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 355 LENDESHSPKASGWFEGVKRFFGDL 379


>gi|212634055|ref|YP_002310580.1| chaperone protein DnaJ [Shewanella piezotolerans WP3]
 gi|226735604|sp|B8CKF4|DNAJ_SHEPW RecName: Full=Chaperone protein dnaJ
 gi|212555539|gb|ACJ27993.1| DnaJ central region:Heat shock protein DnaJ:Chaperone DnaJ
           [Shewanella piezotolerans WP3]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 249/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R++K A++ LAMK+HPD+N  D EA+  F ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASEREVKKAYKRLAMKFHPDRNPGDKEAEASFKEVKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++               +G +DF ++F  +FG I G GR        
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGG--------GHGGADFGDVFGDVFGDIFGGGRRGGGQRQA 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYNLE+SLEEA  G + ++R PT V C  C GSGAK G+ P  C  C+G G+V
Sbjct: 113 ARG-SDLRYNLELSLEEAVKGLSKELRIPTLVACEPCDGSGAKKGSKPTTCGTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+KCHG+GRV + K LSV +P GVD G RIRLS
Sbjct: 172 -QMRQGFFAVQQACPTCHGRGKIIKDPCNKCHGEGRVEKSKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F+RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVSVREHAIFQRDGNNLYCEVPISFSKAALGGEIEVPTLDGK- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP  LN+RQ+ELL EFE+  
Sbjct: 290 VNLKIPTETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEETL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
              S+ ++P++ GFF  +K FF  L
Sbjct: 350 TGQSKKHSPKAEGFFDGVKKFFQDL 374


>gi|170727915|ref|YP_001761941.1| chaperone protein DnaJ [Shewanella woodyi ATCC 51908]
 gi|226735605|sp|B1KRT1|DNAJ_SHEWM RecName: Full=Chaperone protein dnaJ
 gi|169813262|gb|ACA87846.1| chaperone protein DnaJ [Shewanella woodyi ATCC 51908]
          Length = 378

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 250/386 (64%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VL + R+A++R++K A++ LAMK+HPD+N  D  A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLSVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAETSFKEVKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         GN+DF ++F  +FG I G GR        
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGF-------GGNADFGDVFGDVFGDIFGGGRRGGGQRQA 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYNLE+SLEEA  G T ++R PT   C TC GSGAK GT+P  C  C+G G+V
Sbjct: 114 ARG-SDLRYNLELSLEEAVKGLTKELRIPTLAHCDTCDGSGAKKGTSPTTCGTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+ CHG+GRV + K LSV +P GVD+G RIRLS
Sbjct: 173 -QMRQGFFAVQQACPTCHGRGKIIKDPCNSCHGEGRVEKSKTLSVKIPAGVDNGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGEFGAPPGDLYVQVSVREHAIFVRDGNNLYCEVPISFGKAALGGEIEVPTLDGK- 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP KLN+RQ+ELL EF++  
Sbjct: 291 VNLKIPAETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVKLNERQKELLREFDETL 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              SS+ ++P++ GFF  +K FF  L
Sbjct: 351 AGSSSKKHSPKAEGFFDGVKKFFQDL 376


>gi|161525801|ref|YP_001580813.1| chaperone protein DnaJ [Burkholderia multivorans ATCC 17616]
 gi|189349478|ref|YP_001945106.1| chaperone protein DnaJ [Burkholderia multivorans ATCC 17616]
 gi|62899926|sp|Q5NSW9|DNAJ_BURM1 RecName: Full=Chaperone protein dnaJ
 gi|56798253|dbj|BAD82895.1| DnaJ [Burkholderia multivorans]
 gi|160343230|gb|ABX16316.1| chaperone protein DnaJ [Burkholderia multivorans ATCC 17616]
 gi|189333500|dbj|BAG42570.1| molecular chaperone [Burkholderia multivorans ATCC 17616]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 247/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N ++ +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA G          F++ F  IFG I G     +     
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGAQG-------FGGFADAFGDIFGDIFGQAAGGRGGRGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 TV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++FE+
Sbjct: 292 GRATFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEHQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGARHSPQSKSWFDRVKSFFE 376


>gi|332188384|ref|ZP_08390109.1| chaperone protein DnaJ [Sphingomonas sp. S17]
 gi|332011613|gb|EGI53693.1| chaperone protein DnaJ [Sphingomonas sp. S17]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 236/375 (62%), Gaps = 7/375 (1%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++L  +R A D  +K+ +R LAM+YHPD+N    E++ KF  ISEAY+ L+DPQKRA
Sbjct: 6   DYYELLECERTADDATIKSRYRKLAMQYHPDRNAGCKESEAKFKAISEAYDCLKDPQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH A + G    G      G      FS++FE +FG  MG              G
Sbjct: 66  AYDRYGHAAFQQGGMGGGG----HGGQDFGAFSDIFESVFGEFMGG--GRGGGRQQPRRG 119

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRY++EI+LEEAF GK+ +I    +  C TC G+GAKPGT+   C  C G G+V    
Sbjct: 120 ADLRYDMEITLEEAFHGKSTEITIDVSAACDTCDGTGAKPGTSAKTCQQCGGHGKVRAQ- 178

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF +ER C  C+G+GQII  PC  C G GRV + K L+VN+P GVD+GTRIRLSGEG 
Sbjct: 179 QGFFVVERTCPVCQGAGQIIADPCPDCRGDGRVEKTKTLAVNIPAGVDEGTRIRLSGEGE 238

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG  G   GDLYIF+ VK+H  F+R+G  L+   PIS  T A+GG+  +  LD     + 
Sbjct: 239 AGARGAPAGDLYIFLHVKRHAIFEREGTTLFARAPISFTTAALGGSLSIPGLDGRTHEIK 298

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           IP G Q+GKQ R +G GMPV+     GDL VQ++VETP KL+ RQRELLE F +  + D 
Sbjct: 299 IPAGIQSGKQLRQRGAGMPVLQGRGTGDLVVQIEVETPTKLSTRQRELLELFRETETGDE 358

Query: 365 NPQSTGFFARMKDFF 379
            P+S GFFA++K+ F
Sbjct: 359 CPESQGFFAKLKNVF 373


>gi|209520587|ref|ZP_03269342.1| chaperone protein DnaJ [Burkholderia sp. H160]
 gi|209498980|gb|EDZ99080.1| chaperone protein DnaJ [Burkholderia sp. H160]
          Length = 379

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 245/388 (63%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G           
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAGGAARGGG 113

Query: 121 GEA-----GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+
Sbjct: 114 RAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCS 173

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG V   +Q FFSI++ C  C GSG  IP PC+ CHG G+V E K L V +P G+DDG 
Sbjct: 174 GSGSV-RMSQGFFSIQQTCPKCHGSGTYIPEPCNHCHGAGKVKETKTLEVKIPAGIDDGM 232

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V T
Sbjct: 233 RIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGEIEVPT 292

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L A  +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++
Sbjct: 293 L-AGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEAQRDLLKQ 351

Query: 356 FEQISSQ---DNNPQSTGFFARMKDFFD 380
           FE+   +    ++PQS  +F R+K FFD
Sbjct: 352 FEKALVEGGARHSPQSKSWFDRVKSFFD 379


>gi|330447333|ref|ZP_08310982.1| chaperone protein DnaJ [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491524|dbj|GAA05479.1| chaperone protein DnaJ [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 379

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 251/388 (64%), Gaps = 13/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D Y+VLG+ R+A +R +K A++ LAMKYHPD+N+ D E+ EKF ++  AYE+L D 
Sbjct: 1   MSKRDLYEVLGVARDANERDIKKAYKRLAMKYHPDRNQGDEESAEKFKEVKYAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G      R    
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGG--GGGRRQQR 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G + +IR PT V C +C GSGAK G++   C  C+G+G+V
Sbjct: 114 AQRGSDLRYNMELTLEEAVRGCSKEIRVPTLVGCDSCDGSGAKKGSSATTCTTCHGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G GQII  PC KCHG+GRV E K LSV +P GVD G RIRL+
Sbjct: 174 -QMRQGFFAVQQTCPHCHGRGQIIKDPCDKCHGEGRVEETKTLSVKIPAGVDTGDRIRLT 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+RDG +L+C VP+S    A+GG  +V TLD   
Sbjct: 233 GEGEAGEFGAPAGDLYVQVHVKEHNIFQRDGNNLHCDVPVSFTMAALGGEVEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL  ++ VETP  L+ RQ+ELL+E E+  
Sbjct: 292 VNLKVPAETQTGRMFRMRGKGVTSVRGGMTGDLICRLVVETPVNLSSRQKELLQELEETF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSLKN 384
              ++  + P+S GFF  +K FFD L N
Sbjct: 352 GGKAASKHKPKSEGFFKGVKKFFDDLTN 379


>gi|107021829|ref|YP_620156.1| chaperone protein DnaJ [Burkholderia cenocepacia AU 1054]
 gi|116688776|ref|YP_834399.1| chaperone protein DnaJ [Burkholderia cenocepacia HI2424]
 gi|170732075|ref|YP_001764022.1| chaperone protein DnaJ [Burkholderia cenocepacia MC0-3]
 gi|206561608|ref|YP_002232373.1| chaperone protein DnaJ [Burkholderia cenocepacia J2315]
 gi|254246252|ref|ZP_04939573.1| DnaJ central region:Heat shock protein DnaJ [Burkholderia
           cenocepacia PC184]
 gi|123072390|sp|Q1BYX2|DNAJ_BURCA RecName: Full=Chaperone protein dnaJ
 gi|189083300|sp|A0K4S9|DNAJ_BURCH RecName: Full=Chaperone protein dnaJ
 gi|226735546|sp|B1JW20|DNAJ_BURCC RecName: Full=Chaperone protein dnaJ
 gi|226735547|sp|B4EDZ1|DNAJ_BURCJ RecName: Full=Chaperone protein dnaJ
 gi|105892018|gb|ABF75183.1| Chaperone DnaJ [Burkholderia cenocepacia AU 1054]
 gi|116646865|gb|ABK07506.1| chaperone protein DnaJ [Burkholderia cenocepacia HI2424]
 gi|124871028|gb|EAY62744.1| DnaJ central region:Heat shock protein DnaJ [Burkholderia
           cenocepacia PC184]
 gi|169815317|gb|ACA89900.1| chaperone protein DnaJ [Burkholderia cenocepacia MC0-3]
 gi|198037650|emb|CAR53593.1| putative DnaJ chaperone protein [Burkholderia cenocepacia J2315]
          Length = 378

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 243/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G      R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGAQGFGGFADAFGDIFGDIFGQAAGGAARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQGTV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPPGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+  
Sbjct: 296 ASFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEKSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 356 AEGGARHSPQSKSWFDRVKSFFE 378


>gi|114326685|ref|YP_743842.1| chaperone protein DnaJ [Granulibacter bethesdensis CGDNIH1]
 gi|114314859|gb|ABI60919.1| chaperone protein dnaJ [Granulibacter bethesdensis CGDNIH1]
          Length = 376

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 252/382 (65%), Gaps = 12/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y  LG+ R+A   +LK A+R LAM+YHPD+N  D EA+ KF ++SEAY+VL+D 
Sbjct: 3   MAKQDYYATLGVARDANADELKKAYRKLAMQYHPDRNPGDHEAEAKFKEVSEAYDVLKDE 62

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A E G    G G  G    G  D   +F+ +FG  MG      R    
Sbjct: 63  QKRAAYDRFGHAAFENGGGGGGGGFGGFQEGGLGD---IFDQMFGDFMG------RRGGA 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMD-CNICNGSGR 179
              G+DLR  +EI L EAF+G    +R PT V C +C G+G++      D C  C G+G+
Sbjct: 114 PRTGSDLRAAVEIDLVEAFNGTKATLRVPTRVTCESCHGTGSEDKNKSADTCPTCQGAGK 173

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF +ER C TC G+G++I +PC  C G G VS+E+ L +++P GV+DGTRIRL
Sbjct: 174 VRAQ-QGFFVVERTCPTCGGAGRVIRNPCRVCQGAGTVSQERTLQISIPAGVEDGTRIRL 232

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  G  PGDLY+ ++++ H  F+R+GA+++C VP+ +   A+G   +V  +D T
Sbjct: 233 SGEGEAGPNGTPPGDLYVHVAIRPHPIFQREGANIFCRVPLRMTQAALGAEIEVPVIDGT 292

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE-Q 358
            ++V IP GTQ+G+QFRL+GKG  V+ S  +GD+Y+QV VETPQ L+KRQ+ELLEEFE +
Sbjct: 293 SAKVKIPVGTQSGEQFRLRGKGFSVLRSPARGDMYIQVNVETPQHLSKRQQELLEEFERE 352

Query: 359 ISSQDNNPQSTGFFARMKDFFD 380
            S+   +P++ GFFA++K+FF+
Sbjct: 353 ASTTKASPEAEGFFAKVKEFFE 374


>gi|157962897|ref|YP_001502931.1| chaperone protein DnaJ [Shewanella pealeana ATCC 700345]
 gi|189083377|sp|A8H759|DNAJ_SHEPA RecName: Full=Chaperone protein dnaJ
 gi|157847897|gb|ABV88396.1| chaperone protein DnaJ [Shewanella pealeana ATCC 700345]
          Length = 376

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 249/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+ ++R++K A++ LAMK+HPD+N  D EA+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDTSEREIKKAYKRLAMKFHPDRNPGDKEAEANFKEVKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G++DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGY-------GGSADFGDVFGDVFGDIFGG--GRRGGQRQ 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C +C GSGAK G++P  C  C+G G+V
Sbjct: 112 AARGSDLRYNLELSLEEAVRGLTKELRIPTLAACDSCDGSGAKKGSSPTTCGTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+KCHG+GRV + K LSV +P GVD G RIRLS
Sbjct: 172 -QMRQGFFAVQQACPTCHGRGKIIKDPCNKCHGEGRVEKSKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG YG  PGDLY+ +SV++H  F+RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEYGAPPGDLYVQVSVREHAIFQRDGNNLYCEVPISFSKAALGGEIEVPTLDGK- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP  LN+RQ+ELL EFE   
Sbjct: 290 VNLKIPAETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEDTL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
              S+ ++P++ GFF  +K FF  L
Sbjct: 350 TGQSKKHSPKAEGFFDGVKKFFQDL 374


>gi|221200981|ref|ZP_03574021.1| chaperone protein DnaJ [Burkholderia multivorans CGD2M]
 gi|221206567|ref|ZP_03579580.1| chaperone protein DnaJ [Burkholderia multivorans CGD2]
 gi|221173876|gb|EEE06310.1| chaperone protein DnaJ [Burkholderia multivorans CGD2]
 gi|221178831|gb|EEE11238.1| chaperone protein DnaJ [Burkholderia multivorans CGD2M]
          Length = 376

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 246/385 (63%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N ++ +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA G          F++ F  IFG I G     +     
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGAQG-------FGGFADAFGDIFGDIFGQAAGGRGGRGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 SV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL   QR+LL++FE+
Sbjct: 292 GRATFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDHQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGARHSPQSKSWFDRVKSFFE 376


>gi|171362779|dbj|BAG15853.1| probable chaperone protein DnaJ [Pseudomonas putida]
          Length = 374

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 190/384 (49%), Positives = 248/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R A++  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVERGASESDLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA +DQ GH  ++      GA       +G ++FS++F  +F    G       S   
Sbjct: 61  SKRAAFDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG--GRGGSRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC+ CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIITDPCTSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ I+V++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGTHGGPTGDLYVVINVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P+++G+F  +K FF  L
Sbjct: 351 EGDSSHSPKASGWFDGVKRFFGDL 374


>gi|88801011|ref|ZP_01116561.1| dnaJ protein [Reinekea sp. MED297]
 gi|88776278|gb|EAR07503.1| dnaJ protein [Reinekea sp. MED297]
          Length = 374

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 250/383 (65%), Gaps = 10/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D Y+VLG+ + A ++++K A+R LAMKYHPD+N +D EA  KF ++SEAYE+L D 
Sbjct: 1   MSKRDLYEVLGVSKGADEKEIKKAYRRLAMKYHPDRNPDDKEASAKFQELSEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YDQ GH      A   G GGFG    G   FS++F  +FG I G G + +  SS 
Sbjct: 61  QKRQAYDQFGH------AGVDGQGGFGGAGAGAGSFSDIFGDVFGDIFGGGGAGRGRSSV 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DL+YNLE++LEEA  G    IR PT V C TC GSGAK GT+P  C+ C GSG+V
Sbjct: 115 -QRGSDLKYNLELTLEEAVRGIEKTIRVPTLVNCDTCDGSGAKKGTSPTTCSTCGGSGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G+G+II  PC  C+G+G   E K L+V VPPGVD G RIRLS
Sbjct: 174 -RMQQGFFAVQQTCPTCSGAGKIIKDPCGSCYGRGVKEETKTLNVKVPPGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I V+KH  F+RDGA+LYC VPISI   A+GG  +V TLD   
Sbjct: 233 GEGEAGRNGGPAGDLYVEIHVRKHAIFERDGANLYCEVPISIAEAALGGELEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF-EQI 359
            ++ IP  TQTGK FRL+GKG+  +     GDL  +V VETP  L  RQ+ELL+E  E +
Sbjct: 292 VKLKIPAETQTGKLFRLRGKGVKPVRGHSVGDLMCRVVVETPVNLTSRQKELLQELQESL 351

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
             + ++P+S G+F  +K FF  +
Sbjct: 352 EGKKHSPKSKGWFDGVKKFFGEM 374


>gi|295675594|ref|YP_003604118.1| chaperone protein DnaJ [Burkholderia sp. CCGE1002]
 gi|295435437|gb|ADG14607.1| chaperone protein DnaJ [Burkholderia sp. CCGE1002]
          Length = 379

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 245/388 (63%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G           
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAGAGARGGG 113

Query: 121 GEA-----GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+
Sbjct: 114 RAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCS 173

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG V   +Q FFSI++ C  C GSG  IP PC+ CHG G+V E K L V +P G+DDG 
Sbjct: 174 GSGAV-RMSQGFFSIQQTCPKCHGSGTYIPDPCNHCHGAGKVKETKTLEVKIPAGIDDGM 232

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V T
Sbjct: 233 RIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGDIEVPT 292

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L A  +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++
Sbjct: 293 L-AGRATFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEAQRDLLKQ 351

Query: 356 FEQISSQ---DNNPQSTGFFARMKDFFD 380
           FE+   +    ++PQS  +F R+K FFD
Sbjct: 352 FEKALVEGGARHSPQSKSWFDRVKSFFD 379


>gi|114777592|ref|ZP_01452573.1| heat shock protein dnaJ; chaperone with DnaK [Mariprofundus
           ferrooxydans PV-1]
 gi|114552063|gb|EAU54580.1| heat shock protein dnaJ; chaperone with DnaK [Mariprofundus
           ferrooxydans PV-1]
          Length = 384

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 245/386 (63%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   D+Y+VLG+ ++A +  +K A+R LAMK+HPD+N +D +A E F +++EAYEVL D 
Sbjct: 1   MTNRDYYEVLGVAKDADENTIKRAYRKLAMKFHPDRNPDDKKAAENFREVTEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGM---YGNSDFSELFEGIFGGIMGSGRSYKRS 117
            KRA YDQ GH  ++   Q    GG   G    +   DF +LF  +FG +   G   +R+
Sbjct: 61  AKRARYDQYGHAGVDDQMQDFWRGGSAGGFQDSHAFRDFGDLFGDVFGDVFNGGG--QRA 118

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           S     GADLRYNL +SLEEA +GK V++  P  V C TC GSGA+PGTNP+ C+ C G 
Sbjct: 119 SR----GADLRYNLSLSLEEAANGKEVELEIPKHVGCDTCHGSGARPGTNPVPCSTCGGH 174

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FF++ R C  C GSG  I  PC  C G GRV   K L V VP GV DG ++
Sbjct: 175 GQV-QMQQGFFAVRRTCPACHGSGTRIDSPCINCGGAGRVKTSKKLKVKVPAGVYDGAQV 233

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R++GEG AG  G APGDLYI IS+KKH  F+RDGADL+CT+P++    ++G   D  TLD
Sbjct: 234 RVTGEGEAGQQGTAPGDLYIVISLKKHSIFERDGADLHCTMPVTFPQASLGAEVDAPTLD 293

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVIN-SGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
               ++ IP GT+ G+ FRL+G G+P I  SG KGDLYV+VQ+  P+K++ RQ ELL +F
Sbjct: 294 G-RVKIKIPAGTEGGRVFRLRGHGVPDIRASGHKGDLYVRVQIAVPKKMSGRQEELLRQF 352

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
              +  +  P+ + F  ++KD +D L
Sbjct: 353 AAEAGDEIYPERSSFLGKVKDLWDEL 378


>gi|115350701|ref|YP_772540.1| chaperone protein DnaJ [Burkholderia ambifaria AMMD]
 gi|172059730|ref|YP_001807382.1| chaperone protein DnaJ [Burkholderia ambifaria MC40-6]
 gi|122323947|sp|Q0BI17|DNAJ_BURCM RecName: Full=Chaperone protein dnaJ
 gi|226735545|sp|B1YTK1|DNAJ_BURA4 RecName: Full=Chaperone protein dnaJ
 gi|115280689|gb|ABI86206.1| chaperone protein DnaJ [Burkholderia ambifaria AMMD]
 gi|171992247|gb|ACB63166.1| chaperone protein DnaJ [Burkholderia ambifaria MC40-6]
          Length = 378

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 242/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G      R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGGQGFGGFADAFGDIFGDIFGQAAGGAARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQGTV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPPGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+  
Sbjct: 296 ASFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEKSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 356 AEGGARHSPQSKSWFDRVKSFFE 378


>gi|307295666|ref|ZP_07575499.1| chaperone protein DnaJ [Sphingobium chlorophenolicum L-1]
 gi|306878322|gb|EFN09543.1| chaperone protein DnaJ [Sphingobium chlorophenolicum L-1]
          Length = 377

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 179/375 (47%), Positives = 245/375 (65%), Gaps = 5/375 (1%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++L ++R A    +K+A+R LAMKYHPD+N    +++ KF  +SEAY+ L+DPQKRA
Sbjct: 6   DYYELLEVERTADAAAIKSAYRKLAMKYHPDKNGGCTDSEAKFKAVSEAYDCLKDPQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH A + G    G G  GAG +  SD  ++FE IF     +G            G
Sbjct: 66  AYDRFGHAAFQNGGGGFGGGRGGAGGF--SDLGDIFETIF--GQAAGGFGGGGRQAQRRG 121

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRY++EI+L++A+ GK  +I+   +  C +C GSGA+PGT    C  C+G G+V    
Sbjct: 122 ADLRYDMEITLDDAYHGKKTEIQIEVSAACESCDGSGAQPGTGVKSCGTCHGHGQVRAQ- 180

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF +ER C +C G+GQ+I  PC  C G+GRV + K+LSVN+P GVD+GTRIRLSGEG 
Sbjct: 181 QGFFVVERTCPSCHGAGQVIESPCRSCRGEGRVDKPKILSVNIPAGVDEGTRIRLSGEGE 240

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG  G   GDLYIF+ VK+H  F+RDG  L+   P+SI T A+GG  +V  LD     + 
Sbjct: 241 AGARGAPAGDLYIFLHVKRHAIFERDGTTLFARAPVSITTAALGGVIEVPGLDGQRHEIK 300

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           IP G Q+GKQ R +G GMPV+N   +GDL +QV VETP KL+ +QRELLE F +  + + 
Sbjct: 301 IPSGIQSGKQIRQRGAGMPVLNGRGQGDLVIQVDVETPTKLSAKQRELLEAFRETETGEE 360

Query: 365 NPQSTGFFARMKDFF 379
            PQSTGFF+++K+ +
Sbjct: 361 CPQSTGFFSKLKELW 375


>gi|332527895|ref|ZP_08403932.1| chaperone protein DnaJ [Rubrivivax benzoatilyticus JA2]
 gi|332112472|gb|EGJ12265.1| chaperone protein DnaJ [Rubrivivax benzoatilyticus JA2]
          Length = 379

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 246/385 (63%), Gaps = 13/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND--PEAKEKFAQISEAYEVLR 58
           M K D+Y++LG+ +NA+D  +K A+R LAMKYHPD+N+ D   +A+EKF ++ EAYE+L 
Sbjct: 1   MAKRDYYEILGVAKNASDDDIKKAYRKLAMKYHPDRNQGDEAKKAEEKFKEVKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++        GG GAG  G   F+E F  IFG I G     +R  
Sbjct: 61  DAQKRAAYDQYGHAGVD-----PNMGGRGAGPEGFGGFAEAFGDIFGDIFGGAAGGRRGG 115

Query: 119 STG-EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 G+DL Y +EI+LEEA +GK  QIR P+   C TC GSGAKPGT+P  C  C+GS
Sbjct: 116 GQQVYRGSDLSYAMEITLEEAAAGKETQIRIPSWEGCDTCHGSGAKPGTSPKTCPTCSGS 175

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V+   Q FFSI++ C  C GSG+IIP PC  C G G++  +K L V +P G+++G RI
Sbjct: 176 GTVHLR-QGFFSIQQTCPHCHGSGKIIPEPCPTCGGAGKIKRQKTLEVKIPAGINEGMRI 234

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R +G G  G  GG PGDLYI I +K H+ F+RDG DL+CTVP+ + T A+GGT +V TL 
Sbjct: 235 RSAGNGEPGTNGGPPGDLYIEIRIKPHEIFERDGDDLHCTVPVGMTTAALGGTIEVPTL- 293

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
            + + + +PEGTQ GK FRL+GKG+  I S   GDLY  + VETP KL + QR+LL E +
Sbjct: 294 GSKAEIELPEGTQHGKTFRLRGKGIKGIRSSYPGDLYAHITVETPVKLTEHQRKLLRELD 353

Query: 358 QI---SSQDNNPQSTGFFARMKDFF 379
           +        ++P +  +  R+KD F
Sbjct: 354 ESFRKGGDRHSPNAKSWTDRVKDLF 378


>gi|254468702|ref|ZP_05082108.1| chaperone protein DnaJ [beta proteobacterium KB13]
 gi|207087512|gb|EDZ64795.1| chaperone protein DnaJ [beta proteobacterium KB13]
          Length = 377

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 249/381 (65%), Gaps = 10/381 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y++LG++R+A+  ++K AF+ LAMK+HPD+N ++P+A+E F ++ EAYE+L DPQK
Sbjct: 4   KRDYYEILGLNRDASGDEIKKAFKKLAMKFHPDRNPDNPKAEESFKEVKEAYEILSDPQK 63

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           ++ YDQ GH  ++                G SDF + F  IFG I G GRS    S+   
Sbjct: 64  KSAYDQFGHAGVDQSMGGGQG----GFQGGFSDFGDAFGDIFGDIFGGGRSGSGKSNV-Y 118

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYNLEI+LEEA  G   +IR P   +C TCSGSGAK GT P  C  C G G+V  
Sbjct: 119 RGADLRYNLEITLEEAAQGTEKKIRIPVLSQCKTCSGSGAKKGTQPSTCGTCGGHGQV-R 177

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
             Q FFS+++ C  C+GSG++I  PC+ C G GRV E K LSV +P GVD+G RIRLS E
Sbjct: 178 MQQGFFSVQQTCPKCQGSGKVINDPCNDCSGSGRVKESKTLSVKIPAGVDEGDRIRLSNE 237

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AGV GG  GDLY+ + +KKH  F+RDGADL+C +PIS    A+GG  ++ TL   +++
Sbjct: 238 GEAGVNGGPSGDLYVVVGLKKHAIFERDGADLHCELPISFSVAALGGDVEIPTL-GGNAK 296

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           + IP+ TQTG  FRLKGKG+  +     GDL   V VETP KL +RQ+E+L E E ++  
Sbjct: 297 MKIPQETQTGATFRLKGKGVKPVRENYTGDLLCHVVVETPVKLTERQKEILRELEDLNQA 356

Query: 363 D---NNPQSTGFFARMKDFFD 380
           D   ++P+S  +  +++DFFD
Sbjct: 357 DSGKHSPRSKSWVDKVRDFFD 377


>gi|254488057|ref|ZP_05101262.1| chaperone protein DnaJ [Roseobacter sp. GAI101]
 gi|214044926|gb|EEB85564.1| chaperone protein DnaJ [Roseobacter sp. GAI101]
          Length = 384

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 180/385 (46%), Positives = 255/385 (66%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LGI + A+  ++K  +R+ A + HPD+N ++P A+ +F + +EAYEVL+ P
Sbjct: 1   MAKRDYYEILGIAKGASADEIKKGYRTKAKELHPDRNSDNPNAEAQFKEANEAYEVLKSP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGS--GRSYKRSS 118
            K+A YD+ GH A E G    G    G    G  DFS  F  +F  + G   G       
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGQRPGGGFGGGQGDFSSAFSDVFDDLFGDFMGNQRGGGG 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYNL I+LE+AF G    I  PT++ C +C+GSGA+ G  P  C  C+G G
Sbjct: 121 RRAARGADLRYNLGITLEDAFKGMQKSINVPTSIACDSCNGSGAEGGAEPTSCPTCSGMG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQI+ +PC  C G GRV +++ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-QGFFTVERTCPTCSGMGQIVKNPCKSCRGAGRVEKDRTLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V+ H+ F+RDG++L+C VP+S+ T A+GG+ +V T+D 
Sbjct: 240 LAGEGEAGMRGGPSGDLYIFIEVQDHELFERDGSNLFCRVPVSMSTAALGGSIEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IP G+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL+EFE+
Sbjct: 300 GRGRVQIPSGSQSGRQMRLRGKGMPPLRGGGTGDMIIELAVETPVNLTSRQKELLQEFEK 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
             S++NNP+S+ FF+ ++ F+DS+K
Sbjct: 360 -ESENNNPESSSFFSSVRSFWDSMK 383


>gi|78065314|ref|YP_368083.1| heat shock protein DnaJ [Burkholderia sp. 383]
 gi|123569264|sp|Q39JC7|DNAJ_BURS3 RecName: Full=Chaperone protein dnaJ
 gi|77966059|gb|ABB07439.1| Heat shock protein DnaJ [Burkholderia sp. 383]
          Length = 378

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 242/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA D ++K A+R LAMKYHPD+N ++ +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNAGDDEIKKAYRKLAMKYHPDRNPDNKDAEEHFKEVKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G      R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGAQGFGGFADAFGDIFGDIFGQAAGGAARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQGTV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR +
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPPGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL   QR+LL++FE+  
Sbjct: 296 ASFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDNQRDLLKQFEKSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 356 AEGGARHSPQSKSWFDRVKSFFE 378


>gi|221214424|ref|ZP_03587395.1| chaperone protein DnaJ [Burkholderia multivorans CGD1]
 gi|221165681|gb|EED98156.1| chaperone protein DnaJ [Burkholderia multivorans CGD1]
          Length = 376

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 246/385 (63%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N ++ +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA G          F++ F  IFG + G     +     
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGAQG-------FGGFADAFGDIFGDVFGQAAGGRGGRGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 SV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL   QR+LL++FE+
Sbjct: 292 GRATFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDHQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGARHSPQSKSWFDRVKSFFE 376


>gi|254253166|ref|ZP_04946484.1| DnaJ-class molecular chaperone [Burkholderia dolosa AUO158]
 gi|124895775|gb|EAY69655.1| DnaJ-class molecular chaperone [Burkholderia dolosa AUO158]
          Length = 376

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 247/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N ++ +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKDAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA G          F++ F  IFG I G     +     
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGAQG-------FGGFADAFGDIFGDIFGQAAGGRGGRGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 TV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +   +PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL ++QR+LL++FE+
Sbjct: 292 GRASFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEQQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGARHSPQSKSWFDRVKSFFE 376


>gi|290474767|ref|YP_003467647.1| heat shock protein (Hsp40), co-chaperone with DnaK [Xenorhabdus
           bovienii SS-2004]
 gi|289174080|emb|CBJ80867.1| heat shock protein (Hsp40), co-chaperone with DnaK [Xenorhabdus
           bovienii SS-2004]
          Length = 378

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 192/386 (49%), Positives = 253/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLGI +   ++++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEVLGISKTTEEKEIKKAYKRLAMKYHPDRNQGDKEAESKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    GA     G  G +DFS++F  +FG I G GR  +RSS  
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGA----GGFGGGADFSDVFGDVFGDIFGGGRRQQRSSR- 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT   C TC GSGAK GTNP  C+ C+G+G+V
Sbjct: 116 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLESCDTCHGSGAKAGTNPETCSTCHGAGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++ C  C G G++I   C KCHG GRV + K LSV +P GVD G RIRL 
Sbjct: 173 HMR-QGFFTVQQPCPQCHGRGKVIKETCGKCHGHGRVEKYKTLSVKIPAGVDTGDRIRLG 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+RDG++LYC VPI+  T A+GG  +V TLD   
Sbjct: 232 GEGEAGEHGAPAGDLYVQVQVKAHHIFERDGSNLYCEVPINFATAALGGEIEVPTLDGRV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTGK FR+KGKG+  +  G +GDL  +V VETP KLN  Q++LL +  +  
Sbjct: 292 S-LKIPAETQTGKLFRMKGKGVKSVRGGAQGDLLCRVVVETPVKLNDEQKDLLRKLGESL 350

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              S + N+P+S  F   +K FFD L
Sbjct: 351 GGKSGETNSPRSKSFIDGVKKFFDDL 376


>gi|254511075|ref|ZP_05123142.1| chaperone protein DnaJ [Rhodobacteraceae bacterium KLH11]
 gi|221534786|gb|EEE37774.1| chaperone protein DnaJ [Rhodobacteraceae bacterium KLH11]
          Length = 383

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 257/385 (66%), Gaps = 5/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A+  ++K  FRS A + HPD+N+++P+A+ +F + +EAY+VLRD 
Sbjct: 1   MSKRDYYEVLGVSKGASADEIKKGFRSKAKQLHPDRNKDNPDAEAQFKEANEAYDVLRDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGN--SDFSELFEGIFGGIMGSGRSYKRSS 118
           +K+A YD+ GH A E G    G    G    G+  S FS++F+ +FG  MG  R      
Sbjct: 61  EKKAAYDRFGHAAFENGMGGGGGRPGGGFGQGDFSSAFSDVFDDLFGDFMGGQRGGGGGR 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                 +DLRYNL +SLEEA++G    I  PTAV CS C G+GA+ G  P  C  C+G G
Sbjct: 121 RAARG-SDLRYNLRVSLEEAYAGLQKTINVPTAVACSACDGTGAEGGVEPTTCPTCSGMG 179

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF++ER C TC G GQII +PC  C G GRV +++ LSVN+P GV+ GTRIR
Sbjct: 180 KVRAQ-QGFFTVERTCPTCSGLGQIIKNPCKSCGGAGRVEKDRALSVNIPAGVETGTRIR 238

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG PGDLYIF+ V +H+ F+RD  +LYC VP+S+   A+GG+ +V T+D 
Sbjct: 239 LAGEGEAGMRGGPPGDLYIFVEVSEHKLFERDSVNLYCRVPVSMAKAALGGSIEVPTIDG 298

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              RV IP G+Q+G+Q RL+GKGMP +  G  GD+++++ VETP  L  RQ+ELL EF+ 
Sbjct: 299 GRGRVQIPSGSQSGRQMRLRGKGMPALRGGGIGDMFIELAVETPVNLTSRQKELLREFDD 358

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           +  +DN+P+S  FF+ +K F+D +K
Sbjct: 359 L-GEDNHPESKSFFSSVKSFWDGMK 382


>gi|3122016|sp|Q52702|DNAJ_RHOCA RecName: Full=Chaperone protein dnaJ
 gi|1373329|gb|AAC45474.1| DnaJ protein [Rhodobacter capsulatus]
          Length = 384

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 172/385 (44%), Positives = 251/385 (65%), Gaps = 4/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ + A+  ++K A+RS A + HPD+N+    A+ +F +++ AY+VL+D 
Sbjct: 1   MAKVDFYEVLGVSKGASAEEIKKAYRSKAKELHPDRNQGQSAAEAQFKEVNGAYDVLKDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSSS 119
            K+A YD+ GH A E G    G  G        +S FS++FE +FG  MG          
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGPRGPYGQGADFSSAFSDVFEDLFGDFMGGRGGPGGGGR 120

Query: 120 TGEAG-ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                 +DLRYN+ ++LEEAF G    I  P +  C +C+G+GA+ G  P  C  C+G G
Sbjct: 121 RVRRRGSDLRYNMRVTLEEAFKGAQKTITVPGSAACGSCNGTGAEGGAEPQTCPTCSGLG 180

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V      FF++ER C TC G GQ++ +PC  CHG GR+ +E+ LSVN+P GV+ GTRIR
Sbjct: 181 KVRAQ-NGFFTVERTCPTCGGQGQVVKNPCRVCHGSGRIEKERTLSVNIPAGVETGTRIR 239

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AG+ GG  GDLYIFI V++H  F+RDG +L+C VP+S+V+ A+GG  +V T+D 
Sbjct: 240 LAGEGEAGMRGGPSGDLYIFIEVREHAIFQRDGVNLFCRVPVSMVSAALGGEVEVPTIDG 299

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             S+V +P G+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL+EF++
Sbjct: 300 GRSKVKVPVGSQSGRQMRLRGKGMPALRGGGIGDMVIELAVETPVNLTARQKELLDEFQR 359

Query: 359 ISSQDNNPQSTGFFARMKDFFDSLK 383
           I ++ NNP+   FF ++K F+D +K
Sbjct: 360 IQAE-NNPEGASFFQKVKSFWDGMK 383


>gi|66047421|ref|YP_237262.1| chaperone protein DnaJ [Pseudomonas syringae pv. syringae B728a]
 gi|289676010|ref|ZP_06496900.1| chaperone protein DnaJ [Pseudomonas syringae pv. syringae FF5]
 gi|302185418|ref|ZP_07262091.1| chaperone protein DnaJ [Pseudomonas syringae pv. syringae 642]
 gi|81307933|sp|Q4ZNP8|DNAJ_PSEU2 RecName: Full=Chaperone protein dnaJ
 gi|63258128|gb|AAY39224.1| DnaJ central region:Heat shock protein DnaJ, N-terminal:Chaperone
           DnaJ, C-terminal [Pseudomonas syringae pv. syringae
           B728a]
 gi|330969637|gb|EGH69703.1| chaperone protein DnaJ [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330981075|gb|EGH79178.1| chaperone protein DnaJ [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 380

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 250/385 (64%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR+       
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRAGGGGGRG 117

Query: 121 GEAG-ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           G    +DLRY LE++LEEA  G  V IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTNVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 356 LENDESHSPKASGWFEGVKRFFGDL 380


>gi|254456678|ref|ZP_05070107.1| chaperone protein DnaJ [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083680|gb|EDZ61106.1| chaperone protein DnaJ [Candidatus Pelagibacter sp. HTCC7211]
          Length = 376

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 257/379 (67%), Gaps = 5/379 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY VLG+ ++A+  +LK+A+R LA+KYHPD+N  D  A++KF + SEAY +L D 
Sbjct: 1   MAKRDFYDVLGVSKSASPDELKSAYRKLAVKYHPDKNPGDKNAEDKFKEASEAYGILSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+  YD  GH A E G   Q  G    G +  +DFS++FE  FG   G GRS + + ++
Sbjct: 61  EKKQNYDNFGHAAFEGGGGRQSGG---FGGFSGADFSDIFEDFFGDFGGGGRS-RGNRNS 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY+L ISLEEA+ GK   I+F T  KC+TC+G+G+KPG +P  C+ C G+G++
Sbjct: 117 NNRGSDLRYDLSISLEEAYQGKKQDIKFSTTEKCNTCNGNGSKPGHSPDRCSYCGGNGKI 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
            +  Q FF++++ C  C G+G+ I +PC+ C+GQG+    K +SV +P GVDDGTRIRL+
Sbjct: 177 RSN-QGFFTVQQTCPQCNGNGEEITNPCNDCNGQGKKQASKKISVTIPKGVDDGTRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  GGA GDLY+FI+V  H+ FKR   +L+   PISI   A+G   ++ T+D   
Sbjct: 236 GKGEAGTRGGATGDLYLFINVNSHELFKRSDENLFFEFPISIADAALGTVIEIPTIDGGK 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP+GTQ+GKQFRLKGKGMP +  G  GDLYVQV  E P  LNK+Q+ELLE+F +I 
Sbjct: 296 AKLKIPDGTQSGKQFRLKGKGMPFMRRGDFGDLYVQVNTEVPIYLNKQQKELLEKFREIE 355

Query: 361 SQDNNPQSTGFFARMKDFF 379
           ++ +NP    FF + K F+
Sbjct: 356 NEKSNPSIKKFFQKAKSFW 374


>gi|323524822|ref|YP_004226975.1| chaperone protein DnaJ [Burkholderia sp. CCGE1001]
 gi|323381824|gb|ADX53915.1| chaperone protein DnaJ [Burkholderia sp. CCGE1001]
          Length = 379

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 244/388 (62%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G           
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAGGAARGGG 113

Query: 121 GEA-----GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+
Sbjct: 114 RAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCS 173

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG 
Sbjct: 174 GSGAV-RMSQGFFSIQQTCPKCHGTGTYIPEPCGHCHGAGKVKETKTLEVKIPAGIDDGM 232

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V T
Sbjct: 233 RIRSAGNGEPGINGGPSGDLYVEIHIKQHAVFERDGDDLHCQMPIPFTTAALGGEIEVPT 292

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L A  +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++
Sbjct: 293 L-AGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTESQRDLLKQ 351

Query: 356 FEQISSQ---DNNPQSTGFFARMKDFFD 380
           FE+   +    ++PQS  +F R+K FFD
Sbjct: 352 FEKALVEGGARHSPQSKSWFDRVKSFFD 379


>gi|296284103|ref|ZP_06862101.1| chaperone protein DnaJ [Citromicrobium bathyomarinum JL354]
          Length = 371

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/380 (47%), Positives = 236/380 (62%), Gaps = 17/380 (4%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           + D Y++LG+ R+A    +K A+R +AM+YHPD+N  D EA+ +F  I  AYEVL+DPQK
Sbjct: 4   EPDLYELLGVSRDADAAAIKAAYRKMAMQYHPDRNPGDAEAEARFKAIGAAYEVLKDPQK 63

Query: 63  RALYDQGGHEALEYGAQSQGA---GGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
           RA YDQ GH A + G           FG       D  ++FE IFG   G  R   R   
Sbjct: 64  RAAYDQYGHAAFQQGGGGGRGGHQADFG-------DIGDIFETIFGSAFGGMRQGARR-- 114

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               GADLRY+LEI+LEEAF GK+  I    + +C  C+GSGA+PGT    CN+C G G+
Sbjct: 115 ----GADLRYDLEITLEEAFHGKSTTIEIEVSQQCEVCTGSGAEPGTGTRACNMCAGYGK 170

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q  F +ER C  C G G++I  PC  C G GRV   + LSV++PPGVD GTRIRL
Sbjct: 171 VRAQ-QGLFVVERPCPNCHGRGEVIETPCRNCRGDGRVDAPQSLSVDIPPGVDTGTRIRL 229

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SG+G AG  G  PGDLYIFI ++ H  F RDG++L   VPIS  T A+GG  ++  LD +
Sbjct: 230 SGKGEAGPRGAPPGDLYIFIHIRAHSVFARDGSNLIARVPISFTTAALGGKVEIPDLDGS 289

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            + + IP G Q+GKQ R +G GMPV+    +GDL  ++ VETP KL KRQRE+LEEF + 
Sbjct: 290 TNTIEIPAGIQSGKQLRRRGAGMPVLQGRGRGDLVAEITVETPTKLTKRQREILEEFSET 349

Query: 360 SSQDNNPQSTGFFARMKDFF 379
            + +  P+S GFF R+KD F
Sbjct: 350 ETGEECPESRGFFDRIKDAF 369


>gi|312963097|ref|ZP_07777582.1| Chaperone protein [Pseudomonas fluorescens WH6]
 gi|311282608|gb|EFQ61204.1| Chaperone protein [Pseudomonas fluorescens WH6]
          Length = 374

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 246/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +  E++E F + +EAYE L DP
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDSKESEEMFKEANEAYECLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      GA       +G  +FS++F  +F    G           
Sbjct: 61  NKRAAYDQYGHAGVDPSMGGGGA------GFGGQNFSDIFGDVFSDFFGG--GRGGQRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G +V IR PT V C  C GSGAK G++P+ C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTSVNIRVPTLVNCKPCDGSGAKKGSSPITCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E + LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIISDPCDACHGEGRVEEYRTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS V  A+GG  ++ TLD   
Sbjct: 232 GEGEAGTQGGPTGDLYVVINVREHSIFQRDGKHLFCEVPISFVDAALGGELEIPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFR++GKG+  +  G  GDL  +V VETP  LN+RQRELLEEF    
Sbjct: 291 VKLKIPEGTQTGKQFRIRGKGVAPVRGGGAGDLMCRVAVETPVNLNRRQRELLEEFRSSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P++TGFF  +K FF  L
Sbjct: 351 EGDESHSPKTTGFFDGVKRFFGDL 374


>gi|170691348|ref|ZP_02882513.1| chaperone protein DnaJ [Burkholderia graminis C4D1M]
 gi|170143553|gb|EDT11716.1| chaperone protein DnaJ [Burkholderia graminis C4D1M]
          Length = 379

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 244/388 (62%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+E F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G           
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAGGAARGGG 113

Query: 121 GEA-----GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+
Sbjct: 114 RAGPQVYRGADLRYSMEITLEQAAHGYETQIRVPSWVSCEVCHGSGAKPGTKPETCPTCS 173

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG 
Sbjct: 174 GSGAV-RMSQGFFSIQQTCPKCHGTGTYIPEPCGHCHGAGKVKETKTLEVKIPAGIDDGM 232

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V T
Sbjct: 233 RIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGEIEVPT 292

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L A  +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++
Sbjct: 293 L-AGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIPGDLYVHVQVETPVKLTEPQRDLLKQ 351

Query: 356 FEQISSQ---DNNPQSTGFFARMKDFFD 380
           FE+   +    ++PQS  +F R+K FFD
Sbjct: 352 FEKALVEGGARHSPQSKSWFDRVKSFFD 379


>gi|94496877|ref|ZP_01303451.1| Chaperone DnaJ [Sphingomonas sp. SKA58]
 gi|94423553|gb|EAT08580.1| Chaperone DnaJ [Sphingomonas sp. SKA58]
          Length = 378

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 181/379 (47%), Positives = 238/379 (62%), Gaps = 3/379 (0%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M + D+Y +L ++R A    +K+A+R LAMKYHPD+     +++ KF  +SEAYE L+DP
Sbjct: 1   MTETDYYSLLEVERTADGATIKSAYRKLAMKYHPDRTGGCTDSEAKFKAVSEAYECLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH A        G GGF     G SD  ++FE IF                
Sbjct: 61  QKRAAYDRYGHAAYTNAQNGGGGGGFRGQAGGFSDLGDIFETIF--GQAGFGGAGGGRQQ 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EISL+EA+ GK   I+   +  C TC GSGA+PGT    C  C+G G+V
Sbjct: 119 QRRGADLRYDMEISLDEAYHGKQTDIQIEVSAACETCDGSGAQPGTGVKTCATCHGHGQV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +ER C +C G+GQ+I  PC  C G+GRV + K LSV++P GVD+GTRIRLS
Sbjct: 179 -RAQQGFFVVERTCPSCHGAGQVIESPCRSCRGEGRVDKPKSLSVSIPAGVDEGTRIRLS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLYIF+ VK+H  F+RDG  L+C  P+S  T A+GGT +V  LD + 
Sbjct: 238 GEGEAGARGAPAGDLYIFLHVKRHAIFERDGTTLFCRAPVSFTTAALGGTIEVPGLDGSR 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + IP G Q+GKQ R +G GMPV+N    GDL +QV VETP KL  +QRELLE F +  
Sbjct: 298 HEIKIPVGIQSGKQIRQRGAGMPVLNGRGLGDLVIQVDVETPTKLTAKQRELLEAFRETE 357

Query: 361 SQDNNPQSTGFFARMKDFF 379
           + +  PQSTGFF+++K+ +
Sbjct: 358 TGEECPQSTGFFSKLKEMW 376


>gi|170719892|ref|YP_001747580.1| chaperone protein DnaJ [Pseudomonas putida W619]
 gi|226735590|sp|B1J255|DNAJ_PSEPW RecName: Full=Chaperone protein dnaJ
 gi|169757895|gb|ACA71211.1| chaperone protein DnaJ [Pseudomonas putida W619]
          Length = 374

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 244/384 (63%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R A++  LK A+R LAMKYHPD+N  D E+++KF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVERGASEADLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA +DQ GH  ++      GA       +G ++FS++F  +F    G           
Sbjct: 61  SKRAAFDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG--GRGGGRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G+ P  C  C G G+V
Sbjct: 113 AARGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIITDPCGSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ I+V++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGTHGGPTGDLYVVINVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P++ G+F  +K FF  L
Sbjct: 351 EGDSSHSPKANGWFDGVKRFFGDL 374


>gi|330815620|ref|YP_004359325.1| chaperone protein DnaJ [Burkholderia gladioli BSR3]
 gi|327368013|gb|AEA59369.1| chaperone protein DnaJ [Burkholderia gladioli BSR3]
          Length = 378

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 243/383 (63%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E+F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEERFKEAKEAYEMLSDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G G    R    
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGAQGFGGFADAFGDIFGDIFGQAAGGGARGGRGGPQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 VYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPDTCPTCHGQGTV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR S
Sbjct: 178 -RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRIRSS 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 237 GNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQ+ETP KL   QR+LL +FEQ  
Sbjct: 296 ASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQIETPVKLTDGQRDLLRQFEQSL 355

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 356 AEGGGRHSPQSKSWFDRVKSFFE 378


>gi|153869426|ref|ZP_01999025.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Beggiatoa sp. PS]
 gi|152074076|gb|EDN70973.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Beggiatoa sp. PS]
          Length = 374

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 247/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQVLG+ +NA++ +LK A+R LAMKYHPD+N +D +A+E F +I EAYEVL DP
Sbjct: 1   MSKRDYYQVLGVQKNASEDELKKAYRRLAMKYHPDRNPDDKQAEEHFKEIKEAYEVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      G      G     D  E   G      G  R+++     
Sbjct: 61  QKRAAYDQFGHAGIDAAMGGGGG--GFGGFGDIGDIFESVFGGGFRGSGGNRAFR----- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY+L +SLEE  +G  V+IR PT V CSTC GSGAK GT+P  C  C G G++
Sbjct: 114 ---GSDLRYDLSLSLEEVVAGTEVKIRVPTQVVCSTCEGSGAKAGTSPTTCRRCGGQGQI 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T Q FFS+++ C +CRG+G+II  PC  CHG GRV E K LSV +P GVD G RIRLS
Sbjct: 171 RIT-QGFFSVQQTCPSCRGTGKIISEPCVGCHGTGRVQEHKTLSVKIPSGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG+ GG PGDLY+ I+V+ H  F R+  +LYC VPISIVT A+GG  +  TLD   
Sbjct: 230 GEGEAGMNGGPPGDLYVQINVRPHPIFVREDNNLYCEVPISIVTAALGGELEAPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTGK FR++GKG+  +  G  GDL+ +V VETP  L  RQ+ELL+EFE   
Sbjct: 289 VVLKIPPETQTGKVFRIRGKGVKPVRGGPSGDLHCRVVVETPVNLTPRQKELLKEFESSM 348

Query: 360 -SSQDNNPQSTGFFARMKDFFDSLK 383
             S+ ++P+ + +   +K FF+ +K
Sbjct: 349 HGSKRHSPKQSSWLDGVKKFFEDMK 373


>gi|109898305|ref|YP_661560.1| chaperone protein DnaJ [Pseudoalteromonas atlantica T6c]
 gi|123064634|sp|Q15UD2|DNAJ_PSEA6 RecName: Full=Chaperone protein dnaJ
 gi|109700586|gb|ABG40506.1| chaperone protein DnaJ [Pseudoalteromonas atlantica T6c]
          Length = 379

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 189/389 (48%), Positives = 249/389 (64%), Gaps = 15/389 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++++A++R +K A++ LAMKYHPD+ + D   +EKF ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVEKSASERDIKKAYKRLAMKYHPDRTQGDKAMEEKFKEVQEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++             G +G  DF ++F  +FG I G GR   R S  
Sbjct: 61  QKRAAYDQYGHAGVDPNRGH-------GGGHGAGDFGDIFGDVFGDIFGGGRGGGRQSRA 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  GK+V+IR PT  +C TC GSGAK G++   C  C+G G+V
Sbjct: 114 AR-GSDLRYNLELSLEEAVRGKSVEIRVPTLAECDTCDGSGAKKGSSAKTCTTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC  CHGQGRV + K LSV VP GVD G RIRLS
Sbjct: 173 -QMRQGFFAVQQACPTCGGKGKIITDPCDVCHGQGRVEKTKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ + VK+H+ F+RDG +LYC VP+S    A+GG  +V TL+   
Sbjct: 232 NEGEAGENGAPAGDLYVQVHVKQHKIFERDGNNLYCEVPLSFTRAAIGGEIEVPTLEGKV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
                PE TQTGK FRL+ KG+  + SG  GDL  +V +ETP  LN RQ+ELL+E E+  
Sbjct: 292 KLKVTPE-TQTGKMFRLRNKGVKSVRSGSVGDLICKVVIETPVNLNSRQKELLQELEESM 350

Query: 360 ----SSQDNNPQSTGFFARMKDFFDSLKN 384
                +  N P+ +GFF  +K FFD L N
Sbjct: 351 GKGKETAKNRPKESGFFDGVKKFFDDLTN 379


>gi|219682083|ref|YP_002468467.1| DnaJ protein [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|254777943|sp|B8D757|DNAJ_BUCAT RecName: Full=Chaperone protein dnaJ
 gi|219621816|gb|ACL29972.1| DnaJ protein [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
          Length = 377

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 249/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQ+LGI ++A +R++K A++ LAMKYHPD+N+ D  A+ KF +I EAYE+L + 
Sbjct: 1   MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGDKTAEGKFKEIKEAYEILINE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YDQ GH A E G  +     F      ++DFS++F  +FG I G  R+ +     
Sbjct: 61  EKRSAYDQYGHAAFENGQSNSTYSTFT----NSADFSDIFGDVFGDIFGGNRTQR----- 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL YN+EI+LEEA  G   +I+ PT  KC TC GSG + GT P  C+ C+G G++
Sbjct: 112 AKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGTKPRSCSTCHGKGQI 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   + FF+++++C TC G G II  PC+ CHGQGRV   K+LSV +PPG+D   RIRL+
Sbjct: 172 HIR-KGFFTVQQSCPTCHGKGTIIADPCNLCHGQGRVETYKILSVKIPPGLDTNDRIRLN 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ I+VKKH  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 NEGEAGANGAQSGDLYVQITVKKHPIFEREGNNLYCEVPINFTMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQ+GK FR++G+G+  + +  +GDL  +V VETP  LN++Q+ LL E    F
Sbjct: 290 VKLKIPYETQSGKLFRIRGRGVKSVQNRNQGDLLCRVVVETPVNLNEQQKNLLHELGNSF 349

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                + N+P+S  FF  +K FFD L
Sbjct: 350 HGFRGEKNSPRSKRFFDGVKRFFDDL 375


>gi|311087048|gb|ADP67128.1| chaperone protein DnaJ [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 377

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 249/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQ+LGI ++A +R++K A++ LAMKYHPD+N+ D  A+ KF +I EAYE+L + 
Sbjct: 1   MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGDETAEGKFKEIKEAYEILINE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YDQ GH A E G  +     F      ++DFS++F  +FG I G  R+ +     
Sbjct: 61  EKRSAYDQYGHAAFENGQSNSTYSTFT----NSADFSDIFGDVFGDIFGGNRTQR----- 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL YN+EI+LEEA  G   +I+ PT  KC TC GSG + GT P  C+ C+G G++
Sbjct: 112 AKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGTKPRSCSTCHGKGQI 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   + FF+++++C TC G G II  PC+ CHGQGRV   K+LSV +PPG+D   RIRL+
Sbjct: 172 HI-RKGFFTVQQSCPTCHGKGTIITDPCNLCHGQGRVETYKILSVKIPPGLDTNDRIRLN 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ I+VKKH  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 NEGEAGANGAQSGDLYVQITVKKHPIFEREGNNLYCEVPINFTMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQ+GK FR++G+G+  + +  +GDL  +V VETP  LN++Q+ LL E    F
Sbjct: 290 VKLKIPYETQSGKLFRIRGRGVKSVQNRNQGDLLCRVVVETPVNLNEQQKNLLHELGNSF 349

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                + N+P+S  FF  +K FFD L
Sbjct: 350 HGFRGEKNSPRSKRFFDGVKRFFDDL 375


>gi|15616772|ref|NP_239984.1| DnaJ protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
 gi|219681527|ref|YP_002467912.1| DnaJ protein [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|257471208|ref|ZP_05635207.1| DnaJ protein [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)]
 gi|11182413|sp|O32465|DNAJ_BUCAI RecName: Full=Chaperone protein dnaJ
 gi|254777942|sp|B8D8V3|DNAJ_BUCA5 RecName: Full=Chaperone protein dnaJ
 gi|25296014|pir||F84947 dnaJ protein [imported] - Buchnera sp. (strain APS)
 gi|10038835|dbj|BAB12870.1| dnaJ protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
 gi|219624370|gb|ACL30525.1| DnaJ protein [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|311085894|gb|ADP65976.1| chaperone protein DnaJ [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086467|gb|ADP66548.1| chaperone protein DnaJ [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
          Length = 377

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 249/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQ+LGI ++A +R++K A++ LAMKYHPD+N+ D  A+ KF +I EAYE+L + 
Sbjct: 1   MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGDKTAEGKFKEIKEAYEILINE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YDQ GH A E G  +     F      ++DFS++F  +FG I G  R+ +     
Sbjct: 61  EKRSAYDQYGHAAFENGQSNSTYSTFT----NSADFSDIFGDVFGDIFGGNRTQR----- 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL YN+EI+LEEA  G   +I+ PT  KC TC GSG + GT P  C+ C+G G++
Sbjct: 112 AKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGTKPRSCSTCHGKGQI 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   + FF+++++C TC G G II  PC+ CHGQGRV   K+LSV +PPG+D   RIRL+
Sbjct: 172 HI-RKGFFTVQQSCPTCHGKGTIITDPCNLCHGQGRVETYKILSVKIPPGLDTNDRIRLN 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ I+VKKH  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 NEGEAGANGAQSGDLYVQITVKKHPIFEREGNNLYCEVPINFTMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQ+GK FR++G+G+  + +  +GDL  +V VETP  LN++Q+ LL E    F
Sbjct: 290 VKLKIPYETQSGKLFRIRGRGVKSVQNRNQGDLLCRVVVETPVNLNEQQKNLLHELGNSF 349

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                + N+P+S  FF  +K FFD L
Sbjct: 350 HGFRGEKNSPRSKRFFDGVKRFFDDL 375


>gi|229592651|ref|YP_002874770.1| chaperone protein DnaJ [Pseudomonas fluorescens SBW25]
 gi|259645279|sp|C3K274|DNAJ_PSEFS RecName: Full=Chaperone protein dnaJ
 gi|229364517|emb|CAY52372.1| chaperone protein DnaJ (HSP40) [Pseudomonas fluorescens SBW25]
          Length = 374

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 245/384 (63%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +  E++E F + +EAYE L DP
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDSKESEEMFKEANEAYECLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      GA       +G  +FS++F  +F    G           
Sbjct: 61  NKRAAYDQYGHAGVDPSMGGGGA------GFGGQNFSDIFGDVFSDFFGG--GRGGQRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G +V IR PT V C  C GSGAK G++P+ C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTSVNIRVPTLVNCKPCDGSGAKKGSSPITCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIISDPCDSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS V  A+GG  ++ TLD   
Sbjct: 232 GEGEAGTQGGPTGDLYVVINVREHSIFQRDGKHLFCEVPISFVDAALGGELEIPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFR++GKG+  +  G  GDL  +V VETP  L +RQRELLEEF    
Sbjct: 291 VKLKIPEGTQTGKQFRIRGKGVAPVRGGGAGDLMCRVAVETPVNLGRRQRELLEEFRSSL 350

Query: 361 SQDN--NPQSTGFFARMKDFFDSL 382
             D+  +P++TGFF  +K FF  L
Sbjct: 351 EGDDSHSPKTTGFFDGVKRFFGDL 374


>gi|304320405|ref|YP_003854048.1| Heat shock protein DnaJ [Parvularcula bermudensis HTCC2503]
 gi|303299307|gb|ADM08906.1| Heat shock protein DnaJ [Parvularcula bermudensis HTCC2503]
          Length = 385

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 179/381 (46%), Positives = 252/381 (66%), Gaps = 2/381 (0%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y +LG++R+A    +K+AFR LAMKYHPD+N  D  A++KF +I EAYEVL D QKRA
Sbjct: 4   DYYDLLGVERSADGAAIKSAFRKLAMKYHPDRNPGDEAAEKKFKEIGEAYEVLSDDQKRA 63

Query: 65  LYDQGGHEALE-YGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEA 123
            YD+ GH A +  G      G    G + +  FS++FE IFG  MG G    R       
Sbjct: 64  AYDRFGHAAFQNGGGPGGPGGAGFGGGFASGAFSDVFEDIFGEFMGGGGGRGRGRRQSGR 123

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTT 183
           GADL++ + + L EAF+G   +I  P++  C  C GSGA+PGT+P  C+ C G+GRV   
Sbjct: 124 GADLKFEVTVELGEAFAGIEKEISVPSSEACDVCEGSGAEPGTSPTTCSTCGGAGRVRMQ 183

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
            Q FF++ERAC TC+G G+ I  PCS C GQGRV + + L+V +P GV+DGTRIRL+G+G
Sbjct: 184 -QGFFAVERACPTCQGQGETIETPCSNCGGQGRVRKNRTLAVEIPAGVEDGTRIRLTGQG 242

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRV 303
            AG+ G   GDLY+F+ V+ HQ F+RDGADLYC V + +VT A+GG  +  T+D    ++
Sbjct: 243 EAGLRGAPFGDLYLFVRVRDHQLFERDGADLYCHVHVPMVTAALGGEIEAPTIDGGRVKI 302

Query: 304 TIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQD 363
            IPEG+Q+G++FRL+  GM  +    +GD++V++ VETP  L  RQ+ELL EF +    +
Sbjct: 303 KIPEGSQSGRKFRLRSMGMNQLRRPVRGDMFVELMVETPTNLTSRQKELLREFCEEGGGN 362

Query: 364 NNPQSTGFFARMKDFFDSLKN 384
           + PQS  FF R K+F+D++++
Sbjct: 363 DCPQSNNFFDRAKEFWDNIRD 383


>gi|2351217|dbj|BAA21965.1| DnaJ [Buchnera sp.]
          Length = 377

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 249/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQ+LGI ++A +R++K A++ LAMKYHPD+N+ D  A+ KF +I EAYE+L + 
Sbjct: 1   MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGDKTAEGKFKEIKEAYEILINE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YDQ GH A E G  +     F      ++DFS++F  +FG I G  R+ +     
Sbjct: 61  EKRSAYDQYGHAAFENGQSNSTYSTFT----NSADFSDIFGDVFGDIFGGNRTQR----- 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL YN+EI+LEEA  G   +I+ PT  KC TC GSG + GT P  C+ C+G G++
Sbjct: 112 AKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGTKPRSCSTCHGKGQI 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   + FF+++++CSTC G G II  PC+ CHGQGRV   K+LSV +PPG+D   RIRL+
Sbjct: 172 HI-RKGFFTVQQSCSTCHGKGTIITDPCNLCHGQGRVETYKILSVKIPPGLDTNDRIRLN 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ I+VKKH  F+R+G +LYC VP +    A+GG  +V TLD   
Sbjct: 231 NEGEAGANGAQSGDLYVQITVKKHPIFEREGNNLYCEVPKNFTMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQ+GK FR++G+G+  + +  +GDL  +V VETP  LN++Q+ LL E    F
Sbjct: 290 VKLKIPYETQSGKLFRIRGRGVKSVQNRNQGDLLCRVVVETPVNLNEQQKNLLHELGNSF 349

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                + N+P+S  FF  +K FFD L
Sbjct: 350 HGFRGEKNSPRSKRFFDGVKRFFDDL 375


>gi|332140814|ref|YP_004426552.1| chaperone protein DnaJ [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550836|gb|AEA97554.1| chaperone protein DnaJ [Alteromonas macleodii str. 'Deep ecotype']
          Length = 389

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 184/387 (47%), Positives = 250/387 (64%), Gaps = 13/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+D++A +R++K A++ LAMKYHPD+ + D   ++KF +I EAYE+L D 
Sbjct: 13  MSKRDYYEVLGVDKSAGEREIKKAYKKLAMKYHPDRTQGDKGLEDKFKEIQEAYEILSDS 72

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      G         G +DF ++F  +FG I G         S 
Sbjct: 73  QKRAAYDQYGHAGVDPNRGGGGF-------GGGADFGDIFGDVFGDIFGG-GGRGGRQSR 124

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  GK+V IR PT V+C  C GSGAK G++P  C  C+G+G+V
Sbjct: 125 ARQGSDLRYNLELSLEEAVRGKSVDIRVPTLVECDVCDGSGAKKGSSPKTCPTCHGNGQV 184

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHG GR  + K L+V +P GVD G RIRLS
Sbjct: 185 -QMRQGFFAVQQTCPTCSGKGKIIEDPCNSCHGHGRKEKTKTLNVKIPAGVDTGDRIRLS 243

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V++H  F+RDG +LYC VP+S  T A+GG  +V TLD   
Sbjct: 244 GEGEAGENGAPAGDLYVQVHVREHDIFQRDGNNLYCEVPLSFTTAALGGELEVPTLDGK- 302

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ I   TQTG+ FRL+GKG+  + SG  GDL  +V VETP  L+ RQ+ELL+E E+  
Sbjct: 303 VKLKISAETQTGRMFRLRGKGVKSVRSGAMGDLMCKVVVETPVNLSSRQKELLQELEESM 362

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
             +S  ++P++ GFF  +K FFD L N
Sbjct: 363 GKASSKHSPKAQGFFDGVKKFFDDLTN 389


>gi|11132612|sp|Q9ZFC5|DNAJ_METSS RecName: Full=Chaperone protein dnaJ
 gi|4008081|gb|AAC95379.1| putative DnaJ [Methylovorus sp. SS1]
          Length = 371

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 252/382 (65%), Gaps = 15/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A+D ++K ++R LAMKYHPD+N ++P+A+E F +  EAYEVL D 
Sbjct: 1   MAKKDYYEVLGVNRDASDEEIKKSYRKLAMKYHPDRNPDNPKAEESFKEAKEAYEVLSDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A      GFG       +F++ F  IFG I G G   +RS+  
Sbjct: 61  QKRAAYDQYGHAGVDPSAGPGPRQGFG-------NFADAFGDIFGDIFGGGGGNRRSNVY 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+EISLE+A      +IR P   +C TC GSGA+PGT P+ C  C G G+V
Sbjct: 114 --RGADLRYNMEISLEDAARRTETKIRIPVMSECETCHGSGARPGTQPVTCTTCGGHGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG+++  PC  C G GRV + K LSV +P GVD+G RIRLS
Sbjct: 172 -RMQQGFFSVQQTCPKCHGSGKMVKEPCPSCQGAGRVKKHKTLSVKIPAGVDEGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GE G  V GG P DLY+ + +K+H  F+RDG +L+C +PIS  T A+GG  ++ TLD  H
Sbjct: 231 GE-GERVNGGPPRDLYVVVHLKQHDIFQRDGGNLHCEMPISFTTAALGGEIEIPTLDG-H 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQTG  FRL+GKG+  + +   GDL   V VETP KL +RQ+ELL E E+I+
Sbjct: 289 AKMKIPPETQTGATFRLRGKGIKPLRTNDPGDLMCHVVVETPIKLTERQKELLREMEEIN 348

Query: 361 SQDNN---PQSTGFFARMKDFF 379
            QD++   P++ G+  ++KDFF
Sbjct: 349 LQDSDKHSPRAKGWMDKVKDFF 370


>gi|254449862|ref|ZP_05063299.1| chaperone protein DnaJ [Octadecabacter antarcticus 238]
 gi|198264268|gb|EDY88538.1| chaperone protein DnaJ [Octadecabacter antarcticus 238]
          Length = 381

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 180/384 (46%), Positives = 258/384 (67%), Gaps = 5/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A+  ++K  +R  A + HPD+N + P+A+ +F +  EAYEVL++ 
Sbjct: 1   MSKRDYYEILGLSKGASADEIKKGYRQKAKELHPDRNTDKPDAEGQFKEAGEAYEVLKNA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-NSDFSELFEGIFGGIMGSGRSYKRSSS 119
            K+A YD+ GH A E G    G      G     S FS++F+ +FG + G+  + ++S +
Sbjct: 61  DKKAAYDRYGHAAFEGGMGGGGGRPGAGGQGDFGSAFSDIFDDLFGNVGGARGAGRQSRA 120

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           +   G DLRYNL I+LEEAF+G    +  PTAV C +C G+GA+ G+ P  C  C+G G+
Sbjct: 121 S--RGNDLRYNLRITLEEAFAGLQKTVTVPTAVGCGSCKGTGAEGGSEPQTCPTCSGMGK 178

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C TC G GQ I +PC +CHG GRV +EK LSVN+P GV+ GTRIRL
Sbjct: 179 VRAQ-QGFFTVERTCPTCNGMGQTIKNPCHECHGAGRVEKEKSLSVNIPAGVETGTRIRL 237

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG+ GG  GDLYIFI V+ H  F+R+  +L+C VP+S+ T A+GG  +V T+D  
Sbjct: 238 AGEGEAGMRGGPTGDLYIFIEVRDHDLFEREVNNLFCRVPVSMATAALGGDIEVPTIDGG 297

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            SRV IP G+Q+G+Q RL+ KGMP +  G  GD+++++ VETP  L  +Q+ELL EFE +
Sbjct: 298 RSRVKIPAGSQSGRQMRLRAKGMPALRGGGPGDMFIEMAVETPVNLTSKQKELLREFEDL 357

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
           +S DNNPQS+ FF  +K F++S+K
Sbjct: 358 AS-DNNPQSSSFFKSVKSFWESMK 380


>gi|262277781|ref|ZP_06055574.1| chaperone protein DnaJ [alpha proteobacterium HIMB114]
 gi|262224884|gb|EEY75343.1| chaperone protein DnaJ [alpha proteobacterium HIMB114]
          Length = 383

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 252/386 (65%), Gaps = 8/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M KAD+Y+ LG++R+A+  ++K+A+R LAMKYHPD+N  D  A+ KF   +EAY++L DP
Sbjct: 1   MSKADYYETLGVNRSASKDEIKSAYRKLAMKYHPDRNPGDKAAETKFKDATEAYQILSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGA----GGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKR 116
            K++ YDQ GH A E     QG     GGF +G + +       + +     G GR   R
Sbjct: 61  NKKSSYDQFGHSAFENMGGGQGGFSDFGGFDSGSFSDIFDDFFGDFM---GSGRGRGGGR 117

Query: 117 SSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
             S G  G+DL+ NLE+SLEEA+ GK       +  KC TCSGSGAKPG++P  C  C G
Sbjct: 118 RKSRGRRGSDLKINLEVSLEEAYQGKKTTFNINSTEKCGTCSGSGAKPGSSPKTCGTCGG 177

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
            GRV  + Q FF++++ C  CRG G+++  PC  C G G   ++K LS+ +P GVDDGTR
Sbjct: 178 DGRV-RSQQGFFTVQQTCPDCRGEGEVVGSPCKDCSGFGTQKKKKTLSIQIPKGVDDGTR 236

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRLSG+G AG  GGA GDLY++I V+KH+ F+R+  +L+  +P+S+   A+G + +V  +
Sbjct: 237 IRLSGKGEAGSKGGADGDLYVYIQVRKHELFEREEENLFYELPVSLADAALGTSIEVPNI 296

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           D + S+V IP GTQ+GKQ RL+ KGMP++  G  GDLY+Q++VETP  LN  Q+ELLE+F
Sbjct: 297 DGSRSKVKIPAGTQSGKQLRLRDKGMPMLRGGGYGDLYLQIKVETPVSLNTEQKELLEKF 356

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
           + +    NNP++  F  + K F++S+
Sbjct: 357 KDLEDSKNNPENQSFIKKAKKFWESI 382


>gi|70734323|ref|YP_257963.1| chaperone protein DnaJ [Pseudomonas fluorescens Pf-5]
 gi|123658139|sp|Q4KIH0|DNAJ_PSEF5 RecName: Full=Chaperone protein dnaJ
 gi|68348622|gb|AAY96228.1| dnaJ protein [Pseudomonas fluorescens Pf-5]
          Length = 374

 Score =  352 bits (904), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 245/384 (63%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R ++D +LK A+R LAMK+HPD+N  D  +++ F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSDAELKKAYRRLAMKHHPDRNPGDKASEDMFKEANEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      G        +G  +FS++F  +F    G       S   
Sbjct: 61  SKRAAYDQYGHAGVDPSMGGGGG------GFGGQNFSDIFGDVFSDFFGG--GRGGSRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G++P+ C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIISDPCDSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS V  A+GG  ++ TLD   
Sbjct: 232 GEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFVDAALGGELEIPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFR++GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLKIPEGTQTGKQFRIRGKGVAPVRGGGAGDLMCRVAVETPVNLSRRQRELLEELRGSL 350

Query: 361 SQDN--NPQSTGFFARMKDFFDSL 382
             DN  +P++TG+F  +K FF  L
Sbjct: 351 DDDNSHSPKTTGWFEGVKRFFGDL 374


>gi|332993768|gb|AEF03823.1| chaperone protein DnaJ [Alteromonas sp. SN2]
          Length = 378

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 188/387 (48%), Positives = 248/387 (64%), Gaps = 12/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+D+ A +R++K A++ LAMKYHPD+ + D   + KF +I EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVDKGAGEREIKKAYKKLAMKYHPDRTQGDKALEVKFKEIQEAYEVLNDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++            AG  G  DF ++F  +FG I G G +     S 
Sbjct: 61  QKRAAYDQYGHAGVDPNRGG-------AGFGGGGDFGDIFGDVFGDIFGGGGARGGRQSR 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  GK+V IR PT V+C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 114 ARQGSDLRYNLELSLEEAVRGKSVDIRVPTLVECEVCDGSGAKKGSTPKTCPTCHGNGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHG GR  + K L+V +P GVD G RIRLS
Sbjct: 174 -QMRQGFFAVQQTCPTCSGKGKIIEDPCNSCHGHGRKEKTKTLNVKIPSGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V+ H+ F+RDG +LYC VP+S  T A+GG  +V TLD   
Sbjct: 233 GEGEAGENGAPAGDLYVQVHVRDHKIFQRDGNNLYCEVPLSFTTAALGGELEVPTLDGKV 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
                PE TQTG+ FRL+GKG+  + SG  GDL  +V VETP  L+ RQ+ELL+E E+  
Sbjct: 293 KLKISPE-TQTGRMFRLRGKGVKSVRSGAVGDLMCKVVVETPVSLSSRQKELLQELEESM 351

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
             +S  ++P++ GFF  +K FFD L N
Sbjct: 352 GKASSKHSPKAQGFFDGVKKFFDDLTN 378


>gi|294010953|ref|YP_003544413.1| molecular chaperone DnaJ [Sphingobium japonicum UT26S]
 gi|292674283|dbj|BAI95801.1| molecular chaperone DnaJ [Sphingobium japonicum UT26S]
          Length = 375

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 241/375 (64%), Gaps = 7/375 (1%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++L ++R A    +K+A+R LAMKYHPD+N    +++ KF  +SEAYE L+DPQKRA
Sbjct: 6   DYYELLEVERTADAAAIKSAYRKLAMKYHPDKNGGCTDSEAKFKAVSEAYECLKDPQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH A +      G GG G G  G SD  ++FE IF     +   +         G
Sbjct: 66  AYDRFGHAAFQ---NGSGFGGGGRGAGGFSDLGDIFETIF---GQAAGGFGGGRQAQRRG 119

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRY++EI+L++A+ GK  +I    +  C +C GSGA+PGT    C  C+G G+V    
Sbjct: 120 ADLRYDMEITLDDAYHGKKTEIEIEVSAPCESCDGSGAQPGTGVRSCGTCHGHGQVRAQ- 178

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF +ER C +C G+GQ+I  PC  C G+GRV   K LSVN+P GVD+GTRIRLSGEG 
Sbjct: 179 QGFFVVERTCPSCHGAGQVIESPCRSCRGEGRVDRPKTLSVNIPAGVDEGTRIRLSGEGE 238

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG  G   GDLYIF+ VK+H  F+RDG  L+   PISI T A+GG  +V  LD     + 
Sbjct: 239 AGARGAPAGDLYIFLHVKRHPIFERDGTTLFARAPISITTAALGGVIEVPGLDGQRHEIR 298

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           IP G Q+GKQ R +G GMPV+N   +GDL +QV VETP KL+ +QRELLE F +  + + 
Sbjct: 299 IPSGIQSGKQIRQRGAGMPVLNGRGQGDLVIQVDVETPTKLSAKQRELLEAFRETETGEE 358

Query: 365 NPQSTGFFARMKDFF 379
            PQSTGFF+++K+ +
Sbjct: 359 CPQSTGFFSKLKELW 373


>gi|226329214|ref|ZP_03804732.1| hypothetical protein PROPEN_03117 [Proteus penneri ATCC 35198]
 gi|225202400|gb|EEG84754.1| hypothetical protein PROPEN_03117 [Proteus penneri ATCC 35198]
          Length = 363

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 239/356 (67%), Gaps = 9/356 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ +NA ++++K A++ LAMKYHPD+N+ D E++ KF +I EAYE+L D 
Sbjct: 1   MAKRDFYEVLGLSKNADEKEIKRAYKRLAMKYHPDRNQGDKESEIKFKEIKEAYEILSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G      G    G  G +DF ++F  +FG I G GR  +R++  
Sbjct: 61  QKRAAYDQYGHAAFEQGGFGGQGG---GGFGGGADFGDIFGDVFGDIFGGGRRQQRAAR- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DL+YN++++LEEA  G T +IR PT   C  C GSGAK GT+   C+ C+G+G+V
Sbjct: 117 ---GSDLQYNMDLTLEEAVRGVTKEIRIPTLETCDKCHGSGAKEGTSAETCSTCHGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q FF++++ C TC G G++I  PCSKCHG GRV   K LSV +P GVD G RIRLS
Sbjct: 174 HLR-QGFFTVQQTCPTCHGRGKVIKEPCSKCHGDGRVERSKTLSVKIPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V++H  F+RDG +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGENGAPAGDLYVQVHVRQHHIFERDGNNLYCEVPINFAIAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
            ++ IP  TQTGK FR+KGKG+  + S   GDL  +V VETP KLN++Q+EL+++ 
Sbjct: 292 VKLKIPAETQTGKMFRMKGKGVKSVRSSSIGDLMCRVVVETPVKLNEKQKELIQQL 347


>gi|325521155|gb|EGD00057.1| chaperone protein DnaJ [Burkholderia sp. TJI49]
          Length = 377

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 244/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G      R    
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAGGGRGGRG 113

Query: 121 GEA---GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           G     GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G 
Sbjct: 114 GPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEICHGSGAKPGTKPETCPTCHGQ 173

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RI
Sbjct: 174 GTV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRI 232

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R +G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL 
Sbjct: 233 RSAGNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL- 291

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
           A  +   + EGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++FE
Sbjct: 292 AGRATFPVTEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEHQRDLLKQFE 351

Query: 358 QISSQ---DNNPQSTGFFARMKDFFD 380
           +  ++    ++PQS  +F R+K FF+
Sbjct: 352 KSLAEGGARHSPQSKSWFDRVKSFFE 377


>gi|91781885|ref|YP_557091.1| putative DnaJ chaperone protein [Burkholderia xenovorans LB400]
 gi|296161787|ref|ZP_06844589.1| chaperone protein DnaJ [Burkholderia sp. Ch1-1]
 gi|122970696|sp|Q145F0|DNAJ_BURXL RecName: Full=Chaperone protein dnaJ
 gi|91685839|gb|ABE29039.1| Putative DnaJ chaperone protein [Burkholderia xenovorans LB400]
 gi|295887951|gb|EFG67767.1| chaperone protein DnaJ [Burkholderia sp. Ch1-1]
          Length = 380

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 244/385 (63%), Gaps = 10/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+  F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEGHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + G  G          F ++F  IFG   G         + 
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGGAGAQGFGGFADAFGDIFGDIFGQAAGGAARGGGGRAG 117

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+GSG
Sbjct: 118 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKPETCPTCSGSG 177

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR
Sbjct: 178 SV-RMSQGFFSIQQTCPKCHGTGTYIPDPCGHCHGAGKVKETKTLEVKIPAGIDDGMRIR 236

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 237 SAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 295

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++FE+
Sbjct: 296 GRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEPQRDLLKQFEK 355

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
              +    ++PQS  +F R+K FFD
Sbjct: 356 ALVEGGSRHSPQSKSWFDRVKSFFD 380


>gi|296533455|ref|ZP_06896038.1| chaperone DnaJ [Roseomonas cervicalis ATCC 49957]
 gi|296266235|gb|EFH12277.1| chaperone DnaJ [Roseomonas cervicalis ATCC 49957]
          Length = 385

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 250/387 (64%), Gaps = 9/387 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ R A+D  LK A+R LAMKYHPD+N  D  A+  F +++EAY+VL+DP
Sbjct: 1   MAKKDYYETLGVARGASDEDLKKAYRKLAMKYHPDRNPGDKAAEASFKEVNEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YD+ GH A E G    G G       G    +  FE IF  + G     +  +  
Sbjct: 61  EKRAAYDRFGHAAFEGGGGGGGGG---PFGGGGPFGAGGFEDIFAEMFGQFGGRRGGAGA 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGA--KPGTNPMDCNICNGSG 178
              GADLR +  I+LEEAF+G    IR  ++V+C  C G+GA  K  +    C  C G+G
Sbjct: 118 TGRGADLRQDATITLEEAFAGTRQTIRVQSSVQCDACDGTGAEGKASSAQSTCTTCGGAG 177

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FF IER C TC G+G++I +PC  C G GRV  E+ L+V +P GV+DGTRIR
Sbjct: 178 KVRAQ-QGFFLIERTCPTCGGTGRVIKNPCKVCSGAGRVQRERTLNVTIPAGVEDGTRIR 236

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG AG+ G   GDLY+ IS++ H  F+RDGA++Y  VP+ +   A+GG  +V T+D 
Sbjct: 237 LSGEGEAGLRGAPAGDLYVDISIRPHALFQRDGANIYVRVPLRMTQAALGGAVEVPTIDG 296

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             SRVTIP GTQTG QFRL+GKG  V+ S  +GD+YVQV VETPQ L+ RQRELLE+FE 
Sbjct: 297 GRSRVTIPAGTQTGDQFRLRGKGFSVLRSAARGDMYVQVAVETPQNLSPRQRELLEQFES 356

Query: 359 ---ISSQDNNPQSTGFFARMKDFFDSL 382
               S Q ++P+S GFFA++K+F+D L
Sbjct: 357 EGGQSGQQSSPESEGFFAKVKEFWDGL 383


>gi|163750809|ref|ZP_02158044.1| chaperone protein DnaJ [Shewanella benthica KT99]
 gi|161329504|gb|EDQ00498.1| chaperone protein DnaJ [Shewanella benthica KT99]
          Length = 372

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 249/385 (64%), Gaps = 18/385 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VL + R +++R++K A++ LAMK+HPD+N  D  A+  F +I EAYE+L D 
Sbjct: 1   MSKRDYYEVLSVGRESSEREIKKAYKRLAMKFHPDRNPGDKAAEANFKEIKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++        GG      GN+DF ++F   FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVD-----PNRGG------GNADFGDVFGDRFGDIFGG--GRRGGQRQ 107

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R P    C +C GSGAK GT+P  C  C+G G+V
Sbjct: 108 AARGSDLRYNLELSLEEAVKGLTKELRIPKLATCDSCDGSGAKKGTSPTTCGTCHGQGQV 167

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II   C+KCHG+GRV + K+LSV +P GVD+G RIRLS
Sbjct: 168 -QMRQGFFAVQQACPTCHGRGKIIKDLCNKCHGEGRVEKSKILSVKIPAGVDNGDRIRLS 226

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG YG  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 227 GEGEAGEYGAHPGDLYVQVSVREHSIFVRDGNNLYCEVPISFGKAALGGGIEVPTLDGK- 285

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP KLN+RQ+E+L EF++  
Sbjct: 286 VNLKIPAETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVKLNERQKEMLREFDETL 345

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
             +S+ ++P++ GFF  +K FF  L
Sbjct: 346 ADASKKHSPKAEGFFDGVKKFFQDL 370


>gi|260913612|ref|ZP_05920088.1| chaperone DnaJ [Pasteurella dagmatis ATCC 43325]
 gi|260632151|gb|EEX50326.1| chaperone DnaJ [Pasteurella dagmatis ATCC 43325]
          Length = 372

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 184/383 (48%), Positives = 242/383 (63%), Gaps = 14/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A ++++K A++ LAMKYHPD+ + + E +EKF +I EAYEVL D 
Sbjct: 1   MAKKDYYEVLGVERSADEKEIKRAYKKLAMKYHPDRTQGNKELEEKFKEIQEAYEVLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E   Q    G    G      F ++F  IFGG  G  R  +     
Sbjct: 61  QKRANYDQYGHAAFE---QGGFGGSGFGGADFGDIFGDMFGDIFGGSRGRQRVVR----- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G DLRY+LEISLEEA  G T  I+  T V C TC GSGA+ G+    C+ C+G+GRV
Sbjct: 113 ---GDDLRYDLEISLEEAVRGTTKDIQINTLVHCDTCDGSGAEKGSKVETCSTCHGAGRV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF  E+ C TC GSG+ I  PC  CHG GRV ++K LSV +PPGVD G ++RLS
Sbjct: 170 -RRQQGFFVTEQVCPTCHGSGKKIEKPCGSCHGDGRVHKKKNLSVKIPPGVDTGNQLRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ I V+ H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 229 GEGAAGENGAPSGDLYVVIHVRDHHIFDRDGNNLYCEVPISFTMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-I 359
            ++ +P  TQTGK FR++GKG+    SG  GDL  ++ VETP +LN+ Q+ELL + E+ +
Sbjct: 288 VKLKVPPETQTGKLFRMRGKGVTSARSGYSGDLICRIIVETPIQLNEEQKELLRKLEESL 347

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
              ++ P+S+ FF  +K FFD+L
Sbjct: 348 EGTNSRPKSSSFFDSVKKFFDNL 370


>gi|74317557|ref|YP_315297.1| molecular chaperone protein DnaJ [Thiobacillus denitrificans ATCC
           25259]
 gi|123611777|sp|Q3SIN3|DNAJ_THIDA RecName: Full=Chaperone protein dnaJ
 gi|74057052|gb|AAZ97492.1| molecular chaperone protein DnaJ [Thiobacillus denitrificans ATCC
           25259]
          Length = 372

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 190/382 (49%), Positives = 251/382 (65%), Gaps = 15/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  D  A++KF +  +AYE+L D 
Sbjct: 1   MSKRDYYEVLGVAKNASDEEIKKAYRKLAMKHHPDRNPGDHAAEDKFKEAKQAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRS--YKRSS 118
            KRA YDQ GH  ++   QS   GG   G   +  FS++F  IFGG  G+ R   Y+   
Sbjct: 61  DKRAAYDQFGHAGVD--PQSGMGGGGFGGGGFSDAFSDIFGDIFGGGGGNRRDRVYR--- 115

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYNLEI LEEA  G   +IR PT  +C TC GSGAKPGT P  C+ C G G
Sbjct: 116 -----GADLRYNLEIGLEEAARGTETKIRIPTLEECGTCHGSGAKPGTQPTTCSACGGHG 170

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FFS+++ C  C G+G+++  PC  CHG+GRV + K LSV +P GVD G RIR
Sbjct: 171 QVRVQ-QGFFSVQQTCPRCGGTGKMVSDPCPSCHGEGRVKKHKTLSVKIPAGVDSGDRIR 229

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG AGV GG  GDLY+ I +K H  FKRDG DL+C +PIS  T A+GG  ++ TLD 
Sbjct: 230 LAGEGEAGVNGGPSGDLYVVIHLKDHPVFKRDGDDLHCEMPISFATAALGGEVEIPTLDG 289

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
            H+++ IP  TQ+GK FRL+GKG+  + S   GDL   + VETP  L++RQRELL EFE 
Sbjct: 290 -HAKIKIPAETQSGKVFRLRGKGIKGVRSHAPGDLLCHMLVETPVNLSERQRELLREFEA 348

Query: 359 ISS-QDNNPQSTGFFARMKDFF 379
           +S  ++NNP++  F  ++K FF
Sbjct: 349 LSPGRNNNPRAQSFMDKVKSFF 370


>gi|119478522|ref|ZP_01618484.1| DnaJ protein [marine gamma proteobacterium HTCC2143]
 gi|119448503|gb|EAW29751.1| DnaJ protein [marine gamma proteobacterium HTCC2143]
          Length = 378

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 251/385 (65%), Gaps = 10/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ R++  + +K A+R +AMK+HPD+N +D +++EKF + SEAYEVL D 
Sbjct: 1   MSKRDYYEILGVARDSAGKDIKKAYRRVAMKFHPDRNPDDKDSEEKFKEASEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH+A+   A + G         GN +F ++F  +FG I G G      S  
Sbjct: 61  QKRAAYDQYGHDAVNGNAGAGGF------GGGNGNFGDIFGDVFGDIFGGGGGGGGRSRG 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNL++ LE A  G  V+IR PT V C  CSGSGAK G+ P+ C  C G G+V
Sbjct: 115 PARGSDLRYNLDVDLEAAVKGTEVKIRIPTLVSCEPCSGSGAKKGSAPVTCTTCGGIGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++AC  CRG G++I  PC+ CHGQG   E K LSV VPPGVD G RIRLS
Sbjct: 175 -RMQQGFFSVQQACPNCRGKGKMISDPCNSCHGQGLKEETKTLSVKVPPGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDL++ I+V+ H  F+RDG +LYC VPISI   ++GG  +V TLD   
Sbjct: 234 GEGEAGPDGGPSGDLFVQINVRSHSIFERDGKNLYCEVPISITDASLGGELEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPE TQTGK FRL+GKG+  +  G  GDL  +V +ETP  L K Q++LL++ ++  
Sbjct: 293 VKLKIPEETQTGKLFRLRGKGVAPVRGGSTGDLLCRVVLETPVNLTKSQKDLLQQLQESF 352

Query: 361 SQDNN--PQSTGFFARMKDFFDSLK 383
            ++ N  P+ + +FA +K FFD +K
Sbjct: 353 EKEGNQSPKKSSWFAGVKSFFDDMK 377


>gi|294789113|ref|ZP_06754352.1| chaperone protein DnaJ [Simonsiella muelleri ATCC 29453]
 gi|294482854|gb|EFG30542.1| chaperone protein DnaJ [Simonsiella muelleri ATCC 29453]
          Length = 380

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 251/385 (65%), Gaps = 16/385 (4%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D YQ+LG+ ++A+D  +K A+R LAMKYHPD+N ++ EA+EKF ++  AY +L D QKRA
Sbjct: 4   DLYQILGVPKSASDDDIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQNAYAILSDAQKRA 63

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNS---DFSELFEGIFGGIMGSGRSYKRSSSTG 121
            YDQ G+ A E      G G  G G +G S   DF ++F  +FGG  GS R         
Sbjct: 64  TYDQFGNAAFENNGAGAGGGFGGFGGFGGSQSFDFGDIFSQMFGGGGGSARQQNFQ---- 119

Query: 122 EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVY 181
             GADL+Y++EISLEEA +G   QI  PT  +C  C GSGAKPG++   C+ C+G+G V+
Sbjct: 120 --GADLQYSVEISLEEAATGIRKQITVPTYDECDVCHGSGAKPGSSATTCSTCHGTGTVH 177

Query: 182 TTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSG 241
              Q+ F I++ C TC G+G+ I  PC+KCHG+GRV+  K + VN+P G+D+G RIRLSG
Sbjct: 178 VR-QAIFQIQQTCPTCHGTGKEIKDPCTKCHGEGRVATTKTVEVNIPAGIDNGQRIRLSG 236

Query: 242 EGGAGVYGGAPGDLYIFISVKKHQFFKRD---GADLYCTVPISIVTVAMGGTFDVATLDA 298
           EG  G+ G   GDLYI +SVK H+ F RD     DL+C +PIS  T A+GG  +V TLD 
Sbjct: 237 EGEPGMRGAPAGDLYIHVSVKPHKVFHRDPEAPTDLHCELPISFPTAALGGEVEVPTLDG 296

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              ++++P GTQ GK+ R+KGKGM  + S   GDLY  V VETP  L +RQ+ELL+EFE 
Sbjct: 297 K-VKLSVPAGTQNGKRLRIKGKGMKSVRSSLVGDLYCHVVVETPVNLTERQKELLQEFEN 355

Query: 359 ISSQDNN--PQSTGFFARMKDFFDS 381
           ++S D +  P+  GF  ++K+ FD+
Sbjct: 356 LTSTDRSQTPKQKGFLDKLKEMFDN 380


>gi|329896047|ref|ZP_08271283.1| Chaperone protein DnaJ [gamma proteobacterium IMCC3088]
 gi|328922007|gb|EGG29371.1| Chaperone protein DnaJ [gamma proteobacterium IMCC3088]
          Length = 376

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 254/386 (65%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA ++ +K A+R +AMK+HPD+N +DP+A EKF + +EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVAQNADEKDIKKAYRRIAMKFHPDRNSDDPKADEKFKEATEAYEVLTDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YD+ GH A++  A   G        + +  F ++F  +FG I       +  SS 
Sbjct: 61  EKRSAYDRFGHAAVDGSAGGGGG------GFSDGGFGDIFGDVFGDIF---GGGRGRSSG 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY L+ISLE+A +GKTV+I+ PT   C TC GSGAKPG++P  C+ C G G+V
Sbjct: 112 PQRGSDLRYTLDISLEDAVNGKTVEIKVPTLDSCDTCDGSGAKPGSSPKTCDTCGGVGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +++ C +CRG G+ I  PC  C GQGRV   K LSV VPPGVD G RIRLS
Sbjct: 172 RM-QQGFFQVQQTCPSCRGRGKTISDPCGSCRGQGRVERTKTLSVKVPPGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDL++ +SV++H  F+RDG  LYC VPI+    A+GG  +V TL+   
Sbjct: 231 GEGEAGPNGGPKGDLFVEMSVRQHPIFERDGKHLYCDVPITFADAALGGELEVPTLEG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGK FRL+GKG+  +  G  GDL  +V VETP +L+K Q+ELL+ F+   
Sbjct: 290 VKLKIPEGTQTGKLFRLRGKGVKPVRGGAVGDLLCRVTVETPVELSKHQKELLQAFQASL 349

Query: 361 SQ---DNNPQSTGFFARMKDFFDSLK 383
           ++     +P+ T +F  +K+FFD +K
Sbjct: 350 TEGGKKQSPKQTSWFEGVKNFFDDMK 375


>gi|89072620|ref|ZP_01159192.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Photobacterium sp. SKA34]
 gi|90581506|ref|ZP_01237299.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Vibrio angustum S14]
 gi|89051724|gb|EAR57177.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Photobacterium sp. SKA34]
 gi|90437268|gb|EAS62466.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Vibrio angustum S14]
          Length = 380

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 250/388 (64%), Gaps = 12/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D Y+VLG+ R+A +R +K A++ LAMK+HPD+N+ D E+ EKF ++  AYE+L D 
Sbjct: 1   MSKRDLYEVLGVARDAGERDIKKAYKRLAMKFHPDRNQGDDESAEKFKEVKYAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G      G  G +DFS++F  +FG I G      R    
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----GGFGGGADFSDIFGDVFGDIFGG--GGGRRQQR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G + +IR PT V C +C GSGAK G++   C  C+G+G+V
Sbjct: 115 AQRGSDLRYNMELTLEEAVRGCSKEIRVPTLVGCDSCDGSGAKKGSSATTCGTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G GQII  PC+KCHG+GRV E K LSV +P GVD G RIRL+
Sbjct: 175 -QMRQGFFAVQQTCPHCHGRGQIIKDPCNKCHGEGRVEETKTLSVKIPAGVDTGDRIRLT 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+RDG +L+C VP+S    A+GG  +V TLD   
Sbjct: 234 GEGEAGEFGAPAGDLYVQVHVKEHNIFQRDGNNLHCEVPVSFTMAALGGEVEVPTLDGRV 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P   QTG+ FR++GKG+  +  G  GDL  ++ VETP  L+ RQ+ELL+E E+  
Sbjct: 294 S-LKVPAEMQTGRMFRMRGKGVDSVRGGMTGDLICKLVVETPVNLSSRQKELLQELEETF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSLKN 384
              ++  + P+S GFF  +K FFD L N
Sbjct: 353 GGKAASKHKPKSEGFFKGVKKFFDDLTN 380


>gi|187922744|ref|YP_001894386.1| chaperone protein DnaJ [Burkholderia phytofirmans PsJN]
 gi|226735549|sp|B2SXC7|DNAJ_BURPP RecName: Full=Chaperone protein dnaJ
 gi|187713938|gb|ACD15162.1| chaperone protein DnaJ [Burkholderia phytofirmans PsJN]
          Length = 379

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 243/388 (62%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+  F ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEGHFKEVKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G           
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAGGAARGGG 113

Query: 121 GEA-----GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+
Sbjct: 114 RAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEICHGSGAKPGTKPETCPTCS 173

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG 
Sbjct: 174 GSGSV-RMSQGFFSIQQTCPKCHGTGTYIPEPCGHCHGAGKVKETKTLEVKIPAGIDDGM 232

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G+ GG  GDLY+ I +K+H  F+RDG DL+C +PI   T A+GG  +V T
Sbjct: 233 RIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTAALGGEIEVPT 292

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L A  +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL + QR+LL++
Sbjct: 293 L-AGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEPQRDLLKQ 351

Query: 356 FEQISSQ---DNNPQSTGFFARMKDFFD 380
           FE+   +    ++PQS  +F R+K FFD
Sbjct: 352 FEKALVEGGSRHSPQSKSWFDRVKSFFD 379


>gi|299138335|ref|ZP_07031514.1| chaperone protein DnaJ [Acidobacterium sp. MP5ACTX8]
 gi|298599581|gb|EFI55740.1| chaperone protein DnaJ [Acidobacterium sp. MP5ACTX8]
          Length = 381

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/377 (45%), Positives = 243/377 (64%), Gaps = 3/377 (0%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+VL ++R ATD +LK A+R LAM++HPD+N N+PEA+E+F Q SEAY+VL DP K
Sbjct: 7   KMDYYEVLSVERTATDAELKVAYRKLAMQFHPDRNPNNPEAEERFKQCSEAYQVLSDPDK 66

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GH  +  GA   G  G G    G  D  ++F  +FG +   G S  R +S  +
Sbjct: 67  RAAYDRYGHAGVS-GAGPGGFNGGGNPFQGQGDLGDIFGDLFGEMFNMGGSGNRRASRAQ 125

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            G DL++++ +  EEA  G   +I    A  C  CSGSG++ G  P  C  C G G++ T
Sbjct: 126 RGRDLKFDMRLEFEEAVFGVEREITIRRAEVCEVCSGSGSEGGKQPETCQQCGGRGQIRT 185

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
             Q FFS+ R C  C G+G I+ +PC  C G  R+  E  + V VP GV+  TRIR SGE
Sbjct: 186 Q-QGFFSVARTCPVCSGTGSIVRNPCKTCKGDARLQREHKILVKVPAGVEQDTRIRYSGE 244

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG +GG  GDLY+ + VK H+FF+RDG DL+C +P+S    A+G   ++ TL+   + 
Sbjct: 245 GDAGRFGGPAGDLYVVLEVKAHKFFERDGDDLHCVIPVSFPQAALGTEIELTTLEGKET- 303

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           + +PEGTQ+GK+F+LKGKG+P +NS  KGDL V+V+V+TP KLNK+Q+EL+++  +  + 
Sbjct: 304 LKVPEGTQSGKEFKLKGKGVPHLNSHGKGDLIVEVRVQTPSKLNKQQKELMKQLAETMTV 363

Query: 363 DNNPQSTGFFARMKDFF 379
           +N P S G F ++KD F
Sbjct: 364 ENTPASRGLFGKVKDIF 380


>gi|103487540|ref|YP_617101.1| chaperone DnaJ [Sphingopyxis alaskensis RB2256]
 gi|98977617|gb|ABF53768.1| Chaperone DnaJ [Sphingopyxis alaskensis RB2256]
          Length = 376

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/380 (45%), Positives = 237/380 (62%), Gaps = 9/380 (2%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++L  DR+A +  LK ++R LAMKYHPD+N    +++ +F  I+EAY+ LRDPQ+RA
Sbjct: 6   DYYELLECDRSADEAALKASYRKLAMKYHPDRNPGCKDSEARFKAINEAYDCLRDPQRRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ G   +  GA   G            D  ++FE IFG   G  R  +  +     G
Sbjct: 66  AYDRFGKAGVNGGAGGFGG----GHGSDFGDIGDIFESIFGSAFGGARQQRGPAR----G 117

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           ADLRY++EI LE+AF+G T +I    A +C  C GSGAKPGT    C+ C G G+V    
Sbjct: 118 ADLRYDMEIRLEDAFTGVTREIEVDVAARCDACDGSGAKPGTRTHRCSTCGGHGKVRAQ- 176

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF +ER C  C+G+G++I  PC+ CHG+GRV   K L+V +PPGVD+GTRIRLSGEG 
Sbjct: 177 QGFFMVERTCPACQGAGEVIADPCNSCHGEGRVDRRKRLTVTIPPGVDEGTRIRLSGEGE 236

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           +G  G APGDLYIF+ + +H+ F+R+G  L+   PIS  T A+GG   +  LD     + 
Sbjct: 237 SGARGAAPGDLYIFLHMARHKLFEREGTTLFTRAPISFTTAALGGCITIPGLDGRKHEIA 296

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDN 364
           IP G Q+GKQ R +G GMPV+N    GDL +Q+ VETP +L  +Q+ELL+ F    + + 
Sbjct: 297 IPAGIQSGKQLRQRGAGMPVLNGRGHGDLVIQIDVETPTRLTAKQKELLQAFRDTETGEE 356

Query: 365 NPQSTGFFARMKDFFDSLKN 384
            P S GFF R+KD ++ L +
Sbjct: 357 CPASQGFFGRIKDMWEDLTD 376


>gi|269103344|ref|ZP_06156041.1| chaperone protein DnaJ [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268163242|gb|EEZ41738.1| chaperone protein DnaJ [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 379

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 248/388 (63%), Gaps = 13/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D Y+VLG+ R+A++R +K A++ LAMK+HPD+N+ D +A EKF ++  AYE+L D 
Sbjct: 1   MSKRDLYEVLGVARDASERDIKKAYKRLAMKFHPDRNQGDEQAAEKFKEVKSAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G    G +DFS++F  +FG I G     +R    
Sbjct: 61  QKRAAYDQYGHAAFE-----QGGMGGGGFGGGGADFSDIFGDVFGDIFGG--GGRRQQQR 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRY LE+SLEEA  G + +I+ PT V C TC GSGAK G+    C+ C+G G+V
Sbjct: 114 AQRGADLRYTLELSLEEAVRGCSKEIKVPTLVACDTCHGSGAKEGSTASTCSTCHGVGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC KCHG+GRV E K LSV +P GVD G RIRL+
Sbjct: 174 -QMRQGFFAVQQTCPHCHGRGKIITDPCGKCHGEGRVEETKTLSVKIPAGVDTGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V  H  F+RDG++LYC VP+S    A+GG  +V TLD   
Sbjct: 233 GEGEAGEMGAPAGDLYVQVHVLPHHIFERDGSNLYCEVPVSFTMAALGGEVEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL  ++ VETP  L+ RQ+ELL+E E+  
Sbjct: 292 VNLKVPSETQTGRMFRMRGKGVKSVRGGAMGDLICKLVVETPVNLSSRQKELLKELEETF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSLKN 384
              ++  + P+S GFF  +K FFD L N
Sbjct: 352 DGKAASKHKPKSEGFFNGVKKFFDDLTN 379


>gi|326793879|ref|YP_004311699.1| Chaperone protein dnaJ [Marinomonas mediterranea MMB-1]
 gi|326544643|gb|ADZ89863.1| Chaperone protein dnaJ [Marinomonas mediterranea MMB-1]
          Length = 379

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 188/385 (48%), Positives = 244/385 (63%), Gaps = 9/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A  + +K A+RSLA KYHPD+N ++ EA EKF +I+EAYEVL   
Sbjct: 1   MSKRDYYEVLGVSRDADKKAIKKAYRSLANKYHPDKNPDNEEALEKFKEIAEAYEVLSTE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR  YD+ GHE +    Q+   G  GAG  G SD   +F  +FG I G         S 
Sbjct: 61  EKREAYDRFGHEGV--NGQAGAGGFGGAGAGGFSD---IFGDVFGDIFGGAGGGGGQQSR 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY LE+ LE+A  G   +IR PT V C  C GSGAKPGT P  C  CNG+G+V
Sbjct: 116 TRRGSDLRYTLELDLEQAVWGCEEKIRIPTLVDCEVCEGSGAKPGTKPTTCPTCNGAGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFS+++ C  C G GQII  PC+ CHGQGR  E K L+V +P GVD G RIRLS
Sbjct: 176 -RMSQGFFSVQQTCPQCHGQGQIISDPCNSCHGQGRKQEYKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDL++ +SVK H  F+RDG++LYC VPIS  T A+GG  DV TLD   
Sbjct: 235 GEGEAGTFGGPAGDLFVQVSVKPHSIFERDGSNLYCEVPISFTTAALGGEIDVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            R+ +    QTGK FRL+ KG+  +  G  GDL  +V VETP  L  RQ+ELL+EF +  
Sbjct: 294 VRLKVTSECQTGKLFRLRNKGVKPVRGGPVGDLICKVVVETPVNLTDRQKELLKEFAETM 353

Query: 361 SQ--DNNPQSTGFFARMKDFFDSLK 383
            +  +++P+   +F  +K FFD +K
Sbjct: 354 GEESEHSPKQKTWFDGVKKFFDEIK 378


>gi|90412551|ref|ZP_01220554.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Photobacterium profundum
           3TCK]
 gi|90326588|gb|EAS42994.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Photobacterium profundum
           3TCK]
          Length = 380

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A +R +K A++ LAMK+HPD+N+ + +A EKF ++  AYE+L DP
Sbjct: 1   MSKRDFYEVLGVGRDAGERDIKKAYKRLAMKFHPDRNQ-EADATEKFKEVKTAYEILTDP 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E     QG GG G G  G +DF ++F  +FG I G G   +R  S 
Sbjct: 60  QKKAAYDQYGHAAFE-----QGGGGGGYGGGGGADFGDIFGDVFGDIFGGGGGGRRQQSR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G + +IR PT V C +C GSGAK G++   C  C+G G+V
Sbjct: 115 AQRGSDLRYNMELTLEEAVRGCSKEIRVPTLVGCDSCDGSGAKKGSSATTCGTCHGQGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC+ CHGQGRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFAVQQACPHCHGRGKIIKDPCNSCHGQGRVEKTKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG +G   GDLY+ + V +H  F+RDG +LYC VP+S    A+GG  +V TL+   
Sbjct: 234 SEGEAGEFGAPAGDLYVQVHVAEHSIFERDGNNLYCEVPVSFTMAAVGGEVEVPTLNG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL  ++ VETP  L+  Q+ELL+E E+  
Sbjct: 293 VNLKVPSETQTGRMFRMRGKGVKSVRGGAVGDLICKLVVETPVNLSSHQKELLKELEESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 353 GGNAASKHKPKSEGFFNGVKKFFDDL 378


>gi|329114979|ref|ZP_08243734.1| Chaperone protein DnaJ [Acetobacter pomorum DM001]
 gi|326695422|gb|EGE47108.1| Chaperone protein DnaJ [Acetobacter pomorum DM001]
          Length = 380

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 252/379 (66%), Gaps = 10/379 (2%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y +L + R AT  +LK ++R LAMKYHPD+N  D  A+ KF +I++AY++L+D QKRA
Sbjct: 6   DYYAILEVSRTATADELKKSYRKLAMKYHPDRNPGDDAAEAKFKEINQAYDILKDEQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YDQ GH A E G    G   F  G        ++FE +FG +MG  R  +  +      
Sbjct: 66  AYDQYGHAAFEGGGPGPGGFDFSGGFGAGGL-GDIFEQMFGDVMGGRRGGRARTGN---- 120

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMD-CNICNGSGRVYTT 183
            D++ ++EI+LEEAF+G    +R  T V C +C G+G+  G + ++ C  C+G+G+V   
Sbjct: 121 -DIQTHVEITLEEAFAGVKKDVRVITRVACESCHGTGSNDGASGVEVCPSCHGAGKV-RA 178

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
            Q FF +ER C TC G+G+++ +PC  CHG+G + +E+ + V +P GV+DGTRIRLSGEG
Sbjct: 179 QQGFFVVERPCPTCHGAGKVVKNPCKVCHGEGTIEKERTVEVQIPAGVEDGTRIRLSGEG 238

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRV 303
            AG  G  PGDLYI IS+ +H  F+RDGA++YC VP+ +   A+G   +V  +D + ++V
Sbjct: 239 EAGGNGVPPGDLYIHISIDEHSIFQRDGANIYCRVPLRMAQAALGTEIEVPVIDGSRTKV 298

Query: 304 TIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQD 363
            +P GTQTG  FRL+GKG  V+ S  +GD+Y+QV VETPQ L+KRQRELLEEFE+ + +D
Sbjct: 299 KVPAGTQTGAHFRLRGKGFSVLRSTARGDMYIQVTVETPQNLSKRQRELLEEFEKEAGED 358

Query: 364 --NNPQSTGFFARMKDFFD 380
              +P+ TGFF R++DFF+
Sbjct: 359 VKQSPEHTGFFRRVRDFFE 377


>gi|331005318|ref|ZP_08328705.1| Chaperone protein DnaJ [gamma proteobacterium IMCC1989]
 gi|330420857|gb|EGG95136.1| Chaperone protein DnaJ [gamma proteobacterium IMCC1989]
          Length = 369

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 186/381 (48%), Positives = 251/381 (65%), Gaps = 13/381 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG++RN +++ LK A+R +AMK+HPD+N +D +A+EKF + SEAYE+L D 
Sbjct: 1   MSKRDYYEILGVERNISEKDLKKAYRRVAMKFHPDRNPDDKDAEEKFKEASEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH+    G   Q  GG GA      +FS++F  +FG I G     +     
Sbjct: 61  QKRAAYDQYGHD----GVNPQMGGGGGA-----HNFSDIFGDVFGDIFGGAGGGRGRGGP 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DL+Y L++ LE+A  G T +IR PT V C  C GSGAKPG+ P+ C+ C G G+V
Sbjct: 112 QRG-SDLQYTLQVDLEQAVKGTTAKIRVPTLVACKPCGGSGAKPGSKPVQCSTCGGVGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++AC TC G G II  PC+ C+GQGRV E K LSV VP GVD G RIRLS
Sbjct: 171 -RMQQGFFSVQQACPTCHGQGTIISDPCNSCNGQGRVEESKTLSVKVPEGVDTGDRIRLS 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ ISVK H  F+RDGA+LYC VP++ V   +GG  +V TLD   
Sbjct: 230 GEGEAGPAGGQAGDLYVQISVKPHDIFERDGANLYCEVPVNFVDAVLGGELEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ +P  TQTGK FRL+GKG+  +  G KGDL  +V +ETP  L+ +Q+ELL EF+  +
Sbjct: 289 VKLKVPAETQTGKLFRLRGKGVTPVRGGSKGDLMCRVVIETPVNLSNKQKELLREFQTAT 348

Query: 361 SQD-NNPQSTGFFARMKDFFD 380
             D ++P+ + +F  MK+FF+
Sbjct: 349 KADKHSPRQSSWFEGMKEFFN 369


>gi|54294922|ref|YP_127337.1| chaperone protein DnaJ (heat shock protein) [Legionella pneumophila
           str. Lens]
 gi|62899933|sp|Q5WV16|DNAJ_LEGPL RecName: Full=Chaperone protein dnaJ
 gi|53754754|emb|CAH16241.1| chaperone protein DnaJ (heat shock protein) [Legionella pneumophila
           str. Lens]
          Length = 379

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 255/388 (65%), Gaps = 15/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M++ D+Y++L + RNA+D ++K A+R LAMKYHPD+N  D  A+EKF +I +AY +L D 
Sbjct: 1   MEQRDYYELLEVSRNASDAEIKKAYRRLAMKYHPDRNPGDTSAEEKFKEIQKAYNILSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++        G  G G +G+  F ++FE IF G  G GR      S 
Sbjct: 61  QKRAAYDQFGHAGVDPSMGGGPGGFGGFGGFGDV-FEDIFENIFSGGRGQGRQ-----SR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G+ GADL++N++++LEEA  GK V+I  P    C+ C GSGAK GT+P  C  C G G+V
Sbjct: 115 GQRGADLQFNVQLTLEEAAIGKEVEITVPRHGTCTVCEGSGAKKGTSPKTCETCQGMGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C TC G G+II  PC+ CHGQGRV E K ++V +P GVD+G R+RLS
Sbjct: 175 -RIQQGFFSIQQTCPTCHGEGKIISDPCASCHGQGRVRESKKINVKIPAGVDNGDRVRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV+GG  GDLY+ IS+KKH  F+R   DL+C VPIS  T A+GG+ +V TL+   
Sbjct: 234 GEGEAGVHGGGSGDLYVQISLKKHAIFERHENDLHCEVPISFATAALGGSIEVPTLEG-- 291

Query: 301 SRVT--IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE- 357
            RVT  IP  TQTGK FRL+ KGM  +    +GDL  +V VETP  L++ Q+ELL + + 
Sbjct: 292 -RVTLKIPAETQTGKVFRLRSKGMKSVRGYGQGDLLCKVVVETPVNLSREQKELLNKLQD 350

Query: 358 --QISSQDNNPQSTGFFARMKDFFDSLK 383
             + +   ++P+++ +FA +K FF+ +K
Sbjct: 351 SLENAKGTHSPKTSSWFAGVKKFFEDMK 378


>gi|330504842|ref|YP_004381711.1| chaperone protein DnaJ [Pseudomonas mendocina NK-01]
 gi|328919128|gb|AEB59959.1| chaperone protein DnaJ [Pseudomonas mendocina NK-01]
          Length = 376

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 193/381 (50%), Positives = 250/381 (65%), Gaps = 10/381 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG++R A++ +LK A+R LAMKYHPD+N +D +A+EKF + +EAYEVL D 
Sbjct: 1   MAKRDYYEILGVERGASEAELKKAYRRLAMKYHPDRNPDDKDAEEKFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KR+ YDQ GH  ++      G        +G ++FS++F  +F    G GR        
Sbjct: 61  SKRSAYDQYGHAGVDPQMGGGGGA-----GFGGANFSDIFGDVFSDFFGGGRGGGSRGGA 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRY LE+ LEEA  G TV IR PT V C TC GSGAK GT+P+ C  C G G+V
Sbjct: 116 QRG-SDLRYTLELDLEEAVRGTTVTIRVPTLVGCKTCDGSGAKKGTSPVTCTTCGGIGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSG++I  PC  CHGQGRV E K LSV VPPGVD G RIRLS
Sbjct: 175 -RMQQGFFSVQQTCPRCHGSGKMITDPCGSCHGQGRVEESKTLSVKVPPGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ ++V++H  F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 234 GEGEAGAHGGPAGDLYVVVNVREHAIFQRDGKHLYCEVPISFADAALGGELEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGK FRL+GKG+  +  G  GDL  +V VETP  LNKRQRELLEEF +  
Sbjct: 293 VKLKIPEGTQTGKLFRLRGKGVAPVRGGAAGDLMCRVAVETPVNLNKRQRELLEEFRKSL 352

Query: 361 SQDN--NPQSTGFFARMKDFF 379
             D+  +P+++G+F  +K FF
Sbjct: 353 QGDDSHSPKASGWFEGVKRFF 373


>gi|77456991|ref|YP_346496.1| heat shock protein DnaJ [Pseudomonas fluorescens Pf0-1]
 gi|77380994|gb|ABA72507.1| chaperone protein DnaJ (HSP40) [Pseudomonas fluorescens Pf0-1]
          Length = 397

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 188/384 (48%), Positives = 244/384 (63%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N  D  +++ F + +EAYEVL D 
Sbjct: 24  MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPGDKASEDLFKEANEAYEVLSDS 83

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      GA       +G  +FS++F  +F    G       S   
Sbjct: 84  SKRAAYDQYGHAGVDPSMGGGGA------GFGGQNFSDIFGDVFSDFFGG--GRGGSRGG 135

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G++P  C  C G G+V
Sbjct: 136 AQRGSDLRYTLELNLEEAVRGTTVNIRVPTLVNCKPCDGSGAKKGSSPSTCPTCGGIGQV 195

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG GRV E K LSV VP GVD G RIRLS
Sbjct: 196 -RMQQGFFSVQQTCPRCHGQGKIISDPCDSCHGDGRVEEYKTLSVKVPAGVDTGDRIRLS 254

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS V  A+GG  ++ TLD   
Sbjct: 255 GEGEAGTQGGPTGDLYVVINVREHDIFQRDGKHLFCEVPISFVDAALGGELEIPTLDG-R 313

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFR++GKG+  +  G  GDL  +V VETP  L +RQRELLEEF    
Sbjct: 314 VKLKIPEGTQTGKQFRVRGKGVAPVRGGGAGDLMCRVAVETPVNLTRRQRELLEEFRSSL 373

Query: 361 SQDN--NPQSTGFFARMKDFFDSL 382
           + DN  +P++TG+F  +K FF  L
Sbjct: 374 ADDNSHSPKTTGWFDGVKRFFGDL 397


>gi|52842241|ref|YP_096040.1| chaperone protein DnaJ [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|54297951|ref|YP_124320.1| chaperone protein DnaJ [Legionella pneumophila str. Paris]
 gi|148359596|ref|YP_001250803.1| chaperone protein DNAJ [Legionella pneumophila str. Corby]
 gi|296107638|ref|YP_003619339.1| heat shock protein DnaJ, chaperone protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|1706465|sp|P50025|DNAJ_LEGPN RecName: Full=Chaperone protein dnaJ
 gi|62899934|sp|Q5X3M8|DNAJ_LEGPA RecName: Full=Chaperone protein dnaJ
 gi|62899938|sp|Q5ZTY4|DNAJ_LEGPH RecName: Full=Chaperone protein dnaJ
 gi|189083333|sp|A5IDK7|DNAJ_LEGPC RecName: Full=Chaperone protein dnaJ
 gi|1046215|gb|AAA80278.1| heat-shock protein [Legionella pneumophila]
 gi|52629352|gb|AAU28093.1| heat shock protein DnaJ, chaperone protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53751736|emb|CAH13158.1| chaperone protein DnaJ (heat shock protein) [Legionella pneumophila
           str. Paris]
 gi|148281369|gb|ABQ55457.1| heat shock protein DnaJ, chaperone protein [Legionella pneumophila
           str. Corby]
 gi|295649540|gb|ADG25387.1| heat shock protein DnaJ, chaperone protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|307610750|emb|CBX00357.1| chaperone protein DnaJ [Legionella pneumophila 130b]
          Length = 379

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 255/388 (65%), Gaps = 15/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M++ D+Y++L + RNA+D ++K A+R LAMKYHPD+N  D  A+EKF +I +AY +L D 
Sbjct: 1   MEQRDYYELLEVSRNASDAEIKKAYRRLAMKYHPDRNPGDTSAEEKFKEIQKAYNILSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++        G  G G +G+  F ++FE IF G  G GR      S 
Sbjct: 61  QKRAAYDQFGHAGVDPSMGGGPGGFGGFGGFGDV-FEDIFENIFSGGRGHGRQ-----SR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G+ GADL++N++++LEEA  GK V+I  P    C+ C GSGAK GT+P  C  C G G+V
Sbjct: 115 GQRGADLQFNVQLTLEEAAIGKEVEITVPRHGTCTVCEGSGAKKGTSPKTCETCQGMGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C TC G G+II  PC+ CHGQGRV E K ++V +P GVD+G R+RLS
Sbjct: 175 -RIQQGFFSIQQTCPTCHGEGKIISDPCASCHGQGRVRESKKINVKIPAGVDNGDRVRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV+GG  GDLY+ IS+KKH  F+R   DL+C VPIS  T A+GG+ +V TL+   
Sbjct: 234 GEGEAGVHGGGSGDLYVQISLKKHAIFERHENDLHCEVPISFATAALGGSIEVPTLEG-- 291

Query: 301 SRVT--IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE- 357
            RVT  IP  TQTGK FRL+ KGM  +    +GDL  +V VETP  L++ Q+ELL + + 
Sbjct: 292 -RVTLKIPAETQTGKVFRLRSKGMKSVRGYGQGDLLCKVVVETPVNLSREQKELLNKLQD 350

Query: 358 --QISSQDNNPQSTGFFARMKDFFDSLK 383
             + +   ++P+++ +FA +K FF+ +K
Sbjct: 351 SLENAKGTHSPKTSSWFAGVKKFFEDMK 378


>gi|242238034|ref|YP_002986215.1| chaperone protein DnaJ [Dickeya dadantii Ech703]
 gi|242130091|gb|ACS84393.1| chaperone protein DnaJ [Dickeya dadantii Ech703]
          Length = 377

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 248/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMKYHPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKQDYYEILGVAKGADEREIKKAYKRLAMKYHPDRNPGDKEAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G      F ++F  IFGG    GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGAGGFGGADFGDIFGDVFGDIFGG----GRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY +E++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G+G+V
Sbjct: 115 ---GADLRYTMELTLEEAVRGVTKEIRIPTLQECDACHGSGAKPGSSPVTCPTCHGNGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQTCPHCHGRGKIIKDPCTKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + V++H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPAGDLYVQVQVRQHPIFQREDNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+ RQ++LL+E ++  
Sbjct: 290 VMLKVPPETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVNLSDRQKQLLQELQESF 349

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGEGNSPRSKSFFDGVKKFFDDL 375


>gi|294085181|ref|YP_003551941.1| molecular chaperone, DnaJ family [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664756|gb|ADE39857.1| molecular chaperone, DnaJ family [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 377

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 244/383 (63%), Gaps = 13/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+ LG+ ++A ++ LK A+R LAM+ HPD+N ++  A ++F + SEAY+VL+DP
Sbjct: 1   MSKRDFYETLGVSKDADEKALKAAYRKLAMENHPDRNPDNEAAADRFREASEAYDVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDF----SELFEGIFGGIMGSGRSYKR 116
           QKRA YD+ GH A +  A     GG G    G        S++F+ +F    G GR    
Sbjct: 61  QKRAAYDRMGHAAFDNAAGGGFGGGGGGFGGGGFGGGGGFSDIFDQMFSEFSGGGRQPDT 120

Query: 117 SSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
           S      G DLRY++ ISLE+AFSG    I     V C +CSGSGA  G+ P  C  C G
Sbjct: 121 S------GNDLRYDMNISLEDAFSGVQRDISINVPVSCDSCSGSGAAEGSKPSTCGTCGG 174

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
           SGRV    Q FF++ER C+ C+G GQ+I +PC  C G GRV ++K L+V+VP GVD+GTR
Sbjct: 175 SGRVRAQ-QGFFAVERTCNACQGMGQVISNPCGTCRGDGRVQQQKTLAVSVPAGVDNGTR 233

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRL+G+G AG  GGA GDLYIFI++  H  F RDG ++   +P+ +   A+GGT DV TL
Sbjct: 234 IRLTGKGEAGSRGGAAGDLYIFININPHPIFTRDGTNVMAKIPVPMTVAALGGTIDVPTL 293

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
               +R+TI  GTQ+G++FR++GKGMP +  G  GD  V+VQ+ETP  L K+Q+ELL  F
Sbjct: 294 AGKMARLTIDAGTQSGRRFRMRGKGMPALRRGNTGDQIVEVQIETPTNLTKKQKELLTAF 353

Query: 357 EQISSQDNNPQSTGFFARMKDFF 379
            +  + + +P+ST F  R+K  +
Sbjct: 354 SK--AGETSPESTSFMERVKRIW 374


>gi|53725769|ref|YP_103884.1| chaperone protein DnaJ [Burkholderia mallei ATCC 23344]
 gi|67642150|ref|ZP_00440911.1| chaperone protein DnaJ [Burkholderia mallei GB8 horse 4]
 gi|121601315|ref|YP_991851.1| chaperone protein DnaJ [Burkholderia mallei SAVP1]
 gi|124383978|ref|YP_001027082.1| chaperone protein DnaJ [Burkholderia mallei NCTC 10229]
 gi|126448626|ref|YP_001081733.1| chaperone protein DnaJ [Burkholderia mallei NCTC 10247]
 gi|251766684|ref|ZP_04819757.1| chaperone protein DnaJ [Burkholderia mallei PRL-20]
 gi|254178988|ref|ZP_04885642.1| chaperone protein DnaJ [Burkholderia mallei ATCC 10399]
 gi|254202593|ref|ZP_04908956.1| chaperone protein DnaJ [Burkholderia mallei FMH]
 gi|254207931|ref|ZP_04914281.1| chaperone protein DnaJ [Burkholderia mallei JHU]
 gi|254355927|ref|ZP_04972205.1| chaperone protein DnaJ [Burkholderia mallei 2002721280]
 gi|62899941|sp|Q62HD6|DNAJ_BURMA RecName: Full=Chaperone protein dnaJ
 gi|189083301|sp|A3MN97|DNAJ_BURM7 RecName: Full=Chaperone protein dnaJ
 gi|189083302|sp|A2S563|DNAJ_BURM9 RecName: Full=Chaperone protein dnaJ
 gi|189083303|sp|A1V0U8|DNAJ_BURMS RecName: Full=Chaperone protein dnaJ
 gi|52429192|gb|AAU49785.1| chaperone protein DnaJ [Burkholderia mallei ATCC 23344]
 gi|121230125|gb|ABM52643.1| chaperone protein DnaJ [Burkholderia mallei SAVP1]
 gi|124291998|gb|ABN01267.1| chaperone protein DnaJ [Burkholderia mallei NCTC 10229]
 gi|126241496|gb|ABO04589.1| chaperone protein DnaJ [Burkholderia mallei NCTC 10247]
 gi|147746840|gb|EDK53917.1| chaperone protein DnaJ [Burkholderia mallei FMH]
 gi|147751825|gb|EDK58892.1| chaperone protein DnaJ [Burkholderia mallei JHU]
 gi|148024902|gb|EDK83080.1| chaperone protein DnaJ [Burkholderia mallei 2002721280]
 gi|160694902|gb|EDP84910.1| chaperone protein DnaJ [Burkholderia mallei ATCC 10399]
 gi|238523242|gb|EEP86682.1| chaperone protein DnaJ [Burkholderia mallei GB8 horse 4]
 gi|243064911|gb|EES47097.1| chaperone protein DnaJ [Burkholderia mallei PRL-20]
          Length = 376

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 247/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    +       AG  G   F++ F  IFG I G      R+   
Sbjct: 61  QKRAAYDQYGHAGVDPNVGA-------AGAQGFGGFADAFGDIFGDIFGQAAGGGRARGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWAACGVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 TV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPSGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +  T+PEGTQ+GK FRL+GKG+  ++S   GDLYV VQVETP KL  +QR+LL++FE+
Sbjct: 292 GRASFTVPEGTQSGKTFRLRGKGIKGLHSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGPRHSPQSKSWFDRVKSFFE 376


>gi|167586234|ref|ZP_02378622.1| chaperone protein DnaJ [Burkholderia ubonensis Bu]
          Length = 377

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 246/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N ++  A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKGAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++      GA        G   F++ F  IFG I G   +  R    
Sbjct: 61  QKRAAYDQYGHAGVDPNMGGAGA-------QGFGGFADAFGDIFGDIFGQAAAGGRGGRG 113

Query: 121 GEA---GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           G     GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  C+G 
Sbjct: 114 GPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCGICHGSGAKPGTKPETCPTCHGQ 173

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V   +Q FFSI++ C  C GSG  IP PC+ CHG G+V E K L V +P G+DDG RI
Sbjct: 174 GTV-RMSQGFFSIQQTCPKCHGSGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRI 232

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R +G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL 
Sbjct: 233 RSAGNGEPGINGGPPGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL- 291

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
           A  +   +PEGTQ+GK FRL+ KG+  + S   GDLYV VQVETP KL ++QR+LL++FE
Sbjct: 292 AGRATFPVPEGTQSGKTFRLRSKGIKGLRSSIAGDLYVHVQVETPVKLTEQQRDLLKQFE 351

Query: 358 QISSQ---DNNPQSTGFFARMKDFFD 380
           +  ++    ++PQS  +F R+K FF+
Sbjct: 352 KSLAEGGARHSPQSKSWFDRVKSFFE 377


>gi|322834478|ref|YP_004214505.1| chaperone protein DnaJ [Rahnella sp. Y9602]
 gi|321169679|gb|ADW75378.1| chaperone protein DnaJ [Rahnella sp. Y9602]
          Length = 377

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 254/386 (65%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ D E++ KF +I EAYE+L D 
Sbjct: 1   MAKQDYYEILGVSKTADEREIKKAYKRLAMKHHPDRNQGDKESESKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G         G +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGG----GYGGGGADFSDIFGDVFGDIFGGGRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAK G++P  C  C+G+G+V
Sbjct: 115 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKAGSSPTTCPTCHGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC+G G++I  PC+KCHG GRV   K LSV +P GVD G RIRL 
Sbjct: 172 -QMRQGFFTVQQACPTCQGRGKVIKDPCTKCHGHGRVERSKTLSVKIPAGVDTGDRIRLE 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H+ F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEHGAPSGDLYVQVQVKAHKIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
           S + IP  TQTGK FR++G+G+  +  G +GDL  +V VETP  LN++Q++LL + E+  
Sbjct: 291 S-LKIPAETQTGKMFRMRGRGVKSVRGGVQGDLMCRVVVETPVSLNEKQKQLLRDLEESF 349

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
             +S + N+P+S  F   +K FFD L
Sbjct: 350 GGVSGEKNSPRSKSFLDGVKKFFDDL 375


>gi|319763799|ref|YP_004127736.1| chaperone protein dnaj [Alicycliphilus denitrificans BC]
 gi|330823937|ref|YP_004387240.1| chaperone protein DnaJ [Alicycliphilus denitrificans K601]
 gi|317118360|gb|ADV00849.1| chaperone protein DnaJ [Alicycliphilus denitrificans BC]
 gi|329309309|gb|AEB83724.1| chaperone protein DnaJ [Alicycliphilus denitrificans K601]
          Length = 377

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 244/384 (63%), Gaps = 13/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE--AKEKFAQISEAYEVLR 58
           M K DFY+VLG+ +NA+D +LK A+R LAMK+HPD+N+ D    A+EKF +  EAYE+L 
Sbjct: 1   MSKRDFYEVLGVPKNASDDELKKAYRKLAMKHHPDRNQGDAAKPAEEKFKEAKEAYEILS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           DPQKRA YDQ GH  ++   +    G       G   F+E F  IFG + G GR  +   
Sbjct: 61  DPQKRAAYDQYGHAGVDPNMRGGMGG-----AEGFGGFAEAFGDIFGDMFGGGRGGRGGR 115

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G DL Y +EI+LEEA  GK  QIR P+   C TC GSGAKPGT+   C  CNG+G
Sbjct: 116 QVYR-GNDLSYAMEITLEEAAKGKDAQIRIPSWESCDTCHGSGAKPGTSAKTCGTCNGAG 174

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V    Q FFS+++ C  CRG+G+IIP PC+ CHGQGR+  +K L V +P G+DDG RIR
Sbjct: 175 AV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTACHGQGRIKRQKTLEVKIPAGIDDGMRIR 233

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            SG G  G  GG PGDLYI I V+KH  F+RDG DL+C VP+S +T A+GG  +V TL  
Sbjct: 234 SSGNGEPGTNGGPPGDLYIEIRVRKHDIFERDGDDLHCQVPVSFITAALGGEIEVPTLSG 293

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQ GKQFRL+GKG+  + +   GDLY  + VETP KL + QR+LL E ++
Sbjct: 294 K-AAIDIPEGTQAGKQFRLRGKGIKGVRASYPGDLYCHIVVETPVKLTEHQRKLLRELDE 352

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
              +    ++P +  +  R+K FF
Sbjct: 353 SLKKGGGKHSPSTESWTDRLKSFF 376


>gi|212212328|ref|YP_002303264.1| chaperone protein DnaJ [Coxiella burnetii CbuG_Q212]
 gi|226735555|sp|B6IZJ1|DNAJ_COXB2 RecName: Full=Chaperone protein dnaJ
 gi|212010738|gb|ACJ18119.1| chaperone protein [Coxiella burnetii CbuG_Q212]
          Length = 374

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 251/384 (65%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++RNAT+ ++K AFR LAMKYHPD+N  D +A+ KF +  EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNRNATEAEVKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYEVLCDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  +E     Q  GG GAG +G  D  ++F  IFG I G  R      + 
Sbjct: 61  RKRASYDQFGHAGVE-----QTFGGAGAGGFGFGDLGDIFGDIFGDIFGGARG---GQAR 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL Y L +SLEEA  G +  I+ PT + C TC+GSGAK G++P  C  CNGSG++
Sbjct: 113 EQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSGAK-GSSPATCPRCNGSGQM 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
                 F  +++ CS CRG GQ+I  PC+ CHGQGR  + K LSV +PPG+D G RIRL+
Sbjct: 172 -RMQHGFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQTKTLSVKIPPGIDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G  PGDLY+ + VK H  F R+G DL+  VP+   T A+GG  ++ TLD + 
Sbjct: 231 GEGEAGLFGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPMDFTTAALGGEMEIPTLDGS- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            R+TIP  TQ GKQFRL+GKG+  + SG  GDL   + VETP KL+  Q++ L++F ++ 
Sbjct: 290 VRLTIPPETQGGKQFRLRGKGVKALRSGAVGDLICHIVVETPVKLSPEQKDYLKQFAELL 349

Query: 361 SQD---NNPQSTGFFARMKDFFDS 381
            +D   ++P++  +F  +KDFF S
Sbjct: 350 KKDEKNHSPRTRNWFDSVKDFFTS 373


>gi|186477245|ref|YP_001858715.1| chaperone protein DnaJ [Burkholderia phymatum STM815]
 gi|226735548|sp|B2JGE1|DNAJ_BURP8 RecName: Full=Chaperone protein dnaJ
 gi|184193704|gb|ACC71669.1| chaperone protein DnaJ [Burkholderia phymatum STM815]
          Length = 377

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 240/383 (62%), Gaps = 9/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQVLG+ +NA+D ++K A+R LAMK+HPD+N  + +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYQVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    +    G          F ++F  IFG     GR  +     
Sbjct: 61  QKRAAYDQYGHAGVD---PNMAGAGAQGFGGFADAFGDIFGDIFGQAAAGGRGGRSGPQV 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+ V C  C GSGAKPGT P  C  CNGSG V
Sbjct: 118 YR-GADLRYSMEITLEQAAHGYDTQIRVPSWVSCEICHGSGAKPGTKPETCPTCNGSGAV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC+ CHG G+  E K L V +P G+DDG RIR +
Sbjct: 177 -RMSQGFFSIQQTCPKCHGTGTYIPEPCTHCHGAGKTKETKTLEVKIPAGIDDGMRIRSA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI     A+GG  +V TL A  
Sbjct: 236 GNGEPGINGGPSGDLYVEIHIKAHAVFERDGDDLHCQMPIPFTKAALGGEIEVPTL-AGR 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL   QR+LL++FE+  
Sbjct: 295 ATFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDAQRDLLQQFEKSL 354

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
            +    ++PQS  +F R+K FFD
Sbjct: 355 VEGGARHSPQSKSWFDRVKSFFD 377


>gi|330937932|gb|EGH41719.1| chaperone protein DnaJ [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 370

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 245/375 (65%), Gaps = 8/375 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEELFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR+       
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRAGGGGGRG 117

Query: 121 GEAG-ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
           G    +DLRY LE++LEEA  G  V IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTNVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGTQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFF 372
              D  ++P+++G+F
Sbjct: 356 LENDESHSPKASGWF 370


>gi|149190056|ref|ZP_01868333.1| DnaJ protein [Vibrio shilonii AK1]
 gi|148836086|gb|EDL53046.1| DnaJ protein [Vibrio shilonii AK1]
          Length = 379

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 257/386 (66%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+DR+A++R +K A++ LAMKYHPD+N+ D  A EKF ++ EAYE+L +P
Sbjct: 1   MSKRDFYEVLGVDRDASERDIKKAYKRLAMKYHPDRNQGDEAAAEKFKEVKEAYEILTEP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E     QG  G G      +DF ++F  +FG I G GR    S + 
Sbjct: 61  QKKAAYDQYGHAAFE-----QGGMGGGGFGGAGADFGDIFGDVFGDIFGGGRRGGGSRAQ 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYN+E+SLEEA  G + +I  PT V+C TC GSGAK G++P  C  C+G G+V
Sbjct: 116 --RGADLRYNMELSLEEAVRGISKEIEVPTLVECETCDGSGAKKGSSPQTCGTCHGHGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR+ + K L+V +P GVD G RIRLS
Sbjct: 174 -QMRQGFFAVQQTCPTCHGQGKIIKDPCNSCHGQGRIQKTKTLNVKIPAGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+R+G +LYC VP+S    A+GG  +V TLD   
Sbjct: 233 GEGEAGEHGAPAGDLYVQVHVKEHHIFEREGNNLYCEVPVSFAQAALGGEVEVPTLDGRV 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           S + +PE TQTG+ FR++GKG+  +  G  GDL V++ VETP KL+ RQ+ELL EFE+  
Sbjct: 293 S-LKVPEETQTGRMFRMRGKGVKGVRGGGVGDLIVKLVVETPVKLSSRQKELLREFEESC 351

Query: 361 SQD----NNPQSTGFFARMKDFFDSL 382
             D    + P+S GFF  +K FFD L
Sbjct: 352 GGDAANKHKPKSEGFFNGVKKFFDDL 377


>gi|315064614|gb|ADT78391.1| DnaJ [Yersinia entomophaga]
          Length = 362

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 252/372 (67%), Gaps = 16/372 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ + +A+ KF ++ EAYE+L D 
Sbjct: 1   MAKRDYYEILGVPKTADEREIKKAYKRLAMKFHPDRNQ-EQDAEGKFKEVKEAYEILTDA 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E     QG  G G G  G +DFS++F  +FG I G GR  +R+S  
Sbjct: 60  QKRAAYDQYGHAAFE-----QGGMGGGGGFGGGADFSDIFGDVFGDIFGGGRRQQRASR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN++++LEEA  G T +IR PT  +C  C GSGAKPG++P+ C  C+G+G+V
Sbjct: 114 ---GSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPITCPTCHGAGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G GQII  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 171 QMR-QGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 230 GEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
            ++ +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+++Q++LL E E+  
Sbjct: 289 VKLKVPAETQTGKLFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESF 348

Query: 359 --ISSQDNNPQS 368
              + + N+P+S
Sbjct: 349 GGAAGEKNSPRS 360


>gi|126439625|ref|YP_001060287.1| chaperone protein DnaJ [Burkholderia pseudomallei 668]
 gi|126452366|ref|YP_001067546.1| chaperone protein DnaJ [Burkholderia pseudomallei 1106a]
 gi|134280160|ref|ZP_01766871.1| chaperone protein DnaJ [Burkholderia pseudomallei 305]
 gi|167740044|ref|ZP_02412818.1| chaperone protein DnaJ [Burkholderia pseudomallei 14]
 gi|167920345|ref|ZP_02507436.1| chaperone protein DnaJ [Burkholderia pseudomallei BCC215]
 gi|237813677|ref|YP_002898128.1| chaperone protein DnaJ [Burkholderia pseudomallei MSHR346]
 gi|242316539|ref|ZP_04815555.1| chaperone protein DnaJ [Burkholderia pseudomallei 1106b]
 gi|254194930|ref|ZP_04901360.1| chaperone protein DnaJ [Burkholderia pseudomallei S13]
 gi|189083304|sp|A3NYX5|DNAJ_BURP0 RecName: Full=Chaperone protein dnaJ
 gi|189083305|sp|A3ND66|DNAJ_BURP6 RecName: Full=Chaperone protein dnaJ
 gi|126219118|gb|ABN82624.1| chaperone protein DnaJ [Burkholderia pseudomallei 668]
 gi|126226008|gb|ABN89548.1| chaperone protein DnaJ [Burkholderia pseudomallei 1106a]
 gi|134248167|gb|EBA48250.1| chaperone protein DnaJ [Burkholderia pseudomallei 305]
 gi|169651679|gb|EDS84372.1| chaperone protein DnaJ [Burkholderia pseudomallei S13]
 gi|237505563|gb|ACQ97881.1| chaperone protein DnaJ [Burkholderia pseudomallei MSHR346]
 gi|242139778|gb|EES26180.1| chaperone protein DnaJ [Burkholderia pseudomallei 1106b]
          Length = 376

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 246/385 (63%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    +       AG  G   F++ F  IFG I G      R+   
Sbjct: 61  QKRAAYDQYGHAGVDPNVGA-------AGAQGFGGFADAFGDIFGDIFGQAAGGGRARGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWAACGVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 TV-RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPSGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+
Sbjct: 292 GRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGPRHSPQSKSWFDRVKSFFE 376


>gi|56417271|ref|YP_154345.1| DNAJ protein [Anaplasma marginale str. St. Maries]
 gi|222475635|ref|YP_002564052.1| DNAJ protein (dnaJ) [Anaplasma marginale str. Florida]
 gi|255003628|ref|ZP_05278592.1| DNAJ protein (dnaJ) [Anaplasma marginale str. Puerto Rico]
 gi|255004755|ref|ZP_05279556.1| DNAJ protein (dnaJ) [Anaplasma marginale str. Virginia]
 gi|62899927|sp|Q5P9E0|DNAJ_ANAMM RecName: Full=Chaperone protein dnaJ
 gi|254777933|sp|B9KH92|DNAJ_ANAMF RecName: Full=Chaperone protein dnaJ
 gi|56388503|gb|AAV87090.1| DNAJ protein [Anaplasma marginale str. St. Maries]
 gi|222419773|gb|ACM49796.1| DNAJ protein (dnaJ) [Anaplasma marginale str. Florida]
          Length = 379

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 171/383 (44%), Positives = 255/383 (66%), Gaps = 8/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   D+Y++L + RNA+  ++K ++R +  KYHPD+N  D +A+EKF +ISEAYEVL +P
Sbjct: 1   MSGNDYYEILEVSRNASAEEIKKSYRKMVFKYHPDKNPGDKKAEEKFKKISEAYEVLSNP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YD+ GH     G    GA GF      ++DFS++F+       G G+S + SS  
Sbjct: 61  EKRAAYDRYGHSTFTSG----GASGFDFTSGFSTDFSDIFQDF--FGGGFGKSQRASSRE 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY++E+SLE+AF G  V I + T VKCS+CSG G++   N + C  CNG+G V
Sbjct: 115 HLRGSDLRYDVEVSLEDAFKGIKVPISYVTNVKCSSCSGIGSEGAVNSVKCGNCNGAGSV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T + F +IE  C+ C G G++I + C +C G GRV  E  L V VP G++ G ++R++
Sbjct: 175 -RTRKGFLTIEEVCNVCNGEGEVIKNKCRRCGGSGRVRNEVSLLVTVPKGIETGNKVRVN 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  G   GDLY++I VK+H+FF R  +DL+C+VPI +   A+GG  ++ ++D + 
Sbjct: 234 GKGEAGFRGAQEGDLYVYIRVKEHKFFTRRSSDLHCSVPIKMTIAALGGEIEMPSIDGSW 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINS-GRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
           +++ IPEGTQ+G Q R++GKGMP +NS  R+GD+YV V VETP KL K+Q +LL++FE+ 
Sbjct: 294 TKLKIPEGTQSGDQIRMRGKGMPEVNSKDRRGDMYVHVTVETPVKLTKQQVDLLKKFEEE 353

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
           SS + +P+  GFF ++KD +  +
Sbjct: 354 SSANCSPKYQGFFQKIKDIWRDI 376


>gi|251788183|ref|YP_003002904.1| chaperone protein DnaJ [Dickeya zeae Ech1591]
 gi|247536804|gb|ACT05425.1| chaperone protein DnaJ [Dickeya zeae Ech1591]
          Length = 377

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 246/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R +K A++ LAMKYHPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKQDYYEILGVAKGADERDIKKAYKRLAMKYHPDRNPGDKEAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G      F ++F  IFGG    GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGAGGFGGADFGDIFGDVFGDIFGG----GRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY +E++LEEA  G T +IR PT  +C  C GSGAKPG+N + C  C+G+G+V
Sbjct: 115 ---GSDLRYTMELTLEEAVRGVTKEIRIPTLQECDVCHGSGAKPGSNAVTCPTCHGNGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQTCPHCHGRGKIIKDPCTKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + V++H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPAGDLYVQVQVREHPIFQREDNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN RQ++LL+E ++  
Sbjct: 290 VMLKVPPETQTGKLFRMRGKGVKSVRGGVQGDLLCRVVVETPVNLNDRQKQLLQELQESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGESNSPRSKSFFDGVKKFFDDL 375


>gi|119897353|ref|YP_932566.1| chaperone protein DnaJ [Azoarcus sp. BH72]
 gi|189083294|sp|A1K4C4|DNAJ_AZOSB RecName: Full=Chaperone protein dnaJ
 gi|119669766|emb|CAL93679.1| chaperone protein DnaJ [Azoarcus sp. BH72]
          Length = 375

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 242/382 (63%), Gaps = 12/382 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R+A D ++K A+R LAMKYHPD+N +  EA+EKF +  EAYEVL D 
Sbjct: 1   MSKRDYYEVLGVNRDAGDDEIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+  YD+ GH  ++      G         G   F++ F  IFG + G        S+ 
Sbjct: 61  QKKGAYDRYGHAGVDPSMGGGGG------GQGFEGFADAFGDIFGDLFGGRGGGGGRSNV 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEISLEEA  G    IR PT  +C TC GSGAKPGT P  C  C G+G+V
Sbjct: 115 YR-GADLRYNLEISLEEAARGAEKTIRIPTVEECGTCHGSGAKPGTQPKTCPTCGGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C G+G+IIP PC  C G GRV ++K L V +P G+D+G R+R S
Sbjct: 174 -RIQQGFFSIQQTCPKCHGTGRIIPDPCGDCGGAGRVKKQKTLEVKIPAGIDEGMRLRHS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  GV GG PGDLY+ I +++H  F+RD  DL+C +PIS  T A+GG  ++ TL+   
Sbjct: 233 GHGEPGVNGGPPGDLYVEIHIRQHPVFERDHDDLHCEMPISFATAALGGEIEIPTLEGM- 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+ IP  TQ+GK FRL+GKG+  + S   GDL   V VETP  L +RQ+ELL EFE++S
Sbjct: 292 ARIKIPAETQSGKVFRLRGKGIKNVRSHTHGDLMCHVVVETPVNLTERQKELLREFEEVS 351

Query: 361 SQD---NNPQSTGFFARMKDFF 379
             D   +NP++  +  +++DFF
Sbjct: 352 KGDAERHNPKAKSWMDKVRDFF 373


>gi|258541390|ref|YP_003186823.1| chaperone protein DnaJ [Acetobacter pasteurianus IFO 3283-01]
 gi|262527540|sp|Q75WD2|DNAJ_ACEP3 RecName: Full=Chaperone protein dnaJ
 gi|256632468|dbj|BAH98443.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-01]
 gi|256635525|dbj|BAI01494.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-03]
 gi|256638580|dbj|BAI04542.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-07]
 gi|256641634|dbj|BAI07589.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-22]
 gi|256644689|dbj|BAI10637.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-26]
 gi|256647744|dbj|BAI13685.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-32]
 gi|256650797|dbj|BAI16731.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653788|dbj|BAI19715.1| heat shock protein DnaJ [Acetobacter pasteurianus IFO 3283-12]
          Length = 380

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 253/379 (66%), Gaps = 10/379 (2%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y +L + R AT  +LK ++R LAMKYHPD+N  D  A+ KF +I++AY++L+D QKRA
Sbjct: 6   DYYAILEVSRTATADELKKSYRKLAMKYHPDRNPGDDAAEAKFKEINQAYDILKDEQKRA 65

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YDQ GH A E G    G   FG G  G     ++FE +FG +MG  R  +  +      
Sbjct: 66  AYDQYGHAAFEGGGPGPGGFDFGGGFGGGGL-GDIFEQMFGDMMGGRRGGRARTGN---- 120

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMD-CNICNGSGRVYTT 183
            D++ ++EI+LEEAFSG    +R  T V C  C G+G+  G + ++ C  C+G+G+V   
Sbjct: 121 -DIQTHVEITLEEAFSGVKKDVRVITRVACEACHGTGSDDGASGVEVCPSCHGAGKV-RA 178

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
            Q FF +ER C TC G+G+++ +PC  CHG+G V +E+ + V +P GV+DGTRIRLSGEG
Sbjct: 179 QQGFFVVERPCPTCHGAGKVVKNPCKVCHGEGTVEKERTVEVQIPAGVEDGTRIRLSGEG 238

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRV 303
            AG  G  PGDLYI +SV +H  F+RDGA++YC VP+ +   A+G   +V  +D + ++V
Sbjct: 239 EAGGNGVPPGDLYIHVSVTEHGIFQRDGANIYCRVPLRMAQAALGTEIEVPVIDGSRTKV 298

Query: 304 TIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQD 363
            IP GTQTG  FRL+GKG  V+ S  +GD+Y+QV VETPQ L+KRQRELLEEFE+ + +D
Sbjct: 299 KIPAGTQTGAHFRLRGKGFSVLRSTARGDMYIQVTVETPQNLSKRQRELLEEFEKEAGED 358

Query: 364 --NNPQSTGFFARMKDFFD 380
              +P+ TGFF R++DFF+
Sbjct: 359 VKQSPEHTGFFRRVRDFFE 377


>gi|229525479|ref|ZP_04414884.1| chaperone protein DnaJ [Vibrio cholerae bv. albensis VL426]
 gi|229339060|gb|EEO04077.1| chaperone protein DnaJ [Vibrio cholerae bv. albensis VL426]
          Length = 386

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 249/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 6   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 65

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G     + S   
Sbjct: 66  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGG--GRRGSGPR 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 121 AQRGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 181 QMR-QGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 240 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 299

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 300 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 359 GGEAATKHKPKAEGFFNGVKKFFDDL 384


>gi|53720435|ref|YP_109421.1| chaperone protein DnaJ [Burkholderia pseudomallei K96243]
 gi|76812171|ref|YP_334691.1| chaperone protein DnaJ [Burkholderia pseudomallei 1710b]
 gi|167721070|ref|ZP_02404306.1| chaperone protein DnaJ [Burkholderia pseudomallei DM98]
 gi|167817260|ref|ZP_02448940.1| chaperone protein DnaJ [Burkholderia pseudomallei 91]
 gi|167825671|ref|ZP_02457142.1| chaperone protein DnaJ [Burkholderia pseudomallei 9]
 gi|167847158|ref|ZP_02472666.1| chaperone protein DnaJ [Burkholderia pseudomallei B7210]
 gi|167895740|ref|ZP_02483142.1| chaperone protein DnaJ [Burkholderia pseudomallei 7894]
 gi|167904131|ref|ZP_02491336.1| chaperone protein DnaJ [Burkholderia pseudomallei NCTC 13177]
 gi|167912391|ref|ZP_02499482.1| chaperone protein DnaJ [Burkholderia pseudomallei 112]
 gi|217420414|ref|ZP_03451919.1| chaperone protein DnaJ [Burkholderia pseudomallei 576]
 gi|226194162|ref|ZP_03789761.1| chaperone protein DnaJ [Burkholderia pseudomallei Pakistan 9]
 gi|254180762|ref|ZP_04887360.1| chaperone protein DnaJ [Burkholderia pseudomallei 1655]
 gi|254191597|ref|ZP_04898100.1| chaperone protein DnaJ [Burkholderia pseudomallei Pasteur 52237]
 gi|254260632|ref|ZP_04951686.1| chaperone protein DnaJ [Burkholderia pseudomallei 1710a]
 gi|254299149|ref|ZP_04966599.1| chaperone protein DnaJ [Burkholderia pseudomallei 406e]
 gi|62899943|sp|Q63R47|DNAJ_BURPS RecName: Full=Chaperone protein dnaJ
 gi|123598100|sp|Q3JP12|DNAJ_BURP1 RecName: Full=Chaperone protein dnaJ
 gi|52210849|emb|CAH36836.1| putative DnaJ chaperone protein [Burkholderia pseudomallei K96243]
 gi|76581624|gb|ABA51099.1| chaperone protein DnaJ [Burkholderia pseudomallei 1710b]
 gi|157809142|gb|EDO86312.1| chaperone protein DnaJ [Burkholderia pseudomallei 406e]
 gi|157939268|gb|EDO94938.1| chaperone protein DnaJ [Burkholderia pseudomallei Pasteur 52237]
 gi|184211301|gb|EDU08344.1| chaperone protein DnaJ [Burkholderia pseudomallei 1655]
 gi|217395826|gb|EEC35843.1| chaperone protein DnaJ [Burkholderia pseudomallei 576]
 gi|225933627|gb|EEH29615.1| chaperone protein DnaJ [Burkholderia pseudomallei Pakistan 9]
 gi|254219321|gb|EET08705.1| chaperone protein DnaJ [Burkholderia pseudomallei 1710a]
          Length = 376

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 245/385 (63%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    +       AG  G   F++ F  IFG I G      R+   
Sbjct: 61  QKRAAYDQYGHAGVDPNVGA-------AGAQGFGGFADAFGDIFGDIFGQAAGGGRARGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWAACGVCHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 TV-RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPSGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +  T+PEGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+
Sbjct: 292 GRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGPRHSPQSKSWFDRVKSFFE 376


>gi|85708642|ref|ZP_01039708.1| DnaJ molecular chaperone [Erythrobacter sp. NAP1]
 gi|85690176|gb|EAQ30179.1| DnaJ molecular chaperone [Erythrobacter sp. NAP1]
          Length = 380

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 246/377 (65%), Gaps = 2/377 (0%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           + D+Y +L + R+A    +K+A+R LAMK+HPD+N  + EA+ KF   +EAYE L+DPQK
Sbjct: 4   QTDYYSLLEVSRDADGSTIKSAYRKLAMKWHPDRNPGNAEAEAKFKACNEAYECLKDPQK 63

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+ GHEA   G    G  G G G  G +D  ++FE IFG   G G    +      
Sbjct: 64  RAAYDRFGHEAFTQGMNGGGGPGGGHGPDGFADIGDIFETIFGSAFGGGGMGAQRQRQ-R 122

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRY+++++L+EAF GK+ +I    +  C TC GSGA PGT+   CN+C+G G V  
Sbjct: 123 RGADLRYDMQVTLDEAFHGKSTEIEIEVSQSCDTCDGSGAAPGTSERTCNLCHGQGSVRA 182

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
             Q  F +ER C TC G GQ+I  PC  C G+GRV + + L V++PPGVD GTRIRLSG+
Sbjct: 183 K-QGLFVVERPCPTCGGRGQVIEDPCGDCRGEGRVDKAQALQVDIPPGVDTGTRIRLSGK 241

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG  G  PGDLYIF+ VK+H  F+R+G  L   VPIS  T A+GG+ D+  LD + + 
Sbjct: 242 GEAGQRGAPPGDLYIFVHVKEHPLFEREGTTLATRVPISFTTAALGGSVDIPDLDGSTNT 301

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           V IP G Q+GKQ R++G GMPV+    +GDL V+V+VETP KL+++QRE+LE+F    + 
Sbjct: 302 VDIPVGIQSGKQLRVRGAGMPVLQGRGRGDLVVEVKVETPTKLSRKQREILEQFRDTETG 361

Query: 363 DNNPQSTGFFARMKDFF 379
           +  P+S  FF+++K+ F
Sbjct: 362 EECPESRSFFSKIKEAF 378


>gi|271502103|ref|YP_003335129.1| chaperone protein DnaJ [Dickeya dadantii Ech586]
 gi|270345658|gb|ACZ78423.1| chaperone protein DnaJ [Dickeya dadantii Ech586]
          Length = 377

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 247/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R +K A++ LAMKYHPD+N  D EA+ KF ++ EAYE+L D 
Sbjct: 1   MAKQDYYEILGVAKDADERDIKKAYKRLAMKYHPDRNPGDKEAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G      F ++F  IFGG    GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGAGGFGGADFGDIFGDVFGDIFGG----GRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY +E++LEEA  G T +IR PT  +C  C GSGAKPG+N + C  C+G+G+V
Sbjct: 115 ---GSDLRYTMELTLEEAVRGVTKEIRIPTLQECDVCHGSGAKPGSNAVTCPTCHGNGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQTCPHCHGRGKIIKDPCTKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + V++H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPAGDLYVQVQVREHPIFQREDNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+ RQ++LL+E ++  
Sbjct: 290 VMLKVPAETQTGKLFRMRGKGVKSVRGGVQGDLLCRVVVETPVNLSDRQKQLLQELQESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGESNSPRSKSFFDGVKKFFDDL 375


>gi|237809000|ref|YP_002893440.1| chaperone protein DnaJ [Tolumonas auensis DSM 9187]
 gi|259645283|sp|C4L8Y4|DNAJ_TOLAT RecName: Full=Chaperone protein dnaJ
 gi|237501261|gb|ACQ93854.1| chaperone protein DnaJ [Tolumonas auensis DSM 9187]
          Length = 376

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 252/386 (65%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG++R+A +R++K A++ LAMK+HPD+N ++PE++EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEILGVERSADEREIKKAYKRLAMKFHPDRNPDNPESEEKFKEAKEAYEILSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH  ++      G         G +DF ++F  IFG I G GR  +R++  
Sbjct: 61  QKRAAYDKFGHAGVDPNQAGPGG------FGGGADFGDVFGDIFGDIFGGGRRSQRAAR- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G + +I+ PT V+C  C GSGA+ GT+   C  C+GSG+V
Sbjct: 114 ---GSDLRYNMELTLEEAVRGVSKEIKVPTLVECDECHGSGARTGTSAQTCPTCHGSGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++ +AC  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 171 QMR-QGFFAVTQACPHCHGKGKIITDPCRKCHGDGRVQKTKTLSVKIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F RDG +LYC +PIS  T A+GG   V TLD   
Sbjct: 230 GEGEAGEFGAPAGDLYVQVHVKEHPIFVRDGNNLYCEIPISFTTAALGGEVAVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + IP  TQTG+ FRL+GKG+  + SG +GDL  +  VETP KL+  Q+ELL++ E   
Sbjct: 289 VMLKIPVETQTGRMFRLRGKGVRSLRSGAEGDLLCKAVVETPVKLSDEQKELLKQLEDSL 348

Query: 361 S----QDNNPQSTGFFARMKDFFDSL 382
           +    + + P++ GFF  +K FFD L
Sbjct: 349 NGSGVKTHKPKADGFFEGVKRFFDDL 374


>gi|300721733|ref|YP_003711009.1| heat shock protein (Hsp40), co-chaperone with DnaK [Xenorhabdus
           nematophila ATCC 19061]
 gi|297628226|emb|CBJ88781.1| heat shock protein (Hsp40), co-chaperone with DnaK [Xenorhabdus
           nematophila ATCC 19061]
          Length = 375

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 190/388 (48%), Positives = 252/388 (64%), Gaps = 17/388 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A ++++K A++ LAMKYHPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEVLGVSKTADEKEIKKAYKRLAMKYHPDRNQGDKEAESKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E+G           G  G +DF ++F  +FG I G GR  +R+S  
Sbjct: 61  QKRAAYDQYGHAAFEHGGMG-------GGAGGGADFGDIFGDVFGDIFGGGRRQQRASR- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E++LEEA  G T +IR PT   C +C GSGAK GT+P  C  C G+G+V
Sbjct: 113 ---GSDLRYNMELTLEEAVRGVTKEIRIPTLESCDSCHGSGAKSGTSPETCPTCRGAGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC KCHG GRV + K LSV +P GVD G RIRL 
Sbjct: 170 -QMRQGFFAVQQPCPQCHGRGKIIKDPCGKCHGHGRVEKYKTLSVKIPAGVDTGDRIRLG 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK H  F+RDG++LYC VPI+  T A+GG  +V TLD   
Sbjct: 229 GEGEAGEHGAPAGDLYVQVQVKTHHIFERDGSNLYCEVPINFATAALGGEIEVPTLDGRV 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELL----EEF 356
           S + IP  TQT K FR+KGKG+  +  G +GDL  +V VETP KLN+ Q+EL+    E F
Sbjct: 289 S-LKIPAETQTAKLFRMKGKGVKSVRGGAQGDLLCRVVVETPVKLNEEQKELMRKLGESF 347

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSLKN 384
              S ++N+P+S  F   +K FFD L+ 
Sbjct: 348 GGKSGENNSPRSKSFLDGVKKFFDDLRK 375


>gi|60549564|gb|AAX24096.1| DnaJ [Pseudomonas putida]
          Length = 374

 Score =  348 bits (893), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 188/384 (48%), Positives = 243/384 (63%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R A +  LK A+R LAMKYHPD+N  D E++E+F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGANEGDLKKAYRRLAMKYHPDRNPGDKESEEQFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      GA       +G ++FS++F  +F    G       S   
Sbjct: 61  SKRAAYDQYGHAGVDPSMGGGGA------GFGGANFSDIFGDVFSDFFGG--GRGGSRGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT   C+ C G GA  G+ P  C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVSIRVPTLFNCNPCDGCGANKGSTPSTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIITDPCGACHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +GG  GDLY+ I+V++H+ F+RDG  LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGTHGGPTGDLYVVINVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L++RQRELLEE     
Sbjct: 291 VKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSL 350

Query: 361 SQD--NNPQSTGFFARMKDFFDSL 382
             D  ++P++ G+F  +K FF  L
Sbjct: 351 EGDSSHSPKANGWFDGVKRFFGDL 374


>gi|300690548|ref|YP_003751543.1| heat shock protein (Hsp40), co-chaperone with DnaK [Ralstonia
           solanacearum PSI07]
 gi|299077608|emb|CBJ50243.1| heat shock protein (Hsp40), co-chaperone with DnaK [Ralstonia
           solanacearum PSI07]
          Length = 380

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 243/386 (62%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA D ++K A+R LAMKYHPD+N +  EA+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVGKNAGDDEIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEMLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++         G          F ++F  IFG     GR  + +   
Sbjct: 61  DKKAAYDQYGHAGVDPNMAGGFGAGAQGFGGFAEAFGDIFGDIFGQAQQGGR--RGAGPQ 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P   +C  C G GA+PG++   C  C+G+G+V
Sbjct: 119 MYRGADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKGAEPGSSVETCPTCHGAGQV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FF++++ C  C GSG+ IP PCSKCHGQG+V  +K L V +P G+D+G RIR S
Sbjct: 179 -RVSQGFFTMQQTCPKCHGSGKYIPKPCSKCHGQGKVKSQKTLEVKIPAGIDEGMRIRSS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PIS  T AMGG  +V TL    
Sbjct: 238 GNGEPGINGGPPGDLYVEIHIKPHPVFERDGDDLHCQMPISFATAAMGGDIEVPTLGG-- 295

Query: 301 SRVT--IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
            RVT  +PEGTQ GK FRL+GKG+  + SG  GDLYV V +ETP +L + QRELL +F++
Sbjct: 296 -RVTFNVPEGTQAGKTFRLRGKGIKGVRSGYAGDLYVHVVIETPVRLTEHQRELLRQFDK 354

Query: 359 ISSQ---DNNPQSTGFFARMKDFFDS 381
              +    ++PQ   +  ++K+FF S
Sbjct: 355 SVHEGGSRHSPQEQSWLDKVKNFFSS 380


>gi|89900753|ref|YP_523224.1| chaperone protein DnaJ [Rhodoferax ferrireducens T118]
 gi|89345490|gb|ABD69693.1| Chaperone DnaJ [Rhodoferax ferrireducens T118]
          Length = 379

 Score =  348 bits (892), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 244/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE--AKEKFAQISEAYEVLR 58
           M K D+Y+VLG+ +NA+D ++K A+R  AMK+HPD+N+ D    A+EKF +  EAYE+L 
Sbjct: 1   MAKRDYYEVLGVPKNASDEEIKKAYRKHAMKHHPDRNQGDASKAAEEKFKESKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           DPQKRA YDQ GH  ++   +            G   F+E F  IFG + G  R    + 
Sbjct: 61  DPQKRAAYDQHGHAGVDPNMRGGPG------AEGYGGFAEAFGDIFGDMFGQQRGRAGAG 114

Query: 119 STGEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
              +   G+DL Y +E++LEEA  GK  QIR P+   C  C GSGAKPGT    C  C+G
Sbjct: 115 GGRQVFRGSDLSYAMEVTLEEAARGKDAQIRIPSWDACDVCHGSGAKPGTQAKTCGTCSG 174

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
           SG V    Q FFS+++ C TCRG+G++IP PC+ CHGQG++ ++K L V +P G+D G R
Sbjct: 175 SGAVQMR-QGFFSVQQTCPTCRGTGKVIPEPCTACHGQGKIKKQKTLEVKIPAGIDGGMR 233

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IR +G G  G  GG  GDLYI I +KKH  F+RDG D++C+VPISI+T ++GG  DV TL
Sbjct: 234 IRSAGNGEPGTNGGPAGDLYIEIRLKKHDIFERDGDDIHCSVPISIITASLGGEIDVPTL 293

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
               + + IPEGTQTGKQFRL+GKG+  + +   GDLY  + VETP KL++ QR+LL E 
Sbjct: 294 SGK-AAIDIPEGTQTGKQFRLRGKGIKGVRASYPGDLYCHILVETPVKLSEHQRKLLREL 352

Query: 357 EQISSQ---DNNPQSTGFFARMKDFF 379
           ++   +    ++P    +  R+K FF
Sbjct: 353 DESLKKGGSKHSPSGDSWTDRLKSFF 378


>gi|29654589|ref|NP_820281.1| chaperone protein [Coxiella burnetii RSA 493]
 gi|30581046|sp|P42381|DNAJ_COXBU RecName: Full=Chaperone protein dnaJ
 gi|29541857|gb|AAO90795.1| chaperone protein [Coxiella burnetii RSA 493]
          Length = 374

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 250/384 (65%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++ NAT+ ++K AFR LAMKYHPD+N  D +A+ KF +  EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYEVLCDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  +E     Q  GG GAG +G  D  ++F  IFG I G  R      + 
Sbjct: 61  RKRASYDQFGHAGVE-----QTFGGAGAGGFGFGDLGDIFGDIFGDIFGGARG---GQAR 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL Y L +SLEEA  G +  I+ PT + C TC+GSGAK G++P  C  CNGSG++
Sbjct: 113 EQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSGAK-GSSPATCPRCNGSGQM 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
                 F  +++ CS CRG GQ+I  PC+ CHGQGR  + K LSV +PPG+D G RIRL+
Sbjct: 172 -RMQHGFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQTKTLSVKIPPGIDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G  PGDLY+ + VK H  F R+G DL+  VPI   T A+GG  ++ TLD + 
Sbjct: 231 GEGEAGLFGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPIDFTTAALGGEMEIPTLDGS- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            R+TIP  TQ GKQFRL+GKG+  + SG  GDL   + VETP KL+  Q++ L++F ++ 
Sbjct: 290 VRLTIPPETQGGKQFRLRGKGVKALRSGAVGDLICHIVVETPVKLSPEQKDYLKQFAELL 349

Query: 361 SQD---NNPQSTGFFARMKDFFDS 381
            +D   ++P++  +F  +KDFF S
Sbjct: 350 KKDEKNHSPRTRNWFDSVKDFFTS 373


>gi|114571538|ref|YP_758218.1| chaperone protein DnaJ [Maricaulis maris MCS10]
 gi|122314926|sp|Q0AKB3|DNAJ_MARMM RecName: Full=Chaperone protein dnaJ
 gi|114342000|gb|ABI67280.1| chaperone protein DnaJ [Maricaulis maris MCS10]
          Length = 395

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 254/386 (65%), Gaps = 5/386 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+D+ A ++ LK+A+R  AMKYHPD+N  D EA+ +F  + EAY VL DP
Sbjct: 1   MSKRDFYEVLGVDKTADEKTLKSAYRKQAMKYHPDRNPGDAEAEAQFKVVGEAYSVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A E G    G  G   G  G +DF+++FE +FG     G    R    
Sbjct: 61  NKRAAYDRMGHAAFEQGGGMGGGQGPFGGGGGAADFADIFEQVFGEAFNMGGGGGRRGGR 120

Query: 121 GEAG----ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
           G+AG    +DLR+++EISLE+AF+GK   I+ PTA+ C  C G G +PGT    C  C G
Sbjct: 121 GQAGPARGSDLRFDMEISLEDAFNGKDETIKVPTAMNCERCDGQGNEPGTELETCGTCQG 180

Query: 177 SGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
           +GR+  + Q FF++E+ C  C G GQ +  PC+ C G GRV + + L+V VP GV+DGTR
Sbjct: 181 AGRIRRS-QGFFTMEQTCPQCGGRGQYVKTPCNDCDGVGRVRKTRTLNVTVPAGVEDGTR 239

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           IRL+GEG AG  GG  GDLYIFISV++H+ F+RDG +LYC  P S+V  A+G T  V T+
Sbjct: 240 IRLAGEGEAGARGGPRGDLYIFISVREHEIFERDGPNLYCRTPASMVQAALGCTIQVPTI 299

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           +   + + I EG QTGK+ R++GKGMP +  G +GD+ V++ VETP+ L  RQ+ELL+EF
Sbjct: 300 EGGKAEMKIAEGAQTGKRMRMRGKGMPRLRGGPRGDMIVELFVETPRNLCDRQKELLKEF 359

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
             +S +  NP S GFF ++K F+D +
Sbjct: 360 CDLSGEGCNPDSAGFFNKVKQFWDEV 385


>gi|325267130|ref|ZP_08133798.1| dTDP-glucose 4,6-dehydratase [Kingella denitrificans ATCC 33394]
 gi|324981368|gb|EGC17012.1| dTDP-glucose 4,6-dehydratase [Kingella denitrificans ATCC 33394]
          Length = 380

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 186/389 (47%), Positives = 250/389 (64%), Gaps = 18/389 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY++LG+ R+A+D ++K A+R LAMKYHPD+N ++ EA+EKF +I +AY+ L DP
Sbjct: 1   MSNKDFYEILGVSRSASDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEIQKAYDTLSDP 60

Query: 61  QKRALYDQGGHEALE---YGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRS 117
           QK+A YDQ GH A E   +G      G  G G  G  DF ++F  +FGG  G G     +
Sbjct: 61  QKKAAYDQYGHAAFEQGGFGGAGGAGGFGGFGGAGGFDFGDIFSQMFGG--GGG-----A 113

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 GAD++Y++EI+LEEA +G   QI  PT  +C  C GSGAKPGT    C+ C GS
Sbjct: 114 RQPNYQGADMQYSVEITLEEAAAGVKKQITIPTYAECDVCHGSGAKPGTKATTCHTCGGS 173

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V+   Q+ F I++ C TC GSG+ I  PC +CHG+GRV   K + VN+P G+DDG RI
Sbjct: 174 GTVHVR-QAIFQIQQTCPTCHGSGKEIKEPCLRCHGEGRVQTTKTVEVNIPAGIDDGQRI 232

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRD---GADLYCTVPISIVTVAMGGTFDVA 294
           RL+GEG  G++G   GDLYI +SV+ H+ F+RD     DL+C +PIS  T A+GG  +V 
Sbjct: 233 RLTGEGEPGMHGAPAGDLYIHVSVRPHKIFQRDPENPTDLHCELPISFATAALGGEVEVP 292

Query: 295 TLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLE 354
           TL+    ++ IPEGTQ GK+ R+KGKG+  +     GDLY  V VETP  L +RQ+ELL 
Sbjct: 293 TLNG-RVKLNIPEGTQNGKRLRVKGKGVKSVRGSLVGDLYCHVVVETPVNLTERQKELLV 351

Query: 355 EFEQISS---QDNNPQSTGFFARMKDFFD 380
           EFE+IS+       P+  GFF ++KD FD
Sbjct: 352 EFEKISTGLDISQTPRQKGFFDKLKDIFD 380


>gi|167625078|ref|YP_001675372.1| chaperone protein DnaJ [Shewanella halifaxensis HAW-EB4]
 gi|189083375|sp|B0TQC1|DNAJ_SHEHH RecName: Full=Chaperone protein dnaJ
 gi|167355100|gb|ABZ77713.1| chaperone protein DnaJ [Shewanella halifaxensis HAW-EB4]
          Length = 376

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 248/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R++K A++ LAMK+HPD+N  + EA+  F ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGNKEAEASFKEVKEAYEILTDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G +DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGF-------GGGADFGDVFGDVFGDIFGG--GRRGGQRQ 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK G++P  C  C+G G+V
Sbjct: 112 AARGSDLRYNLELSLEEAVRGLTKELRIPTLAACDACDGSGAKKGSSPTTCGTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+KCHG+GRV + K LSV +P GVD G RIRLS
Sbjct: 172 -QMRQGFFAVQQACPTCHGRGKIIKDPCNKCHGEGRVEKSKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG YG  PGDLY+ +SV++H  F+RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEYGAPPGDLYVQVSVREHAIFQRDGNNLYCEVPISFSKAALGGEIEVPTLDGK- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP  LN+RQ+ELL EFE   
Sbjct: 290 VNLKIPAETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEDTL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
              S+ ++P++ GFF  +K FF  L
Sbjct: 350 TGQSKKHSPKAEGFFDGVKKFFQDL 374


>gi|17547353|ref|NP_520755.1| chaperone protein [Ralstonia solanacearum GMI1000]
 gi|62900033|sp|Q8XW41|DNAJ_RALSO RecName: Full=Chaperone protein dnaJ
 gi|17429656|emb|CAD16341.1| probable chaperone protein dnaj [Ralstonia solanacearum GMI1000]
          Length = 380

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 243/386 (62%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  EA+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEMLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++         G          F ++F  IFG     GR  + +   
Sbjct: 61  DKKAAYDQYGHAGVDPNMAGGFGAGAQGFGGFAEAFGDIFGDIFGQAQQGGR--RGAGPQ 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P   +C  C G GA+PG++   C  C+G+G+V
Sbjct: 119 MYRGADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKGAEPGSSVETCPTCHGAGQV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FF++++ C  C G+G+ IP PCSKCHGQG+V  +K L V +P G+D+G RIR S
Sbjct: 179 -RVSQGFFTMQQTCPKCHGNGKYIPKPCSKCHGQGKVKSQKTLEVKIPAGIDEGMRIRSS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PIS    AMGG  +V TL    
Sbjct: 238 GNGEPGINGGPPGDLYVEIHIKAHSVFERDGDDLHCQMPISFAVAAMGGDIEVPTLGG-- 295

Query: 301 SRVT--IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
            RVT  +PEGTQ GK FRL+GKG+  + SG  GDLYV V +ETP +L + QRELL +F++
Sbjct: 296 -RVTFNVPEGTQAGKTFRLRGKGIKGVRSGYAGDLYVHVVIETPVRLTEHQRELLRQFDK 354

Query: 359 ISSQ---DNNPQSTGFFARMKDFFDS 381
              +    ++PQ   +  ++K+FF S
Sbjct: 355 SVHEGGSRHSPQEQSWLDKVKNFFSS 380


>gi|294142082|ref|YP_003558060.1| chaperone protein DnaJ [Shewanella violacea DSS12]
 gi|293328551|dbj|BAJ03282.1| chaperone protein DnaJ [Shewanella violacea DSS12]
          Length = 376

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 248/385 (64%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VL + R+A++R++K A++ LAMK+HPD+N +D  A+  F +I EAYE+L D 
Sbjct: 1   MSKRDYYEVLSVGRDASEREIKKAYKRLAMKFHPDRNPDDKTAEANFKEIKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         GN+DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGF-------GGNADFGDVFGDVFGDIFGG--GRRGGQRQ 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G   ++R P    C  C GSGAK GT+P  C  C+G G+V
Sbjct: 112 AARGSDLRYNLELSLEEAVKGLAKELRIPKLTTCDGCEGSGAKKGTSPTTCGTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+KCHG+GRV + K LSV +P GVD+G RIRLS
Sbjct: 172 -QMRQGFFAVQQACPTCYGRGKIIKDPCNKCHGEGRVEKSKTLSVKIPAGVDNGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVSVREHAIFVRDGNNLYCEVPISFGKAALGGGIEVPTLDGK- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  + S   GDL  +V +ETP KLN+ Q++LL EF++  
Sbjct: 290 VNLKIPAETQTGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVKLNEHQKDLLREFDETL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
             +S+ ++P++ GFF  +K FF  L
Sbjct: 350 SDASKKHSPKAEGFFDGVKKFFQDL 374


>gi|121595522|ref|YP_987418.1| chaperone protein DnaJ [Acidovorax sp. JS42]
 gi|189083287|sp|A1WAR7|DNAJ_ACISJ RecName: Full=Chaperone protein dnaJ
 gi|120607602|gb|ABM43342.1| chaperone protein DnaJ [Acidovorax sp. JS42]
          Length = 376

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 242/384 (63%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE--AKEKFAQISEAYEVLR 58
           M K DFY+VLG+ +NA+D ++K A+R LAMKYHPD+N+ D    A+EKF +  EAYE+L 
Sbjct: 1   MSKRDFYEVLGVPKNASDDEIKKAYRKLAMKYHPDRNQGDAAKPAEEKFKEAKEAYEILS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++   +    G       G   F+E F  IFG + G  R      
Sbjct: 61  DAQKRAAYDQYGHAGVDPNMRGGMGG-----AEGFGGFAEAFGDIFGDMFGGARGRGGRQ 115

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G DL Y +EI+LEEA  GK  QIR P+   C TC GSGAKPGT+   C  C GSG
Sbjct: 116 VY--RGNDLSYAMEITLEEAAKGKEAQIRIPSWESCETCHGSGAKPGTSAKTCGTCQGSG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V    Q FFS+++ C  CRG+G+IIP PC+ CHGQGRV ++K L V +P G+DDG RIR
Sbjct: 174 TV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTACHGQGRVKKQKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G  GG PGDLYI I +KKH  F+RDG DL+C VP+S +T A+GG  +V TL  
Sbjct: 233 STGNGEPGTNGGPPGDLYIEIRIKKHDIFERDGDDLHCQVPVSFITAALGGEIEVPTLQG 292

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQ GKQFRL+GKG+  + S   GDLY  + VETP KL + QR+LL+E ++
Sbjct: 293 K-AAIDIPEGTQAGKQFRLRGKGIKGVRSSYPGDLYCHIIVETPVKLTEHQRKLLKELDE 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
              +    ++P +  +  R+K FF
Sbjct: 352 SLKKGGAKHSPSTESWTDRLKSFF 375


>gi|197334905|ref|YP_002156824.1| chaperone protein DnaJ [Vibrio fischeri MJ11]
 gi|197316395|gb|ACH65842.1| chaperone protein DnaJ [Vibrio fischeri MJ11]
          Length = 394

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 254/386 (65%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A EKF ++  AYE+L D 
Sbjct: 16  MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDDTAAEKFKEVKVAYEILTDA 75

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR+ YDQ GH A E     QG  G G    G +DF ++F  +FG I G     +     
Sbjct: 76  QKRSAYDQYGHAAFE-----QGGMGGGGFGGGGADFGDIFGDVFGDIFGG--GRRGGQQR 128

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G   +I  PT V C  C G+GAK GT+   C+ C+G G+V
Sbjct: 129 AQRGSDLRYNMELTLEEAVRGCDKEIEVPTLVSCDPCEGTGAKKGTSSTTCSTCHGQGQV 188

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+ CHG+GRV + K L+V +P GVD G RIRLS
Sbjct: 189 -QMRQGFFAVQQACPTCHGKGKIIKDPCNSCHGEGRVHKTKTLNVKIPSGVDTGDRIRLS 247

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 248 GEGEAGEHGAPAGDLYVQVHVKEHNIFERDGNNLYCEVPVSFTMAALGGEVEVPTLDGRV 307

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + +   GDL V++ VETP KL KRQ+ELL+EF++  
Sbjct: 308 S-LKVPLETQTGRMFRMRGKGVKGVRTHSAGDLIVKLIVETPVKLTKRQKELLQEFQESF 366

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
               ++ +NP+S GF + +K+FFD L
Sbjct: 367 DGKDAKKHNPKSEGFLSGVKNFFDDL 392


>gi|330722198|gb|EGH00091.1| Chaperone protein DnaJ [gamma proteobacterium IMCC2047]
          Length = 379

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/387 (45%), Positives = 244/387 (63%), Gaps = 11/387 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A  +++K A+R LAMKYHPD+N +D  A+  F ++SEAYE+L D 
Sbjct: 1   MSKRDYYEVLGVAKGADSKEIKKAYRRLAMKYHPDRNPDDKAAEASFKEVSEAYEILSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  ++                G  +FS++F  +FG I G G   ++ S  
Sbjct: 61  EKRAAYDQFGHAGVDPNGGGGRGF-----GGGAGNFSDVFGDVFGDIFGGGGGGRQRSHV 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL Y+LE+ LE+A  G   +I+ P+ V C  C GSGA  G+ P DC  C G G+V
Sbjct: 116 -QRGADLGYSLELDLEDAVKGTQTKIKVPSMVGCGECDGSGAAKGSQPEDCPTCGGVGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G+ I +PC KCHG GRV E K LSV +PPGVD G RIRLS
Sbjct: 175 -RMQQGFFAVQQTCPRCKGQGKTIKNPCHKCHGAGRVEETKTLSVKIPPGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV+GG  GDLY+ ISV+ H+ F RDGA+LYC VPIS V  ++GG  +V TLD   
Sbjct: 234 GEGEAGVHGGPAGDLYVQISVRDHKIFTRDGANLYCEVPISFVDASLGGELEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQT K FR++GKG+  +  G  GDL  +V VETP  L   Q+ELL++F+   
Sbjct: 293 VKLKIPAETQTNKLFRIRGKGVAPVRGGATGDLLCRVYVETPVNLTSEQKELLKQFQATL 352

Query: 361 SQDNN---PQSTGFFARMKDFFDSLKN 384
             + N   P+ + +F  +K+FFD +K 
Sbjct: 353 DGEGNKQSPKKSSWFDGVKNFFDDMKT 379


>gi|30249896|ref|NP_841966.1| DnaJ molecular chaperone [Nitrosomonas europaea ATCC 19718]
 gi|6226599|sp|O06431|DNAJ_NITEU RecName: Full=Chaperone protein dnaJ
 gi|3777487|dbj|BAA33936.1| DnaJ [Nitrosomonas europaea]
 gi|30180933|emb|CAD85859.1| DnaJ molecular chaperone [Nitrosomonas europaea ATCC 19718]
          Length = 369

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 188/382 (49%), Positives = 247/382 (64%), Gaps = 18/382 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M ++D+Y+VLG+ R+A + +LK A+R LAMKYHPD+N  D +A+E+F  I EAYE+L DP
Sbjct: 1   MSQSDYYEVLGVGRDADENELKKAYRKLAMKYHPDRNAGDTKAEERFKNIKEAYEILSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  L  G    GA GF      +  FS++F  +FG + G GRS      +
Sbjct: 61  NKRAAYDQFGHAGLNGGMGGAGAQGF------SDAFSDIFSDLFG-MRGGGRS------S 107

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEI+LE+A  G   QIR P    C TC GSGAKPGT+P  C  CNG G++
Sbjct: 108 VHRGADLRYNLEITLEQAARGAETQIRIPRQEVCDTCHGSGAKPGTSPKTCPTCNGHGQI 167

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ CS C+GSG+++  PC  CHG G V  +K LSV +P GVD+G  IRL+
Sbjct: 168 -RMQQGFFSIQQTCSHCQGSGKVVSDPCGDCHGAGWVKRQKTLSVRIPAGVDEGDSIRLT 226

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLYI I +  H  F+R+G  L+C +PIS    A+GG  +V TLD  H
Sbjct: 227 GEGEAGANGGQAGDLYIVIHLASHPVFQREGNHLHCEIPISFTVAALGGEIEVPTLDG-H 285

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+ +P GTQTGK FRL+ KG+  + +   GDL   V VETP  L  RQ+ELLEEFE IS
Sbjct: 286 ARIKVPAGTQTGKIFRLRSKGITGVRNQSTGDLLCHVAVETPVDLTARQKELLEEFESIS 345

Query: 361 SQD---NNPQSTGFFARMKDFF 379
            +D   ++P++  +  + ++FF
Sbjct: 346 QKDGSRHHPRAKSWMEKAREFF 367


>gi|209695890|ref|YP_002263820.1| chaperone protein DnaJ [Aliivibrio salmonicida LFI1238]
 gi|226735537|sp|B6EKA0|DNAJ_ALISL RecName: Full=Chaperone protein dnaJ
 gi|208009843|emb|CAQ80154.1| chaperone protein DnaJ [Aliivibrio salmonicida LFI1238]
          Length = 380

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 246/386 (63%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A EKF ++  AYE+L D 
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDETAPEKFKEVKVAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G G  G        F ++F  IFGG    G+   +  S 
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGGFGGGQGDFGDIFGDVFGDIFGGGRRGGQQRAQRGS- 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                DLRYN+E++LEEA  G    I  PT   C  C G+GAK GT+   C+ C+G G+V
Sbjct: 120 -----DLRYNMELTLEEAVRGCEKDIEIPTLAACEPCDGTGAKKGTSSTTCSTCHGQGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+ CHG GRV + K L+V +P GVD G RIRLS
Sbjct: 175 -QMRQGFFAVQQACPTCHGKGKIIKDPCNSCHGDGRVQKTKTLNVKIPSGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 234 GEGEAGEHGAPAGDLYVQVHVKEHNIFDRDGNNLYCEVPVSFTMAALGGEVEVPTLDGRV 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + +   GDL V++ VETP KL KRQRELL+EF++  
Sbjct: 294 S-LKVPLETQTGRMFRMRGKGVKGVRTHSAGDLIVKLIVETPVKLTKRQRELLKEFQESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
               ++ +NP+S GF + +K+FFD L
Sbjct: 353 DGKDAKKHNPKSEGFLSGVKNFFDDL 378


>gi|156935465|ref|YP_001439381.1| chaperone protein DnaJ [Cronobacter sakazakii ATCC BAA-894]
 gi|189083323|sp|A7MIK3|DNAJ_ENTS8 RecName: Full=Chaperone protein dnaJ
 gi|156533719|gb|ABU78545.1| hypothetical protein ESA_03324 [Cronobacter sakazakii ATCC BAA-894]
          Length = 379

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 248/386 (64%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVPKTADEREIKKAYKRLAMKFHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G    +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFG--GGFGNGADFSDIFGDVFGDIFGGGRGRRASRGA 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                DLRYN+E++LEEA  G T +IR PT  +C  C GSGAKPG+ P  C  C+G+G+V
Sbjct: 119 -----DLRYNMELTLEEAVRGVTKEIRIPTLEECEVCHGSGAKPGSQPQTCPTCHGAGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+ CHG GR+ + K LSV +P GVD G RIRL+
Sbjct: 174 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNSCHGHGRIEKTKTLSVKIPAGVDTGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 233 GEGEAGEQGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN RQ+ LL+E ++  
Sbjct: 292 VMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDRQKALLQELQESF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 352 GGPTGEKNSPRSKSFFDGVKKFFDDL 377


>gi|262395058|ref|YP_003286912.1| chaperone protein DnaJ [Vibrio sp. Ex25]
 gi|262338652|gb|ACY52447.1| chaperone protein DnaJ [Vibrio sp. Ex25]
          Length = 382

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 251/386 (65%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYEVL DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEVLTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR        
Sbjct: 61  QKKAAYDQYGHAAFE---QGGGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGGHRA 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E++LEEA  G T +I  PT V C TC GSGAK G++   C  C+G G+V
Sbjct: 118 QRG-ADLRYNMELTLEEAVRGVTKEIEVPTLVHCDTCDGSGAKKGSSAETCGTCHGHGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 177 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 236 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 296 S-LKVPSETQTGRMFRMRGKGVKGVRGGGIGDLIVKLVVETPVNLSSRQKELLKEFEESC 354

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 355 GGEAATKHKPKSEGFFNGVKKFFDDL 380


>gi|34497100|ref|NP_901315.1| chaperone protein DnaJ [Chromobacterium violaceum ATCC 12472]
 gi|62899990|sp|Q7NXI1|DNAJ_CHRVO RecName: Full=Chaperone protein dnaJ
 gi|34102957|gb|AAQ59321.1| heat shock protein dnaJ; chaperone with DnaK [Chromobacterium
           violaceum ATCC 12472]
          Length = 375

 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 184/384 (47%), Positives = 245/384 (63%), Gaps = 13/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG++R+A+D  +K A+R LAMKYHPD+N +  EA++KF ++ EAYE+L D 
Sbjct: 1   MSKRDYYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPDSKEAEDKFKEVKEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSD-FSELFEGIFGGIMGSGRSYKRSSS 119
           QKR  YDQ GH  ++  A   G G    G    +D FS++F G  GG  G   +  R   
Sbjct: 61  QKRGAYDQFGHAGVDPQAGMGGGGQGFGGFGDFADIFSDIFGGGRGGSGGGRSNVYR--- 117

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               GADLRYN+EI+LEEA  G   QIR P+   CSTC+G+GAKPGT P  C  C G G+
Sbjct: 118 ----GADLRYNMEITLEEAARGCEKQIRIPSHESCSTCNGTGAKPGTQPKTCATCGGHGQ 173

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V   +Q FFSI++ C TC G+G+ I  PC  CHG G+    K L+V +P GVD+G RIRL
Sbjct: 174 V-RMSQGFFSIQQTCPTCHGTGKQITDPCGSCHGAGQKKTTKTLNVKIPAGVDEGDRIRL 232

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
            GEG  G  GG  GDLY+   +K+H  F+RDG DL+C +PIS  T A+GG  ++ TLD  
Sbjct: 233 GGEGEPGQNGGPAGDLYVVTHIKQHAVFQRDGMDLHCEMPISFSTAALGGEVEIPTLDGM 292

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            ++V I   TQ+G+ +RL+GKG+  +     GDL+  V VETP KL +RQ+ELL EFE I
Sbjct: 293 -AKVKISPETQSGRVYRLRGKGVKAVRGAEYGDLHCHVVVETPVKLTERQKELLREFEAI 351

Query: 360 SSQD---NNPQSTGFFARMKDFFD 380
           S  D   +NP+S  F  +++DFF+
Sbjct: 352 SQGDVATHNPRSKSFMDKLRDFFE 375


>gi|332968845|gb|EGK07892.1| dTDP-glucose 4,6-dehydratase [Kingella kingae ATCC 23330]
          Length = 403

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 243/386 (62%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+ LG+ ++A+D ++K A+R +AMKYHPD+N ++ EA++KF ++ +AY+ L DP
Sbjct: 24  MSKQDFYETLGVSQSASDDEIKKAYRKMAMKYHPDRNPDNKEAEDKFKEVQKAYDTLSDP 83

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E        GG G    G S F   F  IF  + G G + + +   
Sbjct: 84  QKRAAYDQYGHAAFEQAGAGGFGGGAGGFGGGFSGFGGDFGDIFSQMFGGGSARQPNYQ- 142

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+D++Y +EI+LEEA SG   QI  PT  +C  C GSGAK GT    C  C GSG V
Sbjct: 143 ---GSDVQYGVEITLEEAASGVKKQITIPTHDECDVCHGSGAKVGTKATTCRTCGGSGTV 199

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F I++ C TC GSG+ I  PC KCHG GRV   K + VN+P G+DDG RIRL+
Sbjct: 200 HVR-QAIFQIQQTCPTCHGSGKEIKEPCVKCHGSGRVKSSKTMEVNIPAGIDDGQRIRLT 258

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRD---GADLYCTVPISIVTVAMGGTFDVATLD 297
           GEG  G +G   GDLYI +SV++H+ F+RD     DL+C +PIS  T A+GG  +V TL 
Sbjct: 259 GEGEPGTHGAPAGDLYIHVSVREHKIFQRDPDAPTDLHCELPISFATAALGGEVEVPTLT 318

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               ++ IPEGTQ GK+ R+KGKG+  + S   GDLY  V VETP  L +RQ+ELL EFE
Sbjct: 319 GK-VKLNIPEGTQNGKRLRVKGKGIKSVRSSLVGDLYCHVVVETPVNLTERQKELLVEFE 377

Query: 358 QISS---QDNNPQSTGFFARMKDFFD 380
           +IS+       P+  GFF ++KD FD
Sbjct: 378 KISTGLDISQTPRQKGFFDKLKDIFD 403


>gi|241764684|ref|ZP_04762696.1| chaperone protein DnaJ [Acidovorax delafieldii 2AN]
 gi|241365854|gb|EER60503.1| chaperone protein DnaJ [Acidovorax delafieldii 2AN]
          Length = 380

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 244/384 (63%), Gaps = 10/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE--AKEKFAQISEAYEVLR 58
           M K D+Y++LG+ +NA++ ++K A+R LAMK+HPD+N+ D    A+EKF +  EAYE+L 
Sbjct: 1   MSKRDYYEILGVPKNASEEEIKKAYRKLAMKHHPDRNQGDAAKGAEEKFKEAKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++   +  G  G          F ++F  +FG   G   +  R  
Sbjct: 61  DAQKRAAYDQYGHAGVDPNMRGPGGPGAEGFGGFAEAFGDIFGDMFGQQGGRRGAGGRQV 120

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
             G   +DL Y +EI+LEEA  GK  QIR P+   C TC GSGAKPGT+   C  C+GSG
Sbjct: 121 YRG---SDLSYAMEITLEEAARGKDAQIRIPSWESCDTCHGSGAKPGTSAKTCTTCSGSG 177

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V    Q FFS+++ C  CRG+G+IIP PC+ CHGQG++ ++K L V +P G+DDG RIR
Sbjct: 178 TV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTTCHGQGKLKKQKTLEVKIPAGIDDGMRIR 236

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G  GG PGDLYI I +KKH  F+RDG DL+C VP+S +T A+GG  +V TL A
Sbjct: 237 STGNGEPGTNGGPPGDLYIEIRLKKHDIFERDGDDLHCQVPVSFITAALGGEIEVPTL-A 295

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQ GKQFRL+GKG+  + +   GDLY  + VETP KL + QR+LL E ++
Sbjct: 296 GKAAIDIPEGTQAGKQFRLRGKGIKGVRASYPGDLYCHIAVETPVKLTEHQRKLLRELDE 355

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
              +    ++P    +  R+K+FF
Sbjct: 356 SLKKGGARHSPSGESWTDRLKNFF 379


>gi|15675997|ref|NP_273124.1| dnaJ protein [Neisseria meningitidis MC58]
 gi|121633941|ref|YP_974186.1| DnaJ protein [Neisseria meningitidis FAM18]
 gi|161869078|ref|YP_001598244.1| chaperone protein dnaJ [Neisseria meningitidis 053442]
 gi|218767239|ref|YP_002341751.1| DnaJ protein [Neisseria meningitidis Z2491]
 gi|304388863|ref|ZP_07370914.1| chaperone DnaJ [Neisseria meningitidis ATCC 13091]
 gi|54036977|sp|P63969|DNAJ_NEIMB RecName: Full=Chaperone protein dnaJ
 gi|54040948|sp|P63968|DNAJ_NEIMA RecName: Full=Chaperone protein dnaJ
 gi|189083338|sp|A9LZV9|DNAJ_NEIM0 RecName: Full=Chaperone protein dnaJ
 gi|189083339|sp|A1KR91|DNAJ_NEIMF RecName: Full=Chaperone protein dnaJ
 gi|7225280|gb|AAF40528.1| dnaJ protein [Neisseria meningitidis MC58]
 gi|120865647|emb|CAM09367.1| DnaJ protein [Neisseria meningitidis FAM18]
 gi|121051247|emb|CAM07522.1| DnaJ protein [Neisseria meningitidis Z2491]
 gi|161594631|gb|ABX72291.1| Chaperone protein dnaJ [Neisseria meningitidis 053442]
 gi|304337180|gb|EFM03363.1| chaperone DnaJ [Neisseria meningitidis ATCC 13091]
 gi|316983892|gb|EFV62871.1| chaperone protein DnaJ [Neisseria meningitidis H44/76]
 gi|319411445|emb|CBY91860.1| chaperone protein DnaJ [Neisseria meningitidis WUE 2594]
 gi|325129163|gb|EGC52010.1| chaperone protein DnaJ [Neisseria meningitidis N1568]
 gi|325138750|gb|EGC61302.1| chaperone protein DnaJ [Neisseria meningitidis ES14902]
 gi|325141220|gb|EGC63719.1| chaperone protein DnaJ [Neisseria meningitidis CU385]
 gi|325197359|gb|ADY92815.1| chaperone protein DnaJ [Neisseria meningitidis G2136]
 gi|325199287|gb|ADY94742.1| chaperone protein DnaJ [Neisseria meningitidis H44/76]
          Length = 373

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|161831238|ref|YP_001597141.1| chaperone protein DnaJ [Coxiella burnetii RSA 331]
 gi|189083315|sp|A9N8H1|DNAJ_COXBR RecName: Full=Chaperone protein dnaJ
 gi|161763105|gb|ABX78747.1| chaperone protein DnaJ [Coxiella burnetii RSA 331]
          Length = 374

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 184/384 (47%), Positives = 249/384 (64%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++ NAT+ ++K AFR LAMKYHPD+N  D +A+ KF +  EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYEVLCDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  +E     Q  GG GAG +G  D  ++F  IFG I    R      + 
Sbjct: 61  RKRASYDQFGHAGVE-----QTFGGAGAGGFGFGDLGDIFGDIFGDIFSGARG---GQAR 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL Y L +SLEEA  G +  I+ PT + C TC+GSGAK G++P  C  CNGSG++
Sbjct: 113 EQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSGAK-GSSPATCPRCNGSGQM 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
                 F  +++ CS CRG GQ+I  PC+ CHGQGR  + K LSV +PPG+D G RIRL+
Sbjct: 172 -RMQHGFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQTKTLSVKIPPGIDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G  PGDLY+ + VK H  F R+G DL+  VPI   T A+GG  ++ TLD + 
Sbjct: 231 GEGEAGLFGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPIDFTTAALGGEMEIPTLDGS- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            R+TIP  TQ GKQFRL+GKG+  + SG  GDL   + VETP KL+  Q++ L++F ++ 
Sbjct: 290 VRLTIPPETQGGKQFRLRGKGVKALRSGAVGDLICHIVVETPVKLSPEQKDYLKQFAELL 349

Query: 361 SQD---NNPQSTGFFARMKDFFDS 381
            +D   ++P++  +F  +KDFF S
Sbjct: 350 KKDEKNHSPRTRNWFDSVKDFFTS 373


>gi|260773327|ref|ZP_05882243.1| chaperone protein DnaJ [Vibrio metschnikovii CIP 69.14]
 gi|260612466|gb|EEX37669.1| chaperone protein DnaJ [Vibrio metschnikovii CIP 69.14]
          Length = 382

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 247/386 (63%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N  D  A +KF ++ EAYE+L DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNPGDASAADKFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E GA   G GGF  G     D   +F  +FG I G GR    +   
Sbjct: 61  QKKAAYDQYGHRAFEQGAGGFGGGGFSGGGAEFGD---IFGDVFGDIFGGGRRGGGAPRP 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+E++LEEA  G + +I  PT V C +C GSGAK GT+   C  C+G G+V
Sbjct: 118 -QRGADLRYNMELTLEEAVRGCSKEIEIPTLVHCDSCDGSGAKKGTSAQTCGTCHGHGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRL+
Sbjct: 177 QMR-QGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 236 NEGEAGDMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDG-R 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + +PE TQTG+ FR++GKG+  +  G  GDL V++ VETP KL+ RQ+ELL E E   
Sbjct: 295 VNLKVPEETQTGRMFRMRGKGVKSVRGGAIGDLIVKLVVETPVKLSARQKELLRELEDSC 354

Query: 361 SQD----NNPQSTGFFARMKDFFDSL 382
             D    + P+S GFF  +K FFD L
Sbjct: 355 GGDAANKHKPKSEGFFNGVKKFFDDL 380


>gi|153824597|ref|ZP_01977264.1| dnaJ protein [Vibrio cholerae MZO-2]
 gi|254285535|ref|ZP_04960499.1| dnaJ protein [Vibrio cholerae AM-19226]
 gi|149741815|gb|EDM55844.1| dnaJ protein [Vibrio cholerae MZO-2]
 gi|150424397|gb|EDN16334.1| dnaJ protein [Vibrio cholerae AM-19226]
          Length = 381

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 250/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G++DF ++F  +FG I G GR      + 
Sbjct: 61  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGSADFGDIFGDVFGDIFGGGRRGGGPRAQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 118 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKAEGFFNGVKKFFDDL 379


>gi|296315135|ref|ZP_06865076.1| chaperone protein DnaJ [Neisseria polysaccharea ATCC 43768]
 gi|296837940|gb|EFH21878.1| chaperone protein DnaJ [Neisseria polysaccharea ATCC 43768]
          Length = 373

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G +G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGTHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|83719549|ref|YP_441856.1| chaperone protein DnaJ [Burkholderia thailandensis E264]
 gi|167580690|ref|ZP_02373564.1| chaperone protein DnaJ [Burkholderia thailandensis TXDOH]
 gi|167618794|ref|ZP_02387425.1| chaperone protein DnaJ [Burkholderia thailandensis Bt4]
 gi|257138025|ref|ZP_05586287.1| chaperone protein DnaJ [Burkholderia thailandensis E264]
 gi|123537469|sp|Q2SYZ3|DNAJ_BURTA RecName: Full=Chaperone protein dnaJ
 gi|83653374|gb|ABC37437.1| chaperone protein DnaJ [Burkholderia thailandensis E264]
          Length = 376

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 243/385 (63%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + GA        G   F++ F  IFG I G      R    
Sbjct: 61  QKRAAYDQYGHAGVDPNMGAAGA-------QGFGGFADAFGDIFGDIFGQAAGGGRGRGG 113

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G G
Sbjct: 114 PQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWASCGICHGSGAKPGTKPETCPTCHGQG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RIR
Sbjct: 174 TV-RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A
Sbjct: 233 SAGNGEPGINGGPSGDLYVEIHIKPHPVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-A 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             +  T+ EGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL  +QR+LL++FE+
Sbjct: 292 GRASFTVAEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDQQRDLLKQFEK 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
             ++    ++PQS  +F R+K FF+
Sbjct: 352 SLAEGGPRHSPQSKSWFDRVKSFFE 376


>gi|59712600|ref|YP_205376.1| chaperone Hsp40/DnaJ, co-chaperone with DnaK [Vibrio fischeri
           ES114]
 gi|62900140|sp|Q5E3A8|DNAJ_VIBF1 RecName: Full=Chaperone protein dnaJ
 gi|59480701|gb|AAW86488.1| chaperone Hsp40/DnaJ, co-chaperone with DnaK [Vibrio fischeri
           ES114]
          Length = 379

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 254/386 (65%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A EKF ++  AYE+L D 
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDDTAAEKFKEVKVAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR+ YDQ GH A E     QG  G G    G +DF ++F  +FG I G     +     
Sbjct: 61  QKRSAYDQYGHAAFE-----QGGMGGGGFGGGGADFGDIFGDVFGDIFGG--GRRGGQQR 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G   +I  PT V C  C G+GAK GT+   C+ C+G G+V
Sbjct: 114 AQRGSDLRYNMELTLEEAGRGCDKEIEVPTLVSCDPCEGTGAKKGTSSTTCSTCHGQGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+ CHG+GRV + K L+V +P GVD G RIRLS
Sbjct: 174 -QMRQGFFAVQQACPTCHGKGKIIKDPCNSCHGEGRVHKTKTLNVKIPSGVDTGDRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 233 GEGEAGEHGAPAGDLYVQVHVKEHNIFERDGNNLYCEVPVSFTMAALGGEVEVPTLDGRV 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + +   GDL V++ VETP KL KRQ+ELL+EF++  
Sbjct: 293 S-LKVPLETQTGRMFRMRGKGVKGVRTHSAGDLIVKLIVETPVKLTKRQKELLQEFQESF 351

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
               ++ +NP+S GF + +K+FFD L
Sbjct: 352 DGKDAKKHNPKSEGFLSGVKNFFDDL 377


>gi|126664876|ref|ZP_01735860.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Marinobacter sp. ELB17]
 gi|126631202|gb|EBA01816.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [Marinobacter sp. ELB17]
          Length = 375

 Score =  345 bits (885), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 249/387 (64%), Gaps = 17/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ R+A D+++K A+R LAMKYHPD+N +D +A  KF + SEAYE+L D 
Sbjct: 1   MAKRDYYETLGVSRDADDKEVKRAYRKLAMKYHPDRNPDDKDADNKFKEASEAYEILADA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++                GN +FS++F  +FG I             
Sbjct: 61  NKRAAYDQFGHAGVDGQGGGGFG-------GGNGNFSDIFGDVFGDIF----GGGGGRGR 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY L++ LEEA  G+TV+I  P   +C TC GSGA+ G+ P  C  C G G+V
Sbjct: 110 NTRGSDLRYTLDLDLEEAVKGRTVKITIPGHRECETCDGSGAEKGSRPEACGTCKGMGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TCRG+G++I +PCSKCHGQGRV EEK LSV VPPGVD G RIRLS
Sbjct: 170 -RMQQGFFTVQQACPTCRGAGKVIKNPCSKCHGQGRVKEEKTLSVKVPPGVDTGDRIRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G+ GG PGDLY+ ++V++H  F RDG +LYC VPISIV  A+GG  +V TLD   
Sbjct: 229 GEGEMGIEGGPPGDLYVQMAVREHSIFTRDGRNLYCEVPISIVDAALGGELEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-I 359
            ++ IP  TQTGK FRL+ KG+  +  G  GDL  +V +ETP +L KRQ+ELL EF+  +
Sbjct: 288 VKLKIPAETQTGKLFRLRNKGVAPVRGGGAGDLLCRVTIETPVRLTKRQKELLNEFQDTL 347

Query: 360 SSQDNN---PQSTGFFARMKDFFDSLK 383
            S D +   P+ T +F  +K FFD  K
Sbjct: 348 DSGDGDQHGPKKTSWFRGVKSFFDETK 374


>gi|307132652|ref|YP_003884668.1| chaperone Hsp40, co-chaperone with DnaK [Dickeya dadantii 3937]
 gi|306530181|gb|ADN00112.1| chaperone Hsp40, co-chaperone with DnaK [Dickeya dadantii 3937]
          Length = 377

 Score =  345 bits (885), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 248/386 (64%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ ++A +R++K A++ LAMKYHPD+N  D +A+ KF ++ EAYE+L D 
Sbjct: 1   MAKQDYYEILGVAKDADEREIKKAYKRLAMKYHPDRNPGDKDAEAKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G   G      F ++F  IFGG    GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGAGGFGGADFGDIFGDVFGDIFGG----GRRQRASR-- 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY +E++LEEA  G T +IR PT  +C  C GSGA+PG++ + C  C+G+G+V
Sbjct: 115 ---GSDLRYTMELTLEEAVRGVTKEIRIPTLQECDVCHGSGARPGSSAVTCPTCHGNGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFTVQQTCPHCHGRGKIIKDPCAKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + V++H  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPAGDLYVQVQVREHPIFQREDNNLYCEVPINFAMAALGGEIEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  L+ RQ++LL+E ++  
Sbjct: 290 VMLKVPAETQTGKLFRMRGKGVKSVRGGMQGDLLCRVVVETPVNLSDRQKQLLQELQESF 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 350 GGPTGESNSPRSKSFFDGVKKFFDDL 375


>gi|260596432|ref|YP_003209003.1| chaperone protein DnaJ [Cronobacter turicensis z3032]
 gi|260215609|emb|CBA27862.1| Chaperone protein dnaJ [Cronobacter turicensis z3032]
          Length = 380

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 249/386 (64%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ + A +R++K A++ LAMK+HPD+N+ D EA+ KF +I EAYE+L D 
Sbjct: 1   MAKKDYYEILGVPKTADEREIKKAYKRLAMKFHPDRNQGDKEAEAKFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G    G  G G G    +DFS++F  +FG I G GR  + S   
Sbjct: 61  QKRAAYDQYGHAAFEQGGMGGGGFG-GGGFGNGADFSDIFGDVFGDIFGGGRGRRASRGA 119

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                DLRYN+E++LEEA  G T +IR PT  +C  C G+GAKPG+ P  C  C+G+G+V
Sbjct: 120 -----DLRYNMELTLEEAVRGVTKEIRIPTLEECEVCHGNGAKPGSQPQTCPTCHGAGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C  C+G G +I  PC+ CHG GR+ + K LSV +P GVD G RIRL+
Sbjct: 175 -QMRQGFFAVQQTCPHCQGRGTLIKDPCNNCHGHGRIEKTKTLSVKIPAGVDTGDRIRLA 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+R+G +LYC VPI+    A+GG  +V TLD   
Sbjct: 234 GEGEAGEQGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-- 358
             + +P  TQTGK FR++GKG+  +  G +GDL  +V VETP  LN RQ+ LL+E ++  
Sbjct: 293 VMLKVPHETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDRQKALLQELQESF 352

Query: 359 --ISSQDNNPQSTGFFARMKDFFDSL 382
              + + N+P+S  FF  +K FFD L
Sbjct: 353 GGPTGEKNSPRSKSFFDGVKKFFDDL 378


>gi|261400012|ref|ZP_05986137.1| chaperone protein DnaJ [Neisseria lactamica ATCC 23970]
 gi|269210230|gb|EEZ76685.1| chaperone protein DnaJ [Neisseria lactamica ATCC 23970]
          Length = 373

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ + ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVAKTATDEEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYESCDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|261379151|ref|ZP_05983724.1| chaperone protein DnaJ [Neisseria cinerea ATCC 14685]
 gi|269144377|gb|EEZ70795.1| chaperone protein DnaJ [Neisseria cinerea ATCC 14685]
          Length = 373

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDEEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KCHG+GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HIQ-QAIFRMQQTCPTCHGAGKHIKDPCIKCHGEGRNKTGKAVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G +G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGEPGRHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDGK- 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++TIP+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTIPKETQTGRRMRVKGKGVKSLRSSAIGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|325203187|gb|ADY98640.1| chaperone protein DnaJ [Neisseria meningitidis M01-240355]
          Length = 373

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEVCDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|194099845|ref|YP_002002982.1| chaperone protein DnaJ [Neisseria gonorrhoeae NCCP11945]
 gi|291042713|ref|ZP_06568454.1| chaperone protein dnaJ [Neisseria gonorrhoeae DGI2]
 gi|193935135|gb|ACF30959.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           NCCP11945]
 gi|291013147|gb|EFE05113.1| chaperone protein dnaJ [Neisseria gonorrhoeae DGI2]
 gi|317165314|gb|ADV08855.1| chaperone protein DnaJ [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 381

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 9   MSNQDFYATLGVARAATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 68

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 69  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 121

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPG +P  C  C GSG V
Sbjct: 122 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGASPETCPTCKGSGTV 181

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TCRG+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 182 HIQ-QAIFRMQQTCPTCRGAGKHIKEPCVKCRGVGRNKAVKTVEVNIPAGIDDGQRIRLS 240

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 241 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 299

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 300 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 359

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 360 TGLENQTPRKKSFLDKLRDLFD 381


>gi|229505533|ref|ZP_04395043.1| chaperone protein DnaJ [Vibrio cholerae BX 330286]
 gi|229510796|ref|ZP_04400275.1| chaperone protein DnaJ [Vibrio cholerae B33]
 gi|229513039|ref|ZP_04402505.1| chaperone protein DnaJ [Vibrio cholerae TMA 21]
 gi|229517917|ref|ZP_04407361.1| chaperone protein DnaJ [Vibrio cholerae RC9]
 gi|229523339|ref|ZP_04412746.1| chaperone protein DnaJ [Vibrio cholerae TM 11079-80]
 gi|229530036|ref|ZP_04419426.1| chaperone protein DnaJ [Vibrio cholerae 12129(1)]
 gi|229608553|ref|YP_002879201.1| chaperone protein DnaJ [Vibrio cholerae MJ-1236]
 gi|229333810|gb|EEN99296.1| chaperone protein DnaJ [Vibrio cholerae 12129(1)]
 gi|229339702|gb|EEO04717.1| chaperone protein DnaJ [Vibrio cholerae TM 11079-80]
 gi|229344632|gb|EEO09606.1| chaperone protein DnaJ [Vibrio cholerae RC9]
 gi|229349932|gb|EEO14886.1| chaperone protein DnaJ [Vibrio cholerae TMA 21]
 gi|229350761|gb|EEO15702.1| chaperone protein DnaJ [Vibrio cholerae B33]
 gi|229357756|gb|EEO22673.1| chaperone protein DnaJ [Vibrio cholerae BX 330286]
 gi|229371208|gb|ACQ61631.1| chaperone protein DnaJ [Vibrio cholerae MJ-1236]
          Length = 386

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 249/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 6   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 65

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR      + 
Sbjct: 66  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQ 122

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 123 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 181 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 240 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 299

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 300 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 359 GGEAATKHKPKAEGFFNGVKKFFDDL 384


>gi|124267685|ref|YP_001021689.1| chaperone protein DnaJ [Methylibium petroleiphilum PM1]
 gi|189083336|sp|A2SIR5|DNAJ_METPP RecName: Full=Chaperone protein dnaJ
 gi|124260460|gb|ABM95454.1| putative chaperone protein [Methylibium petroleiphilum PM1]
          Length = 380

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 246/387 (63%), Gaps = 16/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND--PEAKEKFAQISEAYEVLR 58
           M K D+Y+ LG+ +NA++  +K A+R LAMK+HPD+N+ D   +A+E F +  EAYE+L 
Sbjct: 1   MAKRDYYETLGVAKNASEEDIKKAYRKLAMKHHPDRNQGDGAKKAEESFKEAKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++     +GAGG  A  YG   F+E F  IFG I G  ++ +R  
Sbjct: 61  DAQKRAAYDQYGHAGVDPNMGGRGAGGPEA--YGG--FAEAFGDIFGDIFG--QNGQRRG 114

Query: 119 STGEA---GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
             G+    G DL Y +EI+LEEA  GK  QIR P+   CSTC G+GAKPGT+   C  C+
Sbjct: 115 PGGQQVYRGNDLSYAMEITLEEAARGKDTQIRIPSWDSCSTCDGTGAKPGTSAKTCPTCS 174

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           GSG+V+   Q FFSI++ C +C G+G+IIP PC+ C+G GR+   K L V +P G+++G 
Sbjct: 175 GSGQVHLR-QGFFSIQQTCPSCHGTGKIIPEPCTACNGAGRIKSNKTLEVKIPAGINEGM 233

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR +G G  G  GG  GDLYI I +K H  F+RDG DL+CT+PI I T  +GG  +V T
Sbjct: 234 RIRSAGNGEPGTNGGPAGDLYIEIRIKAHDIFERDGDDLHCTIPIGIATATLGGAIEVPT 293

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L    + + +PEGTQ GK FRL+GKG+  + S   GDLY  V VETP KL + QR+LL E
Sbjct: 294 LGGK-AEIELPEGTQHGKTFRLRGKGIKGVRSSYPGDLYCHVAVETPIKLTEHQRKLLRE 352

Query: 356 FEQI---SSQDNNPQSTGFFARMKDFF 379
            ++      + ++P +  +  R+KD F
Sbjct: 353 LDESLKKGGERHSPNAKSWTDRVKDLF 379


>gi|309378568|emb|CBX22840.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 373

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ + ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVAKTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYESCDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKYIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|307824247|ref|ZP_07654473.1| chaperone protein DnaJ [Methylobacter tundripaludum SV96]
 gi|307734627|gb|EFO05478.1| chaperone protein DnaJ [Methylobacter tundripaludum SV96]
          Length = 376

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 250/386 (64%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP-EAKEKFAQISEAYEVLRD 59
           M K DFY++LG+DRNA+D ++K ++RS AMK+HPD+N+++P EA+ KF QI EAYEVL D
Sbjct: 1   MAKEDFYKLLGVDRNASDAEIKKSYRSKAMKHHPDRNKDNPVEAEAKFKQIKEAYEVLSD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
           P+KR+ YDQ GH  ++                     +E F  IFG I G GR  +RS+ 
Sbjct: 61  PKKRSAYDQFGHAGIDPSMGGG--------RSSGFGGAESFSDIFGDIFGGGRQQQRSNV 112

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRYNLE++LEEA  G   +IR P  V C  CSGSGAK G++P+ C+ C+G G+
Sbjct: 113 --QRGSDLRYNLELTLEEAVFGTDAKIRVPVLVACGECSGSGAKKGSSPVICSTCHGHGQ 170

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C TCRG+G+ I  PC  C+GQGRV E K LS  +P GVD G RIRL
Sbjct: 171 V-RMQQGFFSVQQTCPTCRGTGKQIKDPCGACYGQGRVQENKTLSAKIPAGVDTGDRIRL 229

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG +GG  GDLY+ + VK HQ F RDGA+LYC VPIS  T  +GG  +V TL+  
Sbjct: 230 AGEGEAGEFGGPAGDLYVQVQVKDHQIFTRDGANLYCEVPISFPTACLGGELEVPTLNGK 289

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
              + IP  TQTGK FRL+GKG+  +  G  GDL  +VQVETP  L K Q+ L+E+  + 
Sbjct: 290 -VLLKIPAETQTGKLFRLRGKGVKPVRGGPVGDLLCKVQVETPVHLTKEQKALVEQLSES 348

Query: 360 SS---QDNNPQSTGFFARMKDFFDSL 382
            S   + ++PQ + +   +K FFD L
Sbjct: 349 LSGGGKHHSPQESSWTDGVKSFFDKL 374


>gi|92115208|ref|YP_575136.1| chaperone DnaJ [Chromohalobacter salexigens DSM 3043]
 gi|122419121|sp|Q1QSX1|DNAJ_CHRSD RecName: Full=Chaperone protein dnaJ
 gi|91798298|gb|ABE60437.1| Chaperone DnaJ [Chromohalobacter salexigens DSM 3043]
          Length = 381

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 249/386 (64%), Gaps = 9/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLGI+R A  +++K A+R LA KYHPD+N +D  A EKF ++SEAYEVL D 
Sbjct: 1   MSKRDYYEVLGIERGADQKEIKKAYRRLAQKYHPDRNPDDDTAAEKFREVSEAYEVLTDE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YDQ GH  ++   Q+ G  G G    G   FS++F  +FG I G G   +R+ + 
Sbjct: 61  EKRSAYDQFGHAGVD--GQAGGGFGGGGFGGGAGGFSDIFGDVFGDIFGGG--GRRNPNA 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYNLE+ LE+A +G TV IR P  ++C  C G GA+PG+    C  C+G G+V
Sbjct: 117 PQRGSDLRYNLELDLEDAVAGTTVDIRVPRHIECEHCDGDGAEPGSTKETCPTCHGQGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G+GQ I  PC KCHG+GRV E + LSV +P GVD G RIRL+
Sbjct: 177 -RMQQGFFAVQQTCPTCHGAGQTIKVPCRKCHGEGRVRETRTLSVKIPAGVDTGDRIRLN 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG+ GG PGDLY+  ++K H  F+RDG  L C VPI+ +   +GG  +V TLD   
Sbjct: 236 NEGEAGLNGGPPGDLYVQAAIKPHPIFERDGRHLQCEVPINFIDATLGGELEVPTLDG-R 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FRLKGKG+  +  G  GDL  +V +ETP  L+  Q++LL +F+   
Sbjct: 295 VKLKIPPETQTGKMFRLKGKGVKPVRGGPPGDLLCKVVLETPVNLSDEQKDLLRQFQDSL 354

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLK 383
             S+  ++P+ T FF  +K FF+ +K
Sbjct: 355 DGSNSHHSPKKTSFFDGVKKFFEDMK 380


>gi|167837751|ref|ZP_02464634.1| chaperone protein DnaJ [Burkholderia thailandensis MSMB43]
          Length = 377

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 242/383 (63%), Gaps = 9/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +   A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKNAEEHFKEAKEAYEMLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + GA G          F ++F  IFG     G   +     
Sbjct: 61  QKRAAYDQYGHAGVD---PNMGAAGAQGFGGFADAFGDIFGDIFGQAAAGGGRGRGGPQV 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G G V
Sbjct: 118 YR-GADLRYSMEITLEQAAHGYDTQIRVPSWASCGVCHGSGAKPGTKPETCPTCHGQGTV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FFSI++ C  C G+G  IP PC+ CHG G+V E K L V +P G+DDG RIR +
Sbjct: 177 -RMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIPAGIDDGMRIRSA 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL A  
Sbjct: 236 GNGEPGINGGPSGDLYVEIHIKPHPVFERDGDDLHCQMPIPFTTAALGGEIEVPTL-AGR 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+ EGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL ++QR+LL++FE+  
Sbjct: 295 ASFTVAEGTQSGKTFRLRGKGVKGLRSSIAGDLYVHVQVETPVKLTEQQRDLLKQFEKSL 354

Query: 361 SQ---DNNPQSTGFFARMKDFFD 380
           ++    ++PQS  +F R+K FF+
Sbjct: 355 AEGGPRHSPQSKSWFDRVKSFFE 377


>gi|239997864|ref|ZP_04717788.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           35/02]
 gi|240015155|ref|ZP_04722068.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           DGI18]
 gi|240017603|ref|ZP_04724143.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           FA6140]
 gi|240081747|ref|ZP_04726290.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           FA19]
 gi|240114023|ref|ZP_04728513.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           MS11]
 gi|240116759|ref|ZP_04730821.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           PID18]
 gi|240118980|ref|ZP_04733042.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           PID1]
 gi|240122226|ref|ZP_04735188.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           PID24-1]
 gi|240124516|ref|ZP_04737472.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           PID332]
 gi|240124611|ref|ZP_04737497.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           SK-92-679]
 gi|254494781|ref|ZP_05107952.1| chaperone protein dnaJ [Neisseria gonorrhoeae 1291]
 gi|260439480|ref|ZP_05793296.1| chaperone protein DnaJ [Neisseria gonorrhoeae DGI2]
 gi|268593710|ref|ZP_06127877.1| chaperone protein dnaJ [Neisseria gonorrhoeae 35/02]
 gi|268597845|ref|ZP_06132012.1| chaperone protein dnaJ [Neisseria gonorrhoeae FA19]
 gi|268600089|ref|ZP_06134256.1| chaperone dnaJ [Neisseria gonorrhoeae MS11]
 gi|268602430|ref|ZP_06136597.1| chaperone dnaJ [Neisseria gonorrhoeae PID18]
 gi|268604694|ref|ZP_06138861.1| chaperone dnaJ [Neisseria gonorrhoeae PID1]
 gi|268683150|ref|ZP_06150012.1| chaperone dnaJ [Neisseria gonorrhoeae PID332]
 gi|268683178|ref|ZP_06150040.1| chaperone dnaJ [Neisseria gonorrhoeae SK-92-679]
 gi|226513821|gb|EEH63166.1| chaperone protein dnaJ [Neisseria gonorrhoeae 1291]
 gi|268547099|gb|EEZ42517.1| chaperone protein dnaJ [Neisseria gonorrhoeae 35/02]
 gi|268551633|gb|EEZ46652.1| chaperone protein dnaJ [Neisseria gonorrhoeae FA19]
 gi|268584220|gb|EEZ48896.1| chaperone dnaJ [Neisseria gonorrhoeae MS11]
 gi|268586561|gb|EEZ51237.1| chaperone dnaJ [Neisseria gonorrhoeae PID18]
 gi|268588825|gb|EEZ53501.1| chaperone dnaJ [Neisseria gonorrhoeae PID1]
 gi|268623434|gb|EEZ55834.1| chaperone dnaJ [Neisseria gonorrhoeae PID332]
 gi|268623462|gb|EEZ55862.1| chaperone dnaJ [Neisseria gonorrhoeae SK-92-679]
          Length = 373

 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARAATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPG +P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGASPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TCRG+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HIQ-QAIFRMQQTCPTCRGAGKHIKEPCVKCRGVGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|159154698|gb|ABW93683.1| DnaJ [Neisseria meningitidis]
 gi|254673653|emb|CBA09222.1| dnaJ protein [Neisseria meningitidis alpha275]
          Length = 373

 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGEPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|15640872|ref|NP_230503.1| dnaJ protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121585706|ref|ZP_01675501.1| dnaJ protein [Vibrio cholerae 2740-80]
 gi|121728330|ref|ZP_01681360.1| dnaJ protein [Vibrio cholerae V52]
 gi|147674389|ref|YP_001216338.1| dnaJ protein [Vibrio cholerae O395]
 gi|153802055|ref|ZP_01956641.1| dnaJ protein [Vibrio cholerae MZO-3]
 gi|153819024|ref|ZP_01971691.1| dnaJ protein [Vibrio cholerae NCTC 8457]
 gi|153823073|ref|ZP_01975740.1| dnaJ protein [Vibrio cholerae B33]
 gi|227081032|ref|YP_002809583.1| dnaJ protein [Vibrio cholerae M66-2]
 gi|254225098|ref|ZP_04918712.1| dnaJ protein [Vibrio cholerae V51]
 gi|254847994|ref|ZP_05237344.1| DnaJ family protein [Vibrio cholerae MO10]
 gi|262161212|ref|ZP_06030323.1| chaperone protein DnaJ [Vibrio cholerae INDRE 91/1]
 gi|262168716|ref|ZP_06036411.1| chaperone protein DnaJ [Vibrio cholerae RC27]
 gi|298499015|ref|ZP_07008822.1| chaperone DnaJ [Vibrio cholerae MAK 757]
 gi|12644061|sp|O34242|DNAJ_VIBCH RecName: Full=Chaperone protein dnaJ
 gi|189083392|sp|A5F362|DNAJ_VIBC3 RecName: Full=Chaperone protein dnaJ
 gi|254777980|sp|C3LTA6|DNAJ_VIBCM RecName: Full=Chaperone protein dnaJ
 gi|9655309|gb|AAF94018.1| dnaJ protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121550069|gb|EAX60085.1| dnaJ protein [Vibrio cholerae 2740-80]
 gi|121629385|gb|EAX61815.1| dnaJ protein [Vibrio cholerae V52]
 gi|124122414|gb|EAY41157.1| dnaJ protein [Vibrio cholerae MZO-3]
 gi|125622485|gb|EAZ50805.1| dnaJ protein [Vibrio cholerae V51]
 gi|126510457|gb|EAZ73051.1| dnaJ protein [Vibrio cholerae NCTC 8457]
 gi|126519399|gb|EAZ76622.1| dnaJ protein [Vibrio cholerae B33]
 gi|146316272|gb|ABQ20811.1| dnaJ protein [Vibrio cholerae O395]
 gi|227008920|gb|ACP05132.1| dnaJ protein [Vibrio cholerae M66-2]
 gi|227012676|gb|ACP08886.1| dnaJ protein [Vibrio cholerae O395]
 gi|254843699|gb|EET22113.1| DnaJ family protein [Vibrio cholerae MO10]
 gi|262022834|gb|EEY41540.1| chaperone protein DnaJ [Vibrio cholerae RC27]
 gi|262028962|gb|EEY47615.1| chaperone protein DnaJ [Vibrio cholerae INDRE 91/1]
 gi|297543348|gb|EFH79398.1| chaperone DnaJ [Vibrio cholerae MAK 757]
 gi|327483601|gb|AEA78008.1| Chaperone protein DnaJ [Vibrio cholerae LMA3894-4]
          Length = 381

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 249/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR      + 
Sbjct: 61  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 118 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKAEGFFNGVKKFFDDL 379


>gi|91225093|ref|ZP_01260315.1| DnaJ protein [Vibrio alginolyticus 12G01]
 gi|269965206|ref|ZP_06179340.1| dnaJ protein [Vibrio alginolyticus 40B]
 gi|91190036|gb|EAS76307.1| DnaJ protein [Vibrio alginolyticus 12G01]
 gi|269830192|gb|EEZ84419.1| dnaJ protein [Vibrio alginolyticus 40B]
          Length = 382

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 188/386 (48%), Positives = 251/386 (65%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYEVL DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDDSAADKFKEVKEAYEVLTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR        
Sbjct: 61  QKKAAYDQYGHAAFE---QGGGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGGHRA 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E++LEEA  G T +I  PT V C TC GSGAK G++   C  C+G G+V
Sbjct: 118 QRG-ADLRYNMELTLEEAVRGVTKEIEVPTLVHCDTCDGSGAKKGSSAETCGTCHGHGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 177 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 236 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 296 S-LKVPSETQTGRMFRMRGKGVKGVRGGGVGDLIVKLVVETPVNLSSRQKELLKEFEESC 354

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 355 GGEAATKHKPKSEGFFNGVKKFFDDL 380


>gi|313667386|ref|YP_004047670.1| chaperone DnaJ protein [Neisseria lactamica ST-640]
 gi|313004848|emb|CBN86274.1| chaperone DnaJ protein [Neisseria lactamica 020-06]
          Length = 373

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ + ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVAKTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYESCDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|300309951|ref|YP_003774043.1| molecular chaperone protein [Herbaspirillum seropedicae SmR1]
 gi|300072736|gb|ADJ62135.1| molecular chaperone protein [Herbaspirillum seropedicae SmR1]
          Length = 375

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 245/385 (63%), Gaps = 15/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ +NA+D ++K A+R LAMKYHPD+N +   A++KF ++ EAYE+L DP
Sbjct: 1   MAKRDFYEVLGLAKNASDDEIKKAYRKLAMKYHPDRNPDSKGAEDKFKEVKEAYEMLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSG--RSYKRSS 118
           QKR  YD+ GH  ++    + G  G G       D      G  GG   S   + Y+   
Sbjct: 61  QKREAYDRYGHAGVDPNMGAGGGAGAGGFADAFGDIFGDIFGGGGGRGRSAGPQVYR--- 117

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADLRYNLEI+LE+A  G    IR P+  +C TC GSGAKPGT+P+ C  C G G
Sbjct: 118 -----GADLRYNLEITLEQAAHGFDTTIRVPSWDQCDTCHGSGAKPGTSPVTCTTCGGHG 172

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FFSI++ C  C GSG+IIP PC  C G GR+   K L V +P G+DDG RIR
Sbjct: 173 QV-RMQQGFFSIQQTCPKCHGSGKIIPEPCPTCAGAGRIKRNKTLEVKIPEGIDDGMRIR 231

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            SG G  GV GG PGDLY+ I +K H  F+RDG DL+C +PIS    A+GG  +  TL+ 
Sbjct: 232 SSGNGEPGVNGGPPGDLYVEIHIKPHDVFQRDGDDLHCEMPISFAKAALGGEIEAPTLNG 291

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             S  +IPEGTQ+GK FRL+GKG+  + SG  GDL+  V VETP KL +RQ+ELL EFEQ
Sbjct: 292 KAS-FSIPEGTQSGKTFRLRGKGIKGVRSGYPGDLFCHVVVETPVKLTERQKELLREFEQ 350

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
           ++++    ++PQ+  +  ++K+FF+
Sbjct: 351 LTTEGGAKHSPQTKTWKDKVKEFFE 375


>gi|167563980|ref|ZP_02356896.1| chaperone protein DnaJ [Burkholderia oklahomensis EO147]
          Length = 377

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 244/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    +       AG  G   F++ F  IFG I G   +       
Sbjct: 61  QKRAAYDQYGHAGVDPNVGA-------AGAQGFGGFADAFGDIFGDIFGQAAAGGGRGRG 113

Query: 121 GEA---GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           G     GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G 
Sbjct: 114 GPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWASCGVCHGSGAKPGTKPETCPTCHGQ 173

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RI
Sbjct: 174 GTV-RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRI 232

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R +G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL 
Sbjct: 233 RSAGNGEPGINGGPSGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL- 291

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
           A  +  T+ EGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL ++QR+LL++FE
Sbjct: 292 AGRASFTVAEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEQQRDLLKQFE 351

Query: 358 QISSQ---DNNPQSTGFFARMKDFFD 380
           +  ++    ++PQS  +F R+K FF+
Sbjct: 352 KSLAEGGPRHSPQSKSWFDRVKSFFE 377


>gi|90022377|ref|YP_528204.1| chaperone protein DnaJ [Saccharophagus degradans 2-40]
 gi|123276486|sp|Q21H37|DNAJ_SACD2 RecName: Full=Chaperone protein dnaJ
 gi|89951977|gb|ABD81992.1| Chaperone DnaJ [Saccharophagus degradans 2-40]
          Length = 374

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 248/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++ + ++LK A+R +AMKYHPD+N +DP +++KF + SEAYEVL D 
Sbjct: 1   MSKRDYYEVLGVSKDVSPQELKKAYRKVAMKYHPDRNSDDPNSEDKFKEASEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A   G         G  +FS++F  +FG I G      R    
Sbjct: 61  QKRAAYDQYGHAGVDGNAGMGGG-------AGAGNFSDIFGDVFGDIFGG--GGGRRRGG 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY L++SLE+A  G TV+IR PT V C  C GSGAKPGT+P  C  C G G+V
Sbjct: 112 PSRGSDLRYTLDLSLEDAVKGTTVKIRVPTLVSCKPCGGSGAKPGTSPQTCTTCGGHGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  CRG G++I  PC +CHG GRV E K LSV VPPGVD G RIRL+
Sbjct: 172 -RMQQGFFSVQQTCPNCRGQGKMITDPCKECHGHGRVEETKTLSVKVPPGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ + V+ H FF+R+G +LYC VPIS+    +GG  +V TLD   
Sbjct: 231 GEGEAGADGGPAGDLYVQVDVQDHAFFQREGRNLYCEVPISLFDACLGGELEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE-QI 359
            ++ IP  TQTGK FRL+GKG+  +  G  GDL  +V +ETP  L K+Q+ELLEE +  +
Sbjct: 290 VKLKIPAETQTGKLFRLRGKGVTPVRGGAAGDLMCRVIIETPVNLTKKQKELLEELKASM 349

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
             + N+P+   +F  MK+FF  LK
Sbjct: 350 KGEKNSPKQESWFEGMKNFFGDLK 373


>gi|325133133|gb|EGC55804.1| chaperone protein DnaJ [Neisseria meningitidis M6190]
 gi|325135183|gb|EGC57808.1| chaperone protein DnaJ [Neisseria meningitidis M13399]
 gi|325205163|gb|ADZ00616.1| chaperone protein DnaJ [Neisseria meningitidis M04-240196]
          Length = 373

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ +A+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKDAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|325131104|gb|EGC53825.1| chaperone protein DnaJ [Neisseria meningitidis OX99.30304]
 gi|325137127|gb|EGC59722.1| chaperone protein DnaJ [Neisseria meningitidis M0579]
 gi|325201246|gb|ADY96700.1| chaperone protein DnaJ [Neisseria meningitidis M01-240149]
 gi|325207105|gb|ADZ02557.1| chaperone protein DnaJ [Neisseria meningitidis NZ-05/33]
          Length = 373

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDEEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYESCDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HIQ-QAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKAVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG +L+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLNLHCELPISFATAALGGELEVPTLDGK- 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIIVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|167571124|ref|ZP_02363998.1| chaperone protein DnaJ [Burkholderia oklahomensis C6786]
          Length = 377

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 244/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  +A+E F +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDG 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    + GA        G   F++ F  IFG I G   +       
Sbjct: 61  QKRAAYDQYGHAGVDPNMGAAGA-------QGFGGFADAFGDIFGDIFGQAAAGGGRGRG 113

Query: 121 GEA---GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           G     GADLRY++EI+LE+A  G   QIR P+   C  C GSGAKPGT P  C  C+G 
Sbjct: 114 GPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWASCGVCHGSGAKPGTKPETCPTCHGQ 173

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V   +Q FFSI++ C  C G+G  IP PC  CHG G+V E K L V +P G+DDG RI
Sbjct: 174 GTV-RMSQGFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKETKTLEVKIPAGIDDGMRI 232

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R +G G  G+ GG  GDLY+ I +K H  F+RDG DL+C +PI   T A+GG  +V TL 
Sbjct: 233 RSAGNGEPGINGGPSGDLYVEIHIKPHSVFERDGDDLHCQMPIPFTTAALGGEIEVPTL- 291

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
           A  +  T+ EGTQ+GK FRL+GKG+  + S   GDLYV VQVETP KL ++QR+LL++FE
Sbjct: 292 AGRASFTVAEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTEQQRDLLKQFE 351

Query: 358 QISSQ---DNNPQSTGFFARMKDFFD 380
           +  ++    ++PQS  +F R+K FF+
Sbjct: 352 KSLAEGGPRHSPQSKSWFDRVKSFFE 377


>gi|222111743|ref|YP_002554007.1| chaperone protein dnaj [Acidovorax ebreus TPSY]
 gi|254777955|sp|B9MDJ8|DNAJ_DIAST RecName: Full=Chaperone protein dnaJ
 gi|221731187|gb|ACM34007.1| chaperone protein DnaJ [Acidovorax ebreus TPSY]
          Length = 376

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 242/384 (63%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE--AKEKFAQISEAYEVLR 58
           M K DFY+VLG+ +NA+D +LK A+R LAMKYHPD+N+ D    A+EKF +  EAYE+L 
Sbjct: 1   MSKRDFYEVLGVPKNASDDELKKAYRKLAMKYHPDRNQGDAAKPAEEKFKEAKEAYEILS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++   +    G       G   F+E F  IFG + G  R      
Sbjct: 61  DAQKRAAYDQYGHAGVDPNMRGGMGG-----AEGFGGFAEAFGDIFGDMFGGARGRGGRQ 115

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G DL Y ++++LEEA  GK  QIR P+   C TC GSGAKPGT+   C  C GSG
Sbjct: 116 VY--RGNDLSYAMDVTLEEAAKGKEAQIRIPSWESCETCHGSGAKPGTSAKTCGTCQGSG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V    Q FFS+++ C  CRG+G+IIP PC+ CHGQGRV ++K L V +P G+DDG RIR
Sbjct: 174 TV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTACHGQGRVKKQKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G  GG PGDLYI I ++KH  F+RDG DL+C VP+S +T A+GG  +V TL  
Sbjct: 233 STGNGEPGTNGGPPGDLYIEIRIRKHDIFERDGDDLHCQVPVSFITAALGGEIEVPTLQG 292

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQ GKQFRL+GKG+  + +   GDLY  + VETP KL + QR+LL+E ++
Sbjct: 293 K-AAIDIPEGTQAGKQFRLRGKGIKGVRASYPGDLYCHIIVETPVKLTEHQRKLLKELDE 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
              +    ++P +  +  R+K FF
Sbjct: 352 SLKKGGAKHSPSTESWTDRLKSFF 375


>gi|254805866|ref|YP_003084087.1| putative DnaJ chaperone protein [Neisseria meningitidis alpha14]
 gi|254669408|emb|CBA08601.1| putative DnaJ chaperone protein [Neisseria meningitidis alpha14]
          Length = 373

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR +YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRTMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HI-QQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|15602605|ref|NP_245677.1| hypothetical protein PM0740 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|14916556|sp|Q9CMS2|DNAJ_PASMU RecName: Full=Chaperone protein dnaJ
 gi|12721036|gb|AAK02824.1| DnaJ [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 372

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 182/383 (47%), Positives = 242/383 (63%), Gaps = 14/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y VLG++R A ++++K A++ LAMKYHPD+ + + E +EKF +I EAYEVL D 
Sbjct: 1   MAKKDYYDVLGVERGADEKEIKRAYKKLAMKYHPDRTQGNKELEEKFKEIQEAYEVLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH A E G           G +  +DF ++F  +FG I G GR+ +R    
Sbjct: 61  QKRANYDQYGHAAFEQGGFG-------GGGFSGADFGDIFGDMFGDIFGGGRARQRVVR- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G DLRY+LEISLEEA  G T  I+  T   C +C GSGA+ G+    C+ C+G+GRV
Sbjct: 113 ---GDDLRYDLEISLEEAVRGTTKDIQINTLAHCDSCDGSGAEKGSKVETCSTCHGAGRV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF  E+ C +C GSG+ I  PC  CHG GRV ++K LSV +P GVD G ++RLS
Sbjct: 170 -RRQQGFFVTEQVCPSCHGSGKKIEKPCKSCHGDGRVHKKKNLSVKIPAGVDTGNQLRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ I V+ H  F+RDG++LYC VPIS    A+GG  +V TLD   
Sbjct: 229 GEGAAGENGAPNGDLYVVIHVRDHHIFERDGSNLYCEVPISFTMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ-I 359
            ++ IP  TQTGK FR++GKG+    S   GDL  ++ VETP KLN+ Q+ LL + E+ +
Sbjct: 288 VKLKIPAETQTGKLFRMRGKGVTSARSAYAGDLICKIIVETPVKLNEEQKALLRQLEESL 347

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
               N P+S+ FF  +K FFD+L
Sbjct: 348 EGSSNKPKSSSFFDGVKKFFDNL 370


>gi|299065806|emb|CBJ36984.1| heat shock protein (Hsp40), co-chaperone with DnaK [Ralstonia
           solanacearum CMR15]
          Length = 381

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 175/390 (44%), Positives = 241/390 (61%), Gaps = 18/390 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  EA+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEMLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFG------GIMGSGRSY 114
            K+A YDQ GH  ++         G          F ++F  IFG      G  G+G   
Sbjct: 61  DKKAAYDQYGHAGVDPNMAGGFGAGAQGFGGFAEAFGDIFGDIFGQQAQQGGRRGAGPQM 120

Query: 115 KRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNIC 174
            R       GADLRY++EI+LE+A  G   QIR P   +C  C G GA+PG++   C  C
Sbjct: 121 YR-------GADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKGAEPGSSVETCPTC 173

Query: 175 NGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDG 234
           +G+G+V   +Q FF++++ C  C GSG+ IP PC+KCHGQG+V  +K L V +P G+D+G
Sbjct: 174 HGAGQV-RVSQGFFTMQQTCPKCHGSGKYIPKPCTKCHGQGKVKSQKTLEVKIPAGIDEG 232

Query: 235 TRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVA 294
            RIR SG G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PIS    AMGG  +V 
Sbjct: 233 MRIRSSGNGEPGINGGPPGDLYVEIHIKAHSVFERDGDDLHCQMPISFAVAAMGGDIEVP 292

Query: 295 TLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLE 354
           TL    +   +PEGTQ GK FRL+GKG+  + SG  GDLYV V +ETP +L   QRELL 
Sbjct: 293 TLGGRVA-FNVPEGTQAGKTFRLRGKGIKGVRSGYAGDLYVHVVIETPVRLTDHQRELLR 351

Query: 355 EFEQISSQ---DNNPQSTGFFARMKDFFDS 381
           +F++   +    ++PQ   +  ++K+FF S
Sbjct: 352 QFDKSVHEGGSRHSPQEQSWLDKVKNFFSS 381


>gi|28871638|ref|NP_794257.1| dnaJ protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213966661|ref|ZP_03394812.1| dnaJ protein [Pseudomonas syringae pv. tomato T1]
 gi|301383171|ref|ZP_07231589.1| chaperone protein DnaJ [Pseudomonas syringae pv. tomato Max13]
 gi|302063394|ref|ZP_07254935.1| chaperone protein DnaJ [Pseudomonas syringae pv. tomato K40]
 gi|302133767|ref|ZP_07259757.1| chaperone protein DnaJ [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|62900009|sp|Q87WP1|DNAJ_PSESM RecName: Full=Chaperone protein dnaJ
 gi|28854890|gb|AAO57952.1| dnaJ protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213928511|gb|EEB62055.1| dnaJ protein [Pseudomonas syringae pv. tomato T1]
 gi|330877247|gb|EGH11396.1| chaperone protein DnaJ [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330963961|gb|EGH64221.1| chaperone protein DnaJ [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331016634|gb|EGH96690.1| chaperone protein DnaJ [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 380

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 194/385 (50%), Positives = 251/385 (65%), Gaps = 8/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++R +++  LK A+R LAMK+HPD+N +D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDKASEEMFKEANEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++    S G GG   G  G ++FS++F  +F    G GR        
Sbjct: 61  SKRAAYDQYGHAGVD---PSMGGGGGFGGGAGGANFSDIFGDVFSDFFGGGRGGGGGGRG 117

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G++P+ C  C G G+
Sbjct: 118 GAQRGSDLRYTLELNLEEAVRGTTVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQ 177

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VPPGVD G RIRL
Sbjct: 178 V-RMQQGFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEESKTLSVKVPPGVDTGDRIRL 236

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS    A+GG  +V TLD  
Sbjct: 237 SGEGEAGAQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFTDAALGGELEVPTLDG- 295

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IPEGTQTGKQFRL+GKG+  +  G  GDL  +V VETP  L+KRQRELLEEF   
Sbjct: 296 RVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLMCRVAVETPVNLSKRQRELLEEFRTS 355

Query: 360 SSQD--NNPQSTGFFARMKDFFDSL 382
              D  ++P+++G+F  +K FF  L
Sbjct: 356 LENDESHSPKASGWFEGVKRFFGDL 380


>gi|262189815|ref|ZP_06048155.1| chaperone protein DnaJ [Vibrio cholerae CT 5369-93]
 gi|262034304|gb|EEY52704.1| chaperone protein DnaJ [Vibrio cholerae CT 5369-93]
          Length = 381

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 249/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR      + 
Sbjct: 61  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 118 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCPTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKAEGFFNGVKKFFDDL 379


>gi|77362269|ref|YP_341843.1| chaperone protein dnaJ (heat shock protein J) (HSP40), co-chaperone
           with DnaK [Pseudoalteromonas haloplanktis TAC125]
 gi|123586625|sp|Q3IC07|DNAJ_PSEHT RecName: Full=Chaperone protein dnaJ
 gi|76877180|emb|CAI89397.1| Chaperone protein dnaJ (Heat shock protein J) (HSP40), co-chaperone
           with DnaK [Pseudoalteromonas haloplanktis TAC125]
          Length = 380

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 255/385 (66%), Gaps = 10/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++A++R +K A++ LAMKYHPD+   D E + KF ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVSKDASERDIKKAYKRLAMKYHPDRTSGDKELETKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YDQ GH A E   Q  G GG G    G+ DF ++F  +FG I G      R  S 
Sbjct: 61  QKRQTYDQYGHAAFE---QGGGGGGHGGFGGGHGDFGDVFGDVFGDIFGG--GGGRRQSR 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+++SLEEA  GK V+I+ PT V C  C GSGAK G+ P  C  C+G+G+V
Sbjct: 116 QQRGSDLRYNMDLSLEEAVRGKEVEIKIPTWVGCDPCDGSGAKAGSKPKTCTTCHGAGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC+G GQII +PC  CHGQGRV + K LSV +P GVD G RIRL+
Sbjct: 176 -QMRQGFFAVQQTCPTCQGQGQIISNPCDSCHGQGRVEKTKTLSVKIPAGVDTGDRIRLT 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G   GDLY+ +SV++H+ F RD  +L+C VPIS  T  +GG  +V TLD   
Sbjct: 235 GEGEAGMHGAPSGDLYVQVSVREHRIFVRDANNLHCEVPISFTTAGLGGEIEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQTGK FR++GKG+  + SG  GDL  +V +ETP  LN+RQRELLEE E+  
Sbjct: 294 AKLKIPSETQTGKMFRMRGKGVKSVRSGAIGDLICKVVIETPINLNERQRELLEELEESM 353

Query: 361 SQD---NNPQSTGFFARMKDFFDSL 382
            +D   N P+  GFF  +K FFD L
Sbjct: 354 GKDSSKNRPKEQGFFDGVKKFFDDL 378


>gi|258625215|ref|ZP_05720128.1| dnaJ protein [Vibrio mimicus VM603]
 gi|261212085|ref|ZP_05926371.1| chaperone protein DnaJ [Vibrio sp. RC341]
 gi|262165116|ref|ZP_06032853.1| chaperone protein DnaJ [Vibrio mimicus VM223]
 gi|262172124|ref|ZP_06039802.1| chaperone protein DnaJ [Vibrio mimicus MB-451]
 gi|258582505|gb|EEW07341.1| dnaJ protein [Vibrio mimicus VM603]
 gi|260838693|gb|EEX65344.1| chaperone protein DnaJ [Vibrio sp. RC341]
 gi|261893200|gb|EEY39186.1| chaperone protein DnaJ [Vibrio mimicus MB-451]
 gi|262024832|gb|EEY43500.1| chaperone protein DnaJ [Vibrio mimicus VM223]
          Length = 381

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 249/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR      + 
Sbjct: 61  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 118 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRL+
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLA 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKAEGFFNGVKKFFDDL 379


>gi|258620038|ref|ZP_05715078.1| dnaJ protein [Vibrio mimicus VM573]
 gi|258587771|gb|EEW12480.1| dnaJ protein [Vibrio mimicus VM573]
          Length = 413

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 249/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 33  MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 92

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR      + 
Sbjct: 93  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQ 149

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 150 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 207

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRL+
Sbjct: 208 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLA 266

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 267 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 326

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 327 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 385

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 386 GGEAATKHKPKAEGFFNGVKKFFDDL 411


>gi|121534802|ref|ZP_01666622.1| chaperone protein DnaJ [Thermosinus carboxydivorans Nor1]
 gi|121306597|gb|EAX47519.1| chaperone protein DnaJ [Thermosinus carboxydivorans Nor1]
          Length = 379

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 250/385 (64%), Gaps = 10/385 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP-EAKEKFAQISEAYEVLRD 59
           M K D+Y+VLG+ R AT+ ++K AFR LA KYHPD NR++P EA+EKF +I+EAYEVL D
Sbjct: 1   MSKRDYYEVLGVPRTATEEEIKKAFRKLARKYHPDVNRDNPKEAEEKFKEINEAYEVLSD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
           P++RA YDQ GH A + G  +   G  G G +G   FS++F+  FG      R      +
Sbjct: 61  PERRAQYDQFGHAAFDPGQGAGAGGFGGFGGFGAGGFSDIFDMFFGQTGFGARH-----A 115

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             E GADLRY+LEI+ EEA  G   +I+ P   +C  C GSGA PGT+P  C  C G+G+
Sbjct: 116 GPEKGADLRYDLEIAFEEAAFGVEKEIQVPRTEECPACHGSGAAPGTHPETCPQCRGTGQ 175

Query: 180 VYTTAQSFFSIE---RACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
                 + F      + C+ CRG G+I+  PC +C G+GRV  ++ + + +P GVD G+R
Sbjct: 176 QQIVQNTPFGRMVNVKTCTRCRGEGKIVRTPCKECQGRGRVRNKRTIKIKIPAGVDSGSR 235

Query: 237 IRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL 296
           +R++ EG AG+ GG PGDLY++I VK H+ F R+G+D+ C VPIS V  A+G   +V TL
Sbjct: 236 LRVAYEGEAGIRGGPPGDLYVYIFVKPHKLFTREGSDVICEVPISFVQAALGDEIEVPTL 295

Query: 297 DATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF 356
           D   S + IPEGTQ+G  FRLK KG+P +    +GD +V+++V TP+ L +RQRELL+EF
Sbjct: 296 DGKVS-LKIPEGTQSGTTFRLKDKGIPHLRGHGRGDQHVRIKVVTPKNLTERQRELLKEF 354

Query: 357 EQISSQDNNPQSTGFFARMKDFFDS 381
            ++S ++ NP+   FF ++KDF  S
Sbjct: 355 ARVSGENINPEQKSFFKKVKDFLGS 379


>gi|113969302|ref|YP_733095.1| chaperone protein DnaJ [Shewanella sp. MR-4]
 gi|114046502|ref|YP_737052.1| chaperone protein DnaJ [Shewanella sp. MR-7]
 gi|123130683|sp|Q0HLM9|DNAJ_SHESM RecName: Full=Chaperone protein dnaJ
 gi|123131679|sp|Q0HY10|DNAJ_SHESR RecName: Full=Chaperone protein dnaJ
 gi|113883986|gb|ABI38038.1| chaperone protein DnaJ [Shewanella sp. MR-4]
 gi|113887944|gb|ABI41995.1| chaperone protein DnaJ [Shewanella sp. MR-7]
          Length = 377

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 245/387 (63%), Gaps = 13/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMK+HPD+N  D  A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G  DF ++F  +FG I G     +     
Sbjct: 61  NKKAAYDQFGHAGVDPNRGGGGG------YGGAGDFGDIFGDVFGDIFGG--GRRGGQRQ 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 113 AARGSDLRYNLELSLEEAVKGLTKELRIPTLASCDVCDGSGAKKGTSATTCGTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 173 QMR-QGFFTVQQACPTCHGRGKIIKDPCTKCHGDGRVEKTKTLSVKIPAGVDTGDRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ ++V++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGEFGAPPGDLYVQVTVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN+RQ+ELL EFE   
Sbjct: 292 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEATL 350

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 351 TGESKKHSPKAEGFFDGVKKFFQDLNS 377


>gi|240129196|ref|ZP_04741857.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268687579|ref|ZP_06154441.1| chaperone dnaJ [Neisseria gonorrhoeae SK-93-1035]
 gi|268627863|gb|EEZ60263.1| chaperone dnaJ [Neisseria gonorrhoeae SK-93-1035]
          Length = 373

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPG +P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGASPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TCRG+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HIQ-QAIFRMQQTCPTCRGAGKHIKEPCVKCRGVGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS    A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFAMAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|308050600|ref|YP_003914166.1| chaperone protein DnaJ [Ferrimonas balearica DSM 9799]
 gi|307632790|gb|ADN77092.1| chaperone protein DnaJ [Ferrimonas balearica DSM 9799]
          Length = 375

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 249/385 (64%), Gaps = 15/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASERDIKKAYKRLAMKYHPDRNPGDAAAEASFKEVKEAYEILADE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++    ++G GGFG G      F ++F  IFGG  G GR   RS   
Sbjct: 61  QKRAAYDQFGHAGVD---PNRGGGGFGGGADFGDIFGDVFGDIFGGRRG-GRQQARS--- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLE++LEEA  G   +++ P+ V C TC GSGAKPGT+   C  C+G+G+V
Sbjct: 114 ---GADLRYNLELTLEEAVKGCKKELKIPSLVGCETCHGSGAKPGTSANTCGTCHGTGQV 170

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C +C G G++I  PC+ C GQGRV + K LSV +P GVD G RIRL+
Sbjct: 171 QMR-QGFFAVQQTCPSCGGRGKVITDPCTSCRGQGRVEKTKTLSVTIPAGVDTGDRIRLA 229

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + +K+H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 230 GEGEAGEMGAPAGDLYVQVHIKEHPIFVRDGNNLYCEVPISFANAALGGEIEVPTLDG-R 288

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  L +RQ+ELL E ++  
Sbjct: 289 VVLKVPAETQTGRMFRLRGKGVKSVRSHAVGDLVCKVIIETPVNLTERQKELLRELDETC 348

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
             S++ + P++ GFF  +K FFD L
Sbjct: 349 AASAKRHKPKAEGFFDGVKKFFDDL 373


>gi|127513771|ref|YP_001094968.1| chaperone protein DnaJ [Shewanella loihica PV-4]
 gi|189083376|sp|A3QGW1|DNAJ_SHELP RecName: Full=Chaperone protein dnaJ
 gi|126639066|gb|ABO24709.1| chaperone protein DnaJ [Shewanella loihica PV-4]
          Length = 376

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 247/387 (63%), Gaps = 14/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMK+HPD+N  D  A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G +DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGF-------GGGADFGDVFGDVFGDIFGG--GRRGGQRQ 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK G++P  C  C+G G+V
Sbjct: 112 AARGSDLRYNLELSLEEAVRGLTKELRIPTLATCDLCDGSGAKKGSSPTTCGTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC KCHG+GRV + K LSV +P GVD G RIRLS
Sbjct: 172 -QMRQGFFAVQQACPTCHGRGKIIKDPCGKCHGEGRVEKSKTLSVKIPAGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ ++V++H  F RDG +LYC VPIS  T A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVTVREHAIFVRDGNNLYCEVPISFSTAALGGEIEVPTLDG-K 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN +Q+ELL EF+   
Sbjct: 290 VNLKIPSETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNDKQKELLREFDNTL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
             SS+ ++P++ GFF  +K FF  L +
Sbjct: 350 TGSSKKHSPKAEGFFDGVKKFFQDLNS 376


>gi|262402791|ref|ZP_06079352.1| chaperone protein DnaJ [Vibrio sp. RC586]
 gi|262351573|gb|EEZ00706.1| chaperone protein DnaJ [Vibrio sp. RC586]
          Length = 377

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 245/386 (63%), Gaps = 15/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G G      F ++F  IFGG    G    +  S 
Sbjct: 61  QKKAAYDQYGHAAFE---QGAGGFGGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQRGS- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                DLRYN+E+SLEEA  G + +I  PT V C +C GSGAK GT+   C  C+G G+V
Sbjct: 117 -----DLRYNMELSLEEAVRGCSKEIEVPTLVHCDSCDGSGAKKGTSAQTCGTCHGHGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRL+
Sbjct: 172 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 231 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 291 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 349

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 350 GGEAATKHKPKAEGFFNGVKKFFDDL 375


>gi|21672435|ref|NP_660502.1| DnaJ protein [Buchnera aphidicola str. Sg (Schizaphis graminum)]
 gi|25008384|sp|Q8K9Y9|DNAJ_BUCAP RecName: Full=Chaperone protein dnaJ
 gi|21623047|gb|AAM67713.1| DNAJ protein [Buchnera aphidicola str. Sg (Schizaphis graminum)]
          Length = 378

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 173/386 (44%), Positives = 239/386 (61%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+YQ+LGI ++A +R++K A++ LAMKYHPD+N+ D  A+ KF +I EAYE+L + 
Sbjct: 1   MAKKDYYQILGIPKSAEEREIKKAYKRLAMKYHPDRNQGDKNAENKFKEIKEAYEILINE 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR  YDQ GH A E G          +    ++DF ++F  +FG I G  R+ +     
Sbjct: 61  EKRTAYDQYGHAAFENGYNQNNTY---STFTSSTDFGDIFGDVFGDIFGGSRNQRV---- 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL YN+EISLEEA  G T +IR PT  KC TC G G   GT P  C+ C+G G++
Sbjct: 114 -KKGADLCYNMEISLEEAVKGTTKEIRIPTFQKCKTCYGMGTSTGTKPNGCSTCHGKGQI 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   + FF+++++C TC G G +I +PC  C GQGR+   K LSV +PPG+D   +IRLS
Sbjct: 173 HI-RKGFFTVQQSCPTCNGIGTVIKNPCRMCRGQGRIKTNKTLSVKIPPGIDTNDKIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G  PGDLY+ + V KH  F+R+  +LYC VPI+    A+GG  +V TLD   
Sbjct: 232 KEGEAGTNGAQPGDLYVQMKVNKHPIFEREENNLYCEVPINFTMAALGGEIEVPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
             + IP  TQ+GK FR++GKG+  + S  +GDL  +V VETP  LN++Q+ LL E    F
Sbjct: 291 VNLKIPSETQSGKLFRIRGKGVKSVQSRSRGDLLCRVVVETPVNLNEKQKYLLSELGNSF 350

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
                  N+P+S  FF  +K FFD L
Sbjct: 351 NGFRGDKNSPRSKRFFDGVKRFFDDL 376


>gi|59802216|ref|YP_208928.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           FA 1090]
 gi|62899919|sp|Q5F5M1|DNAJ_NEIG1 RecName: Full=Chaperone protein dnaJ
 gi|59719111|gb|AAW90516.1| putative heat shock protein/chaperone DnaJ [Neisseria gonorrhoeae
           FA 1090]
          Length = 373

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARAATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPG +P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGASPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TCRG+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HIQ-QAIFRMQQTCPTCRGAGKHIKEPCVKCRGVGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS    A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFAMAALGGELEVPTLDG-K 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|308388281|gb|ADO30601.1| DnaJ protein [Neisseria meningitidis alpha710]
          Length = 393

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 245/382 (64%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 21  MSNQDFYATLGVARTATDEEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 80

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 81  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 133

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 134 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYESCDVCNGSGAKPGTSPETCPTCKGSGTV 193

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 194 HIQ-QAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKAVEVNIPAGIDDGQRIRLS 252

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG +L+C +PIS  T A+GG  +V TLD   
Sbjct: 253 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLNLHCELPISFATAALGGELEVPTLDGK- 311

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 312 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIIVETPVNLTDRQKELLEEFERIS 371

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 372 TGLENQTPRKKSFLDKLRDLFD 393


>gi|320157230|ref|YP_004189609.1| chaperone protein DnaJ [Vibrio vulnificus MO6-24/O]
 gi|319932542|gb|ADV87406.1| chaperone protein DnaJ [Vibrio vulnificus MO6-24/O]
          Length = 381

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 250/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYE+L DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G         G +DF ++F  +FG I G GR     +  
Sbjct: 61  QKKAAYDQYGHAAFEQGGGGFGG----GFGGGGADFGDIFGDVFGDIFGGGRRGGGHARP 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+E+SLEEA  G + +I  PT V C TC GSGAK GT+   C  C+G G+V
Sbjct: 117 -QRGADLRYNMELSLEEAVRGVSKEIEVPTLVHCDTCEGSGAKKGTSAETCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V++H  F+R+G +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGERGAPAGDLYVQVHVREHHIFEREGNNLYCEVPVSFAMAALGGEVEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 294 VNLKVPSETQTGRMFRMRGKGVKGVRGGAIGDLIVKLVVETPVNLSSRQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 354 CGEAATKHKPKSEGFFNGVKKFFDDL 379


>gi|293398260|ref|ZP_06642465.1| chaperone DnaJ [Neisseria gonorrhoeae F62]
 gi|291611523|gb|EFF40593.1| chaperone DnaJ [Neisseria gonorrhoeae F62]
          Length = 381

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 9   MSNQDFYATLGVARAATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 68

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 69  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 121

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPG +P  C  C GSG V
Sbjct: 122 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGASPETCPTCKGSGTV 181

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TCRG+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 182 HIQ-QAIFRMQQTCPTCRGAGKHIKEPCVKCRGVGRNKAVKTVEVNIPAGIDDGQRIRLS 240

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS    A+GG  +V TLD   
Sbjct: 241 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFAMAALGGELEVPTLDG-K 299

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++T+P+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L  RQ+ELLEEFE+IS
Sbjct: 300 VKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERIS 359

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 360 TGLENQTPRKKSFLDKLRDLFD 381


>gi|54307901|ref|YP_128921.1| DnaJ-class molecular chaperone [Photobacterium profundum SS9]
 gi|62899959|sp|Q6LUA6|DNAJ_PHOPR RecName: Full=Chaperone protein dnaJ
 gi|46912327|emb|CAG19119.1| putative DnaJ protein, DnaJ-class molecular chaperone with
           C-terminal Zn finger domain [Photobacterium profundum
           SS9]
          Length = 380

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A +R +K A++ LAMK+HPD+N+ + +A EKF ++  AYE+L DP
Sbjct: 1   MSKRDFYEVLGVGRDAGERDIKKAYKRLAMKFHPDRNQ-EADATEKFKEVKTAYEILTDP 59

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E     QG+GG G G  G +DF ++F  +FG I G     +R    
Sbjct: 60  QKKAAYDQYGHAAFE-----QGSGGGGYGGGGGADFGDIFGDVFGDIFGGAGGGRRQQQR 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G + +IR PT V C +C GSGAK G++   C  C+G G+V
Sbjct: 115 AQRGSDLRYNMELTLEEAVRGCSKEIRVPTLVGCDSCDGSGAKRGSSATTCGTCHGQGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC  C G G+II  PC+ CHGQGRV + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFAVQQACPHCHGRGKIIKDPCNSCHGQGRVEKTKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ + V +H  F+RDG +LYC VP+S    A+GG  +V TL+   
Sbjct: 234 GEGEAGEFGAPAGDLYVQVHVAEHSIFERDGNNLYCEVPVSFTMAAVGGEVEVPTLNG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL  ++ VETP  L+  Q+ELL+E E+  
Sbjct: 293 VNLKVPSETQTGRMFRMRGKGVKSVRGGAVGDLICKLVVETPVNLSSHQKELLKELEESF 352

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 353 GGKAAGKHKPKSEGFFNGVKKFFDDL 378


>gi|157825371|ref|YP_001493091.1| DnaJ protein [Rickettsia akari str. Hartford]
 gi|189083357|sp|A8GMF8|DNAJ_RICAH RecName: Full=Chaperone protein dnaJ
 gi|157799329|gb|ABV74583.1| DnaJ protein [Rickettsia akari str. Hartford]
          Length = 371

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 245/377 (64%), Gaps = 12/377 (3%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y++LG+ + A+   LK A+  LA +YHPD   +D +A++KF +I+ AY+VL+D QKRA
Sbjct: 4   DYYKILGVSKTASQADLKKAYLKLAKQYHPDTT-DDKDAEKKFKEINRAYDVLKDEQKRA 62

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH+  +   QS+G GG  AG +   D +++F   F   MG GR  ++ +S+   G
Sbjct: 63  AYDRFGHDTFQ-NQQSRGGGGSHAGFH--HDINDIFGDFFSDFMGGGR--RKPTSSKARG 117

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           +DL+Y+L I+LEEAF G    I F + VKC TC GSG++ G     C+ C G G      
Sbjct: 118 SDLKYDLTINLEEAFHGIEKNISFSSEVKCDTCHGSGSEKGETVTTCDACGGVG-ATRIQ 176

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF+IE+AC  C+G+GQII +PC KCHG GR  +++ LSVN+P GV++GTRIR +GEG 
Sbjct: 177 QGFFTIEQACHKCKGNGQIIKNPCKKCHGMGRCHKQRNLSVNIPAGVENGTRIRHTGEGE 236

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG+ GG  GDLY+ I++  H  +K DGA+L+C +PIS V  A+GG  +V  ++     +T
Sbjct: 237 AGIRGGNSGDLYVDIAITPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGRKVNLT 296

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF--EQISSQ 362
           IP GTQ G Q RL+ KGMP + S  +GD+   + +E P+ L+KRQ ELLEEF  E IS +
Sbjct: 297 IPAGTQNGDQLRLRSKGMPKMRSTIRGDMITHIHIEVPKNLSKRQCELLEEFKKESISEK 356

Query: 363 DNNPQSTGFFARMKDFF 379
           +N+     FF +MK  +
Sbjct: 357 ENDGS---FFNKMKSLW 370


>gi|261391605|emb|CAX49043.1| chaperone protein DnaJ [Neisseria meningitidis 8013]
          Length = 373

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R ATD ++K A+R LAMKYHPD+N ++ EA+EKF ++ +AYE L D 
Sbjct: 1   MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E G Q    G  G G     DF ++F  +FGG  GSGR+       
Sbjct: 61  EKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMFGG--GSGRA-----QP 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G D++  +EI+LEEA  G   +I  PT   C  C+GSGAKPGT+P  C  C GSG V
Sbjct: 114 DYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C TC G+G+ I  PC KC G GR    K + VN+P G+DDG RIRLS
Sbjct: 174 HIQ-QAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEGG G++G   GDLY+ + ++ H+ F+RDG DL+C +PIS  T A+GG  +V TLD   
Sbjct: 233 GEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDGK- 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++TIP+ TQTG++ R+KGKG+  + S   GDLY  + VETP  L   Q+ELLEEFE+IS
Sbjct: 292 VKLTIPKETQTGRRMRVKGKGVKSLRSSAIGDLYCHIVVETPVNLTDPQKELLEEFERIS 351

Query: 361 S--QDNNPQSTGFFARMKDFFD 380
           +  ++  P+   F  +++D FD
Sbjct: 352 TGLENQTPRKKSFLDKLRDLFD 373


>gi|269958339|ref|YP_003328126.1| chaperone protein DnaJ [Anaplasma centrale str. Israel]
 gi|269848168|gb|ACZ48812.1| chaperone protein DnaJ [Anaplasma centrale str. Israel]
          Length = 380

 Score =  342 bits (877), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 253/386 (65%), Gaps = 13/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   D+Y++L + RNA+  ++K ++R +  KYHPD+N  D +A+EKF +ISEAYEVL +P
Sbjct: 1   MSSNDYYEILEVSRNASADEIKKSYRKMVFKYHPDKNPGDKKAEEKFKKISEAYEVLSNP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGA---GGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRS 117
            KRA YD+ GH A   G  + G     GF      ++DFS++F+       G GRS + +
Sbjct: 61  DKRAAYDRYGHNAFTSGGGTGGFDFTSGF------STDFSDIFQD--FFGGGFGRSQRSN 112

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           S     G+DLRY++E+SLE+AF G  V I + T VKCS+CSG+G+    N + C  CNG+
Sbjct: 113 SREHLRGSDLRYDVEVSLEDAFKGTKVPISYITNVKCSSCSGTGSDGAINSVKCGNCNGA 172

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V  T + F +IE  C  C G G++I + C KC G GRV  E  L V VP G++ G ++
Sbjct: 173 GSV-RTRKGFLTIEEVCHICNGEGEVIKNKCRKCGGNGRVRSEVSLLVTVPKGIETGNKV 231

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R++G+G AG  G   GDLY++I VK H+FF R  +DL+C+VPI +   A+GG  ++ ++D
Sbjct: 232 RVNGKGEAGFRGAKEGDLYVYIRVKDHKFFTRKSSDLHCSVPIKMTIAALGGEIEMPSID 291

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINS-GRKGDLYVQVQVETPQKLNKRQRELLEEF 356
            + +++ IP+GTQ+G Q R++GKGMP +NS  R+GD+YV V VETP KL K+Q +LL++F
Sbjct: 292 GSWTKLKIPDGTQSGDQIRMRGKGMPEVNSKDRRGDMYVHVTVETPVKLTKQQVDLLKKF 351

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
           E+ SS + +P+  GFF ++KD +  +
Sbjct: 352 EEESSANCSPKYQGFFQKIKDIWRDI 377


>gi|37679017|ref|NP_933626.1| chaperone protein DnaJ [Vibrio vulnificus YJ016]
 gi|37197759|dbj|BAC93597.1| chaperone protein DnaJ [Vibrio vulnificus YJ016]
          Length = 386

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 250/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYE+L DP
Sbjct: 6   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDP 65

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G         G +DF ++F  +FG I G GR     +  
Sbjct: 66  QKKAAYDQYGHAAFEQGGGGFGG----GFGGGGADFGDIFGDVFGDIFGGGRRGGGHARP 121

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+E+SLEEA  G + +I  PT V C TC G+GAK GT+   C  C+G G+V
Sbjct: 122 -QRGADLRYNMELSLEEAVRGVSKEIEVPTLVHCDTCEGTGAKKGTSAETCGTCHGHGQV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 181 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V++H  F+R+G +LYC VP+S    A+GG  +V TLD   
Sbjct: 240 GEGEAGERGAPAGDLYVQVHVREHHIFEREGNNLYCEVPVSFAMAALGGEVEVPTLDG-R 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 299 VNLKVPSETQTGRMFRMRGKGVKGVRGGAIGDLIVKLVVETPVNLSSRQKELLKEFEESC 358

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 359 CGEAATKHKPKSEGFFNGVKKFFDDL 384


>gi|27363826|ref|NP_759354.1| chaperone protein DnaJ [Vibrio vulnificus CMCP6]
 gi|62900252|sp|Q7MN84|DNAJ_VIBVY RecName: Full=Chaperone protein dnaJ
 gi|62900289|sp|Q8DF67|DNAJ_VIBVU RecName: Full=Chaperone protein dnaJ
 gi|27359943|gb|AAO08881.1| chaperone protein DnaJ [Vibrio vulnificus CMCP6]
          Length = 381

 Score =  342 bits (876), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 250/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYE+L DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G         G +DF ++F  +FG I G GR     +  
Sbjct: 61  QKKAAYDQYGHAAFEQGGGGFGG----GFGGGGADFGDIFGDVFGDIFGGGRRGGGHARP 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADLRYN+E+SLEEA  G + +I  PT V C TC G+GAK GT+   C  C+G G+V
Sbjct: 117 -QRGADLRYNMELSLEEAVRGVSKEIEVPTLVHCDTCEGTGAKKGTSAETCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + V++H  F+R+G +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGERGAPAGDLYVQVHVREHHIFEREGNNLYCEVPVSFAMAALGGEVEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 294 VNLKVPSETQTGRMFRMRGKGVKGVRGGAIGDLIVKLVVETPVNLSSRQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 354 CGEAATKHKPKSEGFFNGVKKFFDDL 379


>gi|332306628|ref|YP_004434479.1| chaperone protein DnaJ [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173957|gb|AEE23211.1| chaperone protein DnaJ [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 379

 Score =  342 bits (876), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 250/389 (64%), Gaps = 15/389 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+D++A++R +K A++ LAMKYHPD+ + D   +EKF ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVDKSASERDIKKAYKRLAMKYHPDRTQGDKAMEEKFKEVQEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++             G +G  DF ++F  +FG I G GR   R S  
Sbjct: 61  QKRAAYDQYGHAGVDPNRGH-------GGGHGAGDFGDIFGDVFGDIFGGGRGGGRQSRA 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  GK+V+IR PT  +C TC GSGAK G++   C  C+G G+V
Sbjct: 114 AR-GSDLRYNLELSLEEAVRGKSVEIRVPTLAECETCDGSGAKKGSSVKTCTTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC +CHGQGRV + K LSV VP GVD G RIRLS
Sbjct: 173 -QMRQGFFAVQQACPTCSGKGKIITDPCRECHGQGRVEKTKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG  G   GDLY+ + VK+H+ F+RDG +LYC VP+S    A+GG  +V TL+   
Sbjct: 232 NEGEAGENGAPAGDLYVQVHVKQHKIFERDGNNLYCEVPLSFTRAAIGGEIEVPTLEGKV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
                PE TQTGK FRL+ KG+  + SG  GDL  +V +ETP  LN RQ+ELLEE E+  
Sbjct: 292 KLKVTPE-TQTGKMFRLRNKGVKSVRSGSVGDLICKVVIETPVNLNSRQKELLEELEESM 350

Query: 360 ----SSQDNNPQSTGFFARMKDFFDSLKN 384
                +  N P+ +GFF  +K FFD L N
Sbjct: 351 GTGKDTAKNRPKESGFFDGVKKFFDDLTN 379


>gi|253997106|ref|YP_003049170.1| chaperone protein DnaJ [Methylotenera mobilis JLW8]
 gi|253983785|gb|ACT48643.1| chaperone protein DnaJ [Methylotenera mobilis JLW8]
          Length = 376

 Score =  342 bits (876), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 248/382 (64%), Gaps = 15/382 (3%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+VLG++++A++ ++K A+R LAMKYHPD+N ++P+A+++F +  EAYE+L D QK
Sbjct: 4   KKDYYEVLGVNKDASEEEIKKAYRKLAMKYHPDRNPDNPKAEDQFKEAKEAYEMLSDDQK 63

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YDQ GH  ++               +G + F + F  IFG I G G   +RS+    
Sbjct: 64  RAAYDQYGHAGVDQSMGGGAG------GFGGAGFGDAFGDIFGDIFGGGARGQRSNVY-- 115

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLRYN+EISLEEA  G   +IR P   KC  C G+GAK G +P+ C+ C G G+V  
Sbjct: 116 RGADLRYNMEISLEEAAKGTETKIRIPVQAKCDPCGGTGAKSGKSPVTCSTCGGHGQV-R 174

Query: 183 TAQSFFSIERACSTCRGSGQIIPH--PCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             Q FFS+++ C  C G+G++I     C+ CHG GRV + K LSV +P GVD+G RIRLS
Sbjct: 175 MQQGFFSVQQTCPKCHGTGKVIKDEDKCTSCHGAGRVKQNKTLSVKIPAGVDEGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AGV GG  GDLY+ I +K H+ F+RDG +L+C +PIS  T A+GG  +V TLD + 
Sbjct: 235 GEGEAGVNGGPTGDLYVVIHLKTHEIFQRDGGNLHCEMPISFTTAALGGEIEVPTLDGS- 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP  TQTG  FRL+GKG+  + S   GDL V V VETP KL + Q++LL EF+  +
Sbjct: 294 AKMKIPAETQTGGVFRLRGKGIKPLRSSDYGDLMVHVVVETPVKLTEHQKKLLREFDSST 353

Query: 361 SQD---NNPQSTGFFARMKDFF 379
             D   ++P++  +  + KDFF
Sbjct: 354 QADAGKHSPKNKSWVDKAKDFF 375


>gi|292493427|ref|YP_003528866.1| chaperone protein DnaJ [Nitrosococcus halophilus Nc4]
 gi|291582022|gb|ADE16479.1| chaperone protein DnaJ [Nitrosococcus halophilus Nc4]
          Length = 381

 Score =  342 bits (876), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 188/385 (48%), Positives = 255/385 (66%), Gaps = 7/385 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y++LG+ RNA+D ++K A+R LAMKYHPD+N  D  A+++F ++ EAY+VL D 
Sbjct: 1   MAKQDYYEILGVARNASDPEIKKAYRRLAMKYHPDRNPGDKTAEDQFKEVQEAYDVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR  YDQ GH  +  GA     GG+G     N  F ++F  +F  I G+    +     
Sbjct: 61  RKRTAYDQFGHAGVGAGAGPGAGGGYGFEGGPN--FGDIFGDVFNDIFGAAAG-RGGRRQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNL+++LEEA +G T +IR PT VKC TC GSGAKPGT+P+ C  C+G G+V
Sbjct: 118 AYRGADLRYNLDLTLEEAVAGTTAKIRIPTYVKCKTCEGSGAKPGTSPITCPTCDGHGQV 177

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C GSGQI+  PCS CHG+GRV E K LSV +PPGVD G RIRL+
Sbjct: 178 -RMQQGFFSLQQTCPRCHGSGQIVSSPCSDCHGEGRVREHKTLSVKIPPGVDTGDRIRLA 236

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG PGDLY+ I +K H  F R+G  L+C VP+S VT A+GG  DV TL    
Sbjct: 237 GEGEAGESGGPPGDLYVQIQIKAHPIFSREGDALHCEVPVSFVTAALGGELDVPTLSG-R 295

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +++ IP GTQ+G+ FRL+GKG+  +  G  GDL  +V VETP  LN+ Q+ELLE+FE   
Sbjct: 296 AKLKIPAGTQSGQVFRLRGKGVAPVRGGPTGDLLCRVMVETPVNLNEEQKELLEKFEASM 355

Query: 361 SQD--NNPQSTGFFARMKDFFDSLK 383
           +++  ++P+   +   +K FF+ +K
Sbjct: 356 NRNKKHSPKHHSWLEGVKHFFEEMK 380


>gi|160876642|ref|YP_001555958.1| chaperone protein DnaJ [Shewanella baltica OS195]
 gi|189083374|sp|A9L0R7|DNAJ_SHEB9 RecName: Full=Chaperone protein dnaJ
 gi|160862164|gb|ABX50698.1| chaperone protein DnaJ [Shewanella baltica OS195]
 gi|315268841|gb|ADT95694.1| chaperone protein DnaJ [Shewanella baltica OS678]
          Length = 377

 Score =  342 bits (876), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 242/387 (62%), Gaps = 13/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+ ++R++K A++ LAMK+HPD+N  D  A+  F +I EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVSRDTSEREIKKAYKRLAMKFHPDRNPGDKTAEANFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G  DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGY------GGGQGDFGDIFGDVFGDIFGG--GRRGGQRQ 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 113 AARGSDLRYNLELSLEEAVKGLTKELRIPTLATCDLCEGSGAKKGTSATTCGTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PCSKCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 173 -QMRQGFFAVQQPCPTCHGRGKIIKDPCSKCHGDGRVEKSKTLSVKIPAGVDTGDRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGEFGAPPGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN RQ+ELL EFE   
Sbjct: 292 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNDRQKELLREFEATL 350

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 351 TGESKKHSPKAEGFFDGVKKFFQDLNS 377


>gi|297581246|ref|ZP_06943170.1| chaperone dnaJ [Vibrio cholerae RC385]
 gi|297534562|gb|EFH73399.1| chaperone dnaJ [Vibrio cholerae RC385]
          Length = 381

 Score =  342 bits (876), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 248/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N  D  A EKF ++ EAYE+L D 
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR      + 
Sbjct: 61  QKKAAYDQYGHAAFE---QGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQ 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLEEA  G + +I  PT V C  C GSGAK GT+   C  C+G G+V
Sbjct: 118 --RGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+G   +V TLD   
Sbjct: 235 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGCEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  + S   GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P++ GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKAEGFFNGVKKFFDDL 379


>gi|114330434|ref|YP_746656.1| chaperone protein DnaJ [Nitrosomonas eutropha C91]
 gi|122314547|sp|Q0AIY0|DNAJ_NITEC RecName: Full=Chaperone protein dnaJ
 gi|114307448|gb|ABI58691.1| chaperone protein DnaJ [Nitrosomonas eutropha C91]
          Length = 369

 Score =  341 bits (875), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 187/382 (48%), Positives = 244/382 (63%), Gaps = 18/382 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M + D+Y+VLG+ R+A + +LK  +R LAMKYHPD+N  D +A+E+F +I EAYEVL D 
Sbjct: 1   MSQRDYYEVLGVGRDADESELKKVYRKLAMKYHPDRNAGDAKAEERFKEIKEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  L  G    GA GF      +  FS++F  +FG + G GRS      +
Sbjct: 61  NKRAAYDQFGHAGLNGGVGGAGAQGF------SDAFSDIFSDLFG-MRGGGRS------S 107

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRYNLEI+LE+A  G   +IR P    C TC GSGAKPGT+P  C  CNG G+V
Sbjct: 108 VHRGADLRYNLEITLEQAARGTETKIRIPRQEACDTCHGSGAKPGTSPKTCPTCNGHGQV 167

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ CS C GSG+I+  PC+ C G GRV   K LSV +P GVD+G  IRL+
Sbjct: 168 -RMQQGFFSIQQTCSHCHGSGKIVSDPCTDCQGAGRVKRHKTLSVRIPAGVDEGDSIRLT 226

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I +  H  F+R+G  L+C +PIS    A+GG  +V TLD  H
Sbjct: 227 GEGEAGASGGLAGDLYVVIHLASHPVFQREGNHLHCEIPISFTVAALGGEIEVPTLDG-H 285

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +R+ +P GTQTGK FRL+ KG+  + +   GDL   V VETP  L  RQ+ELLEEFE IS
Sbjct: 286 ARIKVPTGTQTGKIFRLRSKGITGVRNQSTGDLLCHVAVETPVNLTPRQKELLEEFESIS 345

Query: 361 SQD---NNPQSTGFFARMKDFF 379
            +D   ++P++  +  + ++FF
Sbjct: 346 QKDGSLHHPRAKSWMEKAREFF 367


>gi|71906561|ref|YP_284148.1| heat shock protein DnaJ [Dechloromonas aromatica RCB]
 gi|71846182|gb|AAZ45678.1| Heat shock protein DnaJ [Dechloromonas aromatica RCB]
          Length = 378

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 245/386 (63%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG++R+A+D ++K A+R LAMK+HPD+N ++P A+EKF +  EAYE+L D 
Sbjct: 1   MSKRDFYEILGVNRDASDDEIKKAYRKLAMKHHPDRNPDNPGAEEKFKEAKEAYEILSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSD---FSELFEGIFGGIMGSGRSYKRS 117
           QKRA YDQ GH  +E G    G  G G G + ++    F E+F G  GG  G   +  R 
Sbjct: 61  QKRAAYDQFGHAGVEQGGMGGGGFGGGGGGFADAFGGIFDEIFGGRAGGSGGGRSNIYR- 119

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 GADLRYNLEI+LE+A  G   +IR PT   C  C+GSGAK GT P  C  C GS
Sbjct: 120 ------GADLRYNLEITLEQAAHGTETKIRIPTMEVCEPCNGSGAKAGTQPKTCPTCGGS 173

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V    Q FFSI++ C  C G+G+ I  PC  C G GR+ + K L+V +P GVD+G RI
Sbjct: 174 GQV-RLQQGFFSIQQTCHKCHGTGRFIADPCKSCDGAGRIKQHKTLAVKIPAGVDEGDRI 232

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RLSGEG  GV GG PGDLY+ I +K H  F RD  DL+C +PIS    A+GG  ++ TLD
Sbjct: 233 RLSGEGEHGVNGGPPGDLYVQIHLKPHAVFTRDHNDLHCEMPISFTAAALGGEIEIPTLD 292

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
              + + IP  TQ+G+ FRL+GKG+  + S   GDL   V VETP  L +RQ+ELL E E
Sbjct: 293 GA-AAIKIPAETQSGRVFRLRGKGIKGVRSHTHGDLMCHVVVETPVNLTERQKELLRELE 351

Query: 358 QISSQDN----NPQSTGFFARMKDFF 379
           + SS+DN    NP+S  +  ++KDFF
Sbjct: 352 E-SSKDNSGKHNPRSKSWMDKVKDFF 376


>gi|117919409|ref|YP_868601.1| chaperone protein DnaJ [Shewanella sp. ANA-3]
 gi|189083379|sp|A0KTS6|DNAJ_SHESA RecName: Full=Chaperone protein dnaJ
 gi|117611741|gb|ABK47195.1| chaperone protein DnaJ [Shewanella sp. ANA-3]
          Length = 377

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 244/387 (63%), Gaps = 13/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMK+HPD+N  D  A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G  DF ++F  +FG I G     +     
Sbjct: 61  NKKAAYDQFGHAGVDPNRGGGGG------YGGAGDFGDIFGDVFGDIFGG--GRRGGQRQ 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK G++   C  C+G G+V
Sbjct: 113 AARGSDLRYNLELSLEEAVKGLTKELRIPTLASCDVCDGSGAKKGSSATTCGTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PCSKCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 173 QMR-QGFFTVQQPCPTCHGRGKIIKDPCSKCHGDGRVEKTKTLSVKIPAGVDTGDRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ ++V++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGEFGAPPGDLYVQVTVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN+RQ+ELL EFE   
Sbjct: 292 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEATL 350

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 351 TGESKKHSPKAEGFFDGVKKFFQDLNS 377


>gi|300703156|ref|YP_003744758.1| heat shock protein (hsp40), co-chaperone with dnak [Ralstonia
           solanacearum CFBP2957]
 gi|299070819|emb|CBJ42116.1| heat shock protein (Hsp40), co-chaperone with DnaK [Ralstonia
           solanacearum CFBP2957]
          Length = 381

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 239/384 (62%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D  +K A+R LAMKYHPD+N +  EA+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVGKNASDDDIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEMLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K++ YDQ GH  ++         G          F ++F  IFG     G         
Sbjct: 61  DKKSAYDQYGHAGVDPNMAGGFGAGGQGFGGFAEAFGDIFGDIFGQAQQGGGRRGAGPQM 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P   +C  C G GA+PG++   C  C+G+G+V
Sbjct: 121 -YRGADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKGAEPGSSVETCPTCHGAGQV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FF++++ C  C GSG+ IP PCSKCHGQG+V  +K L V +P G+D+G RIR S
Sbjct: 180 -RVSQGFFTMQQTCPKCHGSGKYIPKPCSKCHGQGKVKSQKTLEVKIPAGIDEGMRIRSS 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PIS  T AMGG  +V TL    
Sbjct: 239 GNGEPGINGGPPGDLYVEIHIKSHAMFERDGDDLHCQMPISFATAAMGGDIEVPTLGGRV 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ GK FRL+GKG+  + SG  GDLYV + +ETP KL + Q+ELL +F++  
Sbjct: 299 T-FTVPEGTQAGKTFRLRGKGIKGVRSGYAGDLYVHMVIETPVKLTEHQKELLRQFDKSV 357

Query: 361 SQ---DNNPQSTGFFARMKDFFDS 381
            +    ++PQ   +  ++K+FF S
Sbjct: 358 HEGGSRHSPQEQSWLDKVKNFFSS 381


>gi|153837719|ref|ZP_01990386.1| chaperone protein DnaJ [Vibrio parahaemolyticus AQ3810]
 gi|149748914|gb|EDM59745.1| chaperone protein DnaJ [Vibrio parahaemolyticus AQ3810]
          Length = 385

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 248/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYEVL D 
Sbjct: 5   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEVLTDS 64

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G         G +DF ++F  +FG I G GR        
Sbjct: 65  QKKAAYDQYGHAAFEQGGGGFGG----GFGGGGADFGDIFGDVFGDIFGGGRRGGGGHRA 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E++LEEA  G T +I  PT V C +C GSGAK G++   C  C+G G+V
Sbjct: 121 QRG-ADLRYNMELTLEEAVRGVTKEIEVPTLVHCDSCDGSGAKKGSSAETCGTCHGHGQV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 180 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 239 GEGEAGEMGAPSGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 299 S-LKVPSETQTGRMFRMRGKGVKGVRGGGIGDLIVKLVVETPVNLSSRQKELLKEFEESC 357

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 358 GGEAATKHKPKSEGFFNGVKKFFDDL 383


>gi|40063710|gb|AAR38491.1| chaperone protein DnaJ [uncultured marine bacterium 583]
          Length = 367

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 179/381 (46%), Positives = 238/381 (62%), Gaps = 15/381 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND-PEAKEKFAQISEAYEVLRD 59
           M + D+Y+VLG+ + A + ++K A++ LAMKYHPD+N  D   A++KF ++ +AY+V+ D
Sbjct: 1   MAQRDYYEVLGVKKGANEAEIKKAYKRLAMKYHPDRNAGDKASAEKKFKEVRKAYDVISD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
           PQKR+ YDQ GH  +E        GG   G  G  D       IFG I G G     ++ 
Sbjct: 61  PQKRSAYDQFGHAGVEQQGAGGFGGGNPFGAGGFGD-------IFGDIFGGG-----NTK 108

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G DLRY+LEI L +A  G TV+IR P    C TCSG+GAKPGT+   C  C+GSG+
Sbjct: 109 PDNRGPDLRYDLEIDLRQAAEGDTVKIRVPKNDTCDTCSGTGAKPGTSVKTCGNCHGSGQ 168

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF+I+R C+ C G+G+ I  PC  C GQG V ++K LSV +P GVD G RIRL
Sbjct: 169 V-QMQQGFFAIQRPCNQCHGTGEKIDSPCRTCSGQGIVRKQKTLSVKIPAGVDTGNRIRL 227

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           S EG AG+  G  GDLY+ I VK HQ F+R+G DLYC VPI   T  +GG+ +V TLD  
Sbjct: 228 SNEGEAGLRSGPSGDLYVQIHVKDHQIFQREGNDLYCEVPIDFATATLGGSIEVPTLDG- 286

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             ++ IP GTQT K FRL+GKGMP +     GDL  QV++ETP  LN +Q++LL++F   
Sbjct: 287 KLKINIPSGTQTSKLFRLRGKGMPAMRYNGSGDLLCQVKLETPVNLNSKQKQLLKDFSSS 346

Query: 360 SSQDNNPQSTGFFARMKDFFD 380
            +    P+S  FF +MK FF+
Sbjct: 347 CNAKQYPESNSFFGKMKSFFE 367


>gi|294668381|ref|ZP_06733484.1| hypothetical protein NEIELOOT_00293 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309699|gb|EFE50942.1| hypothetical protein NEIELOOT_00293 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 374

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 180/383 (46%), Positives = 243/383 (63%), Gaps = 12/383 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY  LG+ R A++ ++K A+R LAMKYHPD+N+ D EA+EKF ++ +AY+ L D 
Sbjct: 1   MSDQDFYTTLGVSRTASEDEIKKAYRKLAMKYHPDRNQGDKEAEEKFKEVQKAYDTLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA+YDQ GH A E GA +   G  G G     DFS++F  +FGG  G G     +   
Sbjct: 61  EKRAMYDQYGHAAFEQGAGAGAGGFGGFGGAQGFDFSDIFSQMFGG--GGG-----ARQQ 113

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADL+Y++EISLEEA  G   ++  PT  +C  C GSGAKPGT+   C+ C GSG V
Sbjct: 114 NYQGADLQYSVEISLEEAAKGVKKRLTIPTYEECDVCHGSGAKPGTSATTCSTCRGSGTV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           +   Q+ F +++ C  C GSG+ I  PC KC G+GRV   K + V++P G+DDG RIRLS
Sbjct: 174 HIR-QAIFQMQQTCPACHGSGKEIKDPCLKCRGEGRVKAGKTVEVDIPAGIDDGQRIRLS 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G  G   GDLYI + VK H+ F+R+G DL+C +PIS    A+GG  +V TLD   
Sbjct: 233 GEGEPGRNGAPAGDLYISVHVKAHKIFERNGLDLHCELPISFTVAALGGEVEVPTLDGK- 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP+ TQTG++ R+KGKG+  + S   GDLY  V VETP  L  RQ+ELLEEFE+IS
Sbjct: 292 VKLNIPKETQTGRRMRVKGKGIKSLRSSATGDLYCHVLVETPVNLTDRQKELLEEFEKIS 351

Query: 361 S---QDNNPQSTGFFARMKDFFD 380
           +   +   P+   F+ ++ D FD
Sbjct: 352 TGMERSQTPRKKSFWDKVGDLFD 374


>gi|73542469|ref|YP_296989.1| heat shock protein DnaJ [Ralstonia eutropha JMP134]
 gi|123624165|sp|Q46XI8|DNAJ_RALEJ RecName: Full=Chaperone protein dnaJ
 gi|72119882|gb|AAZ62145.1| Heat shock protein DnaJ [Ralstonia eutropha JMP134]
          Length = 379

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/385 (44%), Positives = 244/385 (63%), Gaps = 13/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMKYHPD+N +  E++EKF ++ EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDSKESEEKFKEVKEAYEMLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGS---GRSYKRS 117
           +K+A YDQ GH  ++         G   G  G   F+E F  IFG I G    G      
Sbjct: 61  EKKAAYDQYGHAGVD-----PNMAGGFGGGQGYGGFAEAFGDIFGDIFGQQAGGGRRGGG 115

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 GADLRY++EISLE+A  G   QIR P    C  C G+GA+PG++   C  C+G+
Sbjct: 116 GPQAYRGADLRYSMEISLEQAAHGHEAQIRVPHWDDCDHCHGNGAEPGSSVETCPTCHGA 175

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G+V   +Q FFS+++ C  C GSG+ IP PC+KCHGQG++  +K L V +P G+D+G RI
Sbjct: 176 GQV-RVSQGFFSMQQTCPKCHGSGKFIPKPCTKCHGQGKLKSQKTLEVKIPAGIDEGMRI 234

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R SG G  G+ GG PGDLY+ + +K H  F+RDG DL+C +PIS  T A+GG  +V TL+
Sbjct: 235 RSSGNGEPGINGGPPGDLYVEVHIKAHPVFERDGDDLHCQMPISFATAALGGDLEVPTLN 294

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
              +   +PE TQ+GK FRL+GKG+  + SG  GDLYV V VETP KL + Q+++L +F+
Sbjct: 295 GK-ATFPVPEATQSGKTFRLRGKGIKGVRSGYPGDLYVHVNVETPVKLTEAQKDMLRQFD 353

Query: 358 QISSQ---DNNPQSTGFFARMKDFF 379
           +   +    ++PQ   +  ++K FF
Sbjct: 354 RSVHEGGSRHSPQEQSWLDKVKSFF 378


>gi|120597807|ref|YP_962381.1| chaperone protein DnaJ [Shewanella sp. W3-18-1]
 gi|189083381|sp|A1RGN2|DNAJ_SHESW RecName: Full=Chaperone protein dnaJ
 gi|120557900|gb|ABM23827.1| chaperone protein DnaJ [Shewanella sp. W3-18-1]
 gi|319427400|gb|ADV55474.1| chaperone protein DnaJ [Shewanella putrefaciens 200]
          Length = 376

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 241/387 (62%), Gaps = 14/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMK+HPD+N  D  A+  F +  EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEAKEAYEILTDT 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++                G  DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGYG-------GGQGDFGDIFGDVFGDIFGG--GRRGGQRQ 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 112 AARGSDLRYNLELSLEEAVKGLTKELRIPTLATCDLCDGSGAKKGTSASTCTTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PCSKCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 QMR-QGFFTVQQPCPTCHGRGKIIKDPCSKCHGDGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN RQ+ELL EFE   
Sbjct: 291 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNDRQKELLREFEATL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 350 TGESKKHSPKAEGFFDGVKKFFQDLNS 376


>gi|94311853|ref|YP_585063.1| chaperone DnaJ [Cupriavidus metallidurans CH34]
 gi|189083353|sp|Q1LJ82|DNAJ_RALME RecName: Full=Chaperone protein dnaJ
 gi|93355705|gb|ABF09794.1| chaperone Hsp40, co-chaperone with DnaK [Cupriavidus metallidurans
           CH34]
          Length = 379

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 175/382 (45%), Positives = 246/382 (64%), Gaps = 7/382 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N ++ EA+EKF ++ EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKHHPDRNPDNKEAEEKFKEVKEAYEMLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+A YDQ GH  ++        GG   G      F ++F  IFG   G GR      + 
Sbjct: 61  EKKAAYDQYGHAGVDPNMAGGFGGGGFGGGGFAEAFGDIFGDIFGQAAGGGRRGGGPQAY 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EISLE+A  G   QIR P    C  C G+GA+PG++   C  CNG G+V
Sbjct: 121 --RGADLRYSMEISLEQAAHGHEAQIRVPHWDDCEHCHGNGAEPGSSVETCPTCNGVGQV 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FF++++ C  C GSG+ IP PC+KCHGQG++  +K L V +P G+D+G RIR S
Sbjct: 179 -RVSQGFFTMQQTCPKCHGSGKFIPKPCTKCHGQGKLKSQKTLEVKIPAGIDEGMRIRSS 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ + +K+H  F+RDG DL+C +PIS  T A+GG  +V TL    
Sbjct: 238 GNGEPGINGGPPGDLYVEVHIKQHPVFERDGDDLHCQMPISFATAALGGDIEVPTLGGRA 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           S   +PEGTQ GK FRL+GKG+  + SG  GDLYV V VETP KL + Q+++L +F++  
Sbjct: 298 S-FPVPEGTQAGKTFRLRGKGIKGVRSGYPGDLYVHVNVETPVKLTEAQKDILRQFDRSV 356

Query: 361 SQ---DNNPQSTGFFARMKDFF 379
            +    ++PQ   +  ++K FF
Sbjct: 357 HEGGSRHSPQEQSWLDKVKSFF 378


>gi|254295466|ref|YP_003061489.1| chaperone protein DnaJ [Hirschia baltica ATCC 49814]
 gi|254043997|gb|ACT60792.1| chaperone protein DnaJ [Hirschia baltica ATCC 49814]
          Length = 381

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 237/382 (62%), Gaps = 7/382 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M    +Y++LG+ ++  ++ LK+AFR  AM+YHPD+N +D  A+  F ++S AYE L DP
Sbjct: 1   MSDTCYYELLGVSKDVDEKALKSAFRKKAMQYHPDRNPDDASAEAMFKEVSSAYECLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSD-FSELFEGIFGGIMGSGRSYKRSSS 119
           QKRA Y+Q G    E G      GG G G     D F ++F   F      GR       
Sbjct: 61  QKRAAYNQYGRAGYEQGGMGSAGGGGGFGGQRPEDVFGDIFADFF-----GGRQSGGGRG 115

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G+DLRY+  I+LEEAFSGK  +I  PT   C  C G+GA  G +P  C  C G+GR
Sbjct: 116 GATRGSDLRYDYSITLEEAFSGKQAEIEIPTTETCDPCHGTGAAKGYSPETCGTCGGAGR 175

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FF++ER C  C+G G +I  PC KC G+G V  ++ L +N+P G++DG RIRL
Sbjct: 176 V-RAQQGFFTMERTCGACQGRGTVIKKPCGKCGGRGNVHAKRKLDINIPAGIEDGQRIRL 234

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
            GEG AG  GG  GDLYIF+S+++H+ F+RDG +LY   P+     A+GG  ++ T+   
Sbjct: 235 QGEGEAGTMGGPKGDLYIFVSIEEHELFERDGPNLYARAPVPFCKAALGGDIEMPTISGG 294

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            +RV+IPEG QTGK+ RLKGKGMP + S   GDLYV++ VETP+ L+ +Q+ELL EF + 
Sbjct: 295 RARVSIPEGAQTGKRMRLKGKGMPSLRSAVAGDLYVELFVETPRNLSAKQKELLREFSES 354

Query: 360 SSQDNNPQSTGFFARMKDFFDS 381
             +D NP+  GF +R+K FFD+
Sbjct: 355 CDEDTNPEHRGFISRVKSFFDA 376


>gi|114562148|ref|YP_749661.1| chaperone protein DnaJ [Shewanella frigidimarina NCIMB 400]
 gi|122300534|sp|Q086J2|DNAJ_SHEFN RecName: Full=Chaperone protein dnaJ
 gi|114333441|gb|ABI70823.1| chaperone protein DnaJ [Shewanella frigidimarina NCIMB 400]
          Length = 376

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 242/387 (62%), Gaps = 14/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+ ++R++K A++ LAMK+HPD+N  D  A+  F +I EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDTSEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEIKEAYEILTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++                G  DF ++F  +FG I G GR        
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGH--------GGGQGDFGDIFGDVFGDIFGGGRRGGGQRQA 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 113 ARG-SDLRYNLELSLEEAVRGLTKELRIPTLAACDLCDGSGAKKGTSATTCGTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++AC TC G G+II  PC KCHG+GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFAVQQACPTCHGRGKIIKDPCGKCHGEGRVEKSKTLSVKIPAGVDTGDRIRLT 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RD  +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVSVREHAIFTRDANNLYCEVPISFSKAALGGEIEVPTLDGKV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN++Q+ELL EFE   
Sbjct: 291 S-LKIPTETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNEKQKELLREFEATL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 350 TGESKKHSPKAEGFFDGVKKFFQDLNS 376


>gi|28897428|ref|NP_797033.1| chaperone protein DnaJ [Vibrio parahaemolyticus RIMD 2210633]
 gi|260366305|ref|ZP_05778761.1| chaperone protein DnaJ [Vibrio parahaemolyticus K5030]
 gi|260876391|ref|ZP_05888746.1| chaperone protein DnaJ [Vibrio parahaemolyticus AN-5034]
 gi|260898662|ref|ZP_05907158.1| chaperone protein DnaJ [Vibrio parahaemolyticus Peru-466]
 gi|260899244|ref|ZP_05907639.1| chaperone protein DnaJ [Vibrio parahaemolyticus AQ4037]
 gi|62900280|sp|Q87RX2|DNAJ_VIBPA RecName: Full=Chaperone protein dnaJ
 gi|28805640|dbj|BAC58917.1| DnaJ protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086872|gb|EFO36567.1| chaperone protein DnaJ [Vibrio parahaemolyticus Peru-466]
 gi|308092991|gb|EFO42686.1| chaperone protein DnaJ [Vibrio parahaemolyticus AN-5034]
 gi|308106642|gb|EFO44182.1| chaperone protein DnaJ [Vibrio parahaemolyticus AQ4037]
 gi|308112712|gb|EFO50252.1| chaperone protein DnaJ [Vibrio parahaemolyticus K5030]
          Length = 381

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 248/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYEVL D 
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G         G +DF ++F  +FG I G GR        
Sbjct: 61  QKKAAYDQYGHAAFEQGGGGFGG----GFGGGGADFGDIFGDVFGDIFGGGRRGGGGHRA 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E++LEEA  G T +I  PT V C +C GSGAK G++   C  C+G G+V
Sbjct: 117 QRG-ADLRYNMELTLEEAVRGVTKEIEVPTLVHCDSCDGSGAKKGSSAETCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEMGAPSGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPSETQTGRMFRMRGKGVKGVRGGGIGDLIVKLVVETPVNLSSRQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKSEGFFNGVKKFFDDL 379


>gi|330807469|ref|YP_004351931.1| Chaperone protein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327375577|gb|AEA66927.1| Chaperone protein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 374

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 190/384 (49%), Positives = 246/384 (64%), Gaps = 12/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG++R A++  LK A+R LAMK+HPD+N  D  ++E F + +EAYEVL D 
Sbjct: 1   MAKRDFYEVLGVERGASEADLKKAYRRLAMKHHPDRNPGDKASEEMFKEANEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  ++      GA       +G  +FS++F  +F    G       +   
Sbjct: 61  SKRAAYDQYGHAGVDPSMGGGGA------GFGGQNFSDIFGDVFSDFFGG--GRGGARGG 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY LE++LEEA  G TV IR PT V C  C GSGAK G++P+ C  C G G+V
Sbjct: 113 AQRGSDLRYTLELNLEEAVRGTTVNIRVPTLVNCKPCDGSGAKKGSSPVTCPTCGGIGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C  C G G+II  PC  CHG+GRV E K LSV VP GVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPRCHGQGKIISDPCDSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ I+V++H  F+RDG  L+C VPIS V  A+GG  ++ TLD   
Sbjct: 232 GEGEAGAQGGPTGDLYVVINVREHAIFQRDGKHLFCEVPISFVDAALGGELEIPTLDG-R 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPEGTQTGKQFR++GKG+  +  G  GDL  +V VETP  L +RQRELLEEF    
Sbjct: 291 VKLKIPEGTQTGKQFRIRGKGVAPVRGGGAGDLMCRVAVETPVNLGRRQRELLEEFRNSL 350

Query: 361 SQDN--NPQSTGFFARMKDFFDSL 382
           + DN  +P++TG+F  +K FF  L
Sbjct: 351 ADDNSHSPKTTGWFEGVKRFFGDL 374


>gi|332288676|ref|YP_004419528.1| chaperone protein DnaJ [Gallibacterium anatis UMN179]
 gi|330431572|gb|AEC16631.1| chaperone protein DnaJ [Gallibacterium anatis UMN179]
          Length = 373

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 238/384 (61%), Gaps = 15/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ ++  ++ +K A++ LAMK+HPD+N  D EA+ KF ++ EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVSKSDDEKAIKKAYKRLAMKFHPDRNPGDKEAEAKFKEVQEAYEVLGDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH A E   Q     G   G      F ++F  +FGG  G  R  +     
Sbjct: 61  EKRAAYDQYGHAAFE---QGGAGAGGFGGADFGDIFGDIFSDMFGGGRGRQRVVR----- 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G DLRY+LE++LEEA  G T  IR  T   C +C GSGAK G+    C+ C+GSGR+
Sbjct: 113 ---GEDLRYDLELTLEEAVKGVTKDIRIATLATCDSCHGSGAKAGSKVETCSYCHGSGRI 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +  FF  E+ C  C G+G+II  PC  CHG GRV + K LSV VP GVD G+++RL+
Sbjct: 170 RRQS-GFFVQEQTCPHCHGTGKIIEQPCDSCHGDGRVHKYKNLSVKVPAGVDTGSQLRLN 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ I VK+H  F+RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 229 GEGAAGENGAPAGDLYVVIHVKEHDIFQRDGNNLYCEVPISFTLAALGGEIEVPTLDGK- 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IPE TQTGK FRL+GKG+    S  +GDL  +V VETP KLNK Q+ELL++FE+  
Sbjct: 288 VKLKIPEETQTGKLFRLRGKGVTSTRSHYQGDLICRVVVETPIKLNKEQKELLQKFEKSL 347

Query: 361 SQDNN--PQSTGFFARMKDFFDSL 382
              N   P+  GF   +K FFD+L
Sbjct: 348 EGRNQHRPKENGFLDGVKRFFDNL 371


>gi|152980481|ref|YP_001354572.1| molecular chaperone DnaJ (heat shock protein) [Janthinobacterium
           sp. Marseille]
 gi|189083330|sp|A6T225|DNAJ_JANMA RecName: Full=Chaperone protein dnaJ
 gi|151280558|gb|ABR88968.1| molecular chaperone DnaJ (heat shock protein) [Janthinobacterium
           sp. Marseille]
          Length = 374

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 241/385 (62%), Gaps = 16/385 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG+ ++A+D ++K A+R LAMK+HPD+N +   A++KF +  EAYE+L DP
Sbjct: 1   MAKRDFYEILGVGKSASDEEIKKAYRKLAMKHHPDRNPDSKGAEDKFKEAKEAYEMLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YD+ GH  ++      G             F++ F  IFG I G     +     
Sbjct: 61  QKRDAYDRYGHAGVDPNMGGGGG---------GGGFADAFGDIFGDIFGQAGGGRGGRGG 111

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRYNLEI+LE+A  G    IR P+   C TC GSGAKPGT+P++C  C G G
Sbjct: 112 PQVYRGADLRYNLEITLEQAAHGYDTTIRVPSWDNCETCDGSGAKPGTSPVNCTTCGGHG 171

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FFS+ + C  C GSG+I P PC  C G G++   K L V +P G+DDG RIR
Sbjct: 172 QV-RMQQGFFSVLQTCPKCHGSGKINPSPCGTCSGAGKIKRNKTLEVKIPSGIDDGMRIR 230

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            SG G  G+ GG PGDLY+ I +K+H  F+RDG DL+C +PIS    A+GG  +V TL+ 
Sbjct: 231 SSGNGEPGMNGGPPGDLYVEIRIKQHPMFQRDGDDLHCEIPISFAKAALGGEIEVPTLNG 290

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             S  TIPEGTQ+GK FRL+ KG+  + SG  GDL+  V VETP  L +RQ+EL+ EFEQ
Sbjct: 291 KAS-FTIPEGTQSGKTFRLRSKGIKGVRSGYAGDLFCHVIVETPVTLTERQKELMREFEQ 349

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
           ++ +    ++PQ+  +  ++K+FF+
Sbjct: 350 LTIEGGSKHSPQTKSWKDKVKEFFE 374


>gi|328472559|gb|EGF43422.1| chaperone protein DnaJ [Vibrio parahaemolyticus 10329]
          Length = 381

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 248/386 (64%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYEVL D 
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G         G +DF ++F  +FG I G GR        
Sbjct: 61  QKKAAYDQYGHAAFEQGGGGFGG----GFGGGGADFGDIFGDVFGDIFGGGRRGGGGHRA 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E++LEEA  G T +I  PT V C +C GSGAK G++   C  C+G G+V
Sbjct: 117 QRG-ADLRYNMELTLEEAVRGVTKEIEVPTLVHCDSCDGSGAKKGSSAETCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEMGAPSGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRV 294

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP  L+ RQ+ELL+EFE+  
Sbjct: 295 S-LKVPSETQTGRMFRMRGKGVKGVRGGGIGDLIVKLVVETPVNLSARQKELLKEFEESC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF  +K FFD L
Sbjct: 354 GGEAATKHKPKSEGFFNGVKKFFDDL 379


>gi|307546748|ref|YP_003899227.1| molecular chaperone DnaJ [Halomonas elongata DSM 2581]
 gi|307218772|emb|CBV44042.1| K03686 molecular chaperone DnaJ [Halomonas elongata DSM 2581]
          Length = 379

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 251/386 (65%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLGI+R A  +++K A+R LA KYHPD+N +D  + EKF ++SEAYEVL D 
Sbjct: 1   MSKRDYYEVLGIERGADQKEIKKAYRRLAQKYHPDRNPDDETSAEKFREVSEAYEVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH           AGG G G  G   FS++F  +FG I G G + +R+ + 
Sbjct: 61  EKRAAYDQFGH-----AGVDGQAGGGGFGGAGAGGFSDIFGDVFGDIFGGGGA-RRNPNA 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYNLE+ LE A +G +V IR P  ++C  C G GA+PG++   C  C+G G+V
Sbjct: 115 PQRGSDLRYNLELDLESAVAGTSVDIRVPRHIECERCDGDGAEPGSSKETCPTCHGHGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC GSGQ I  PC KC+G+GR  E + LSV +P GVD G RIRL+
Sbjct: 175 -RMQQGFFAVQQTCPTCHGSGQHIKVPCHKCNGEGRQRETRTLSVKIPAGVDTGDRIRLN 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
            EG AG+ GG PGDLY+ +++K H  F+R+G  L C VPI+ V   +GG  +V TLD   
Sbjct: 234 AEGEAGINGGPPGDLYVQVAIKPHHIFEREGRHLQCEVPINFVDATLGGELEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
            ++ IP  TQTGK FRLKGKG+  +  G  GDL  +V VETP KL++ Q++LL +F++  
Sbjct: 293 VKLKIPPETQTGKMFRLKGKGVKPVRGGPAGDLLCKVVVETPVKLSEEQKDLLRKFQESL 352

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLK 383
             S+  ++P+ + FF  +K FF+ +K
Sbjct: 353 DGSNSHHSPKKSSFFDGVKKFFEDMK 378


>gi|24372710|ref|NP_716752.1| chaperone protein DnaJ [Shewanella oneidensis MR-1]
 gi|62900015|sp|Q8EHT6|DNAJ_SHEON RecName: Full=Chaperone protein dnaJ
 gi|24346772|gb|AAN54197.1|AE015557_3 chaperone protein DnaJ [Shewanella oneidensis MR-1]
          Length = 378

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 243/387 (62%), Gaps = 12/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMK+HPD+N  D  A+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G  DF ++F  +FG I G GR        
Sbjct: 61  NKKAAYDQFGHAGVDPNRGGGGG------YGGAGDFGDIFGDVFGDIFGGGRRGGGQRQA 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               +DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 115 ARG-SDLRYNLELSLEEAVKGLTKELRIPTLASCDVCDGSGAKKGTSATTCTTCHGQGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 174 -QMRQGFFTVQQPCPTCHGRGKIIKDPCAKCHGDGRVEKTKTLSVKIPAGVDTGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 233 GEGEAGEFGAPAGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN+RQ+ELL EFE   
Sbjct: 293 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEATL 351

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 352 TGESKKHSPKAEGFFDGVKKFFQDLNS 378


>gi|207721695|ref|YP_002252134.1| chaperone protein DnaJ [Ralstonia solanacearum MolK2]
 gi|207744204|ref|YP_002260596.1| chaperone protein dnaj [Ralstonia solanacearum IPO1609]
 gi|206586857|emb|CAQ17442.1| chaperone protein dnaj [Ralstonia solanacearum MolK2]
 gi|206595609|emb|CAQ62536.1| chaperone protein dnaj [Ralstonia solanacearum IPO1609]
          Length = 381

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 172/384 (44%), Positives = 239/384 (62%), Gaps = 6/384 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D  +K A+R LAMKYHPD+N +  EA+EKF +  EAYE+L D 
Sbjct: 1   MAKRDYYEVLGVGKNASDDDIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEMLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K++ YDQ GH  ++         G          F ++F  IFG     G         
Sbjct: 61  DKKSAYDQYGHAGVDPNMAGGFGAGGQGFGGFAEAFGDIFGDIFGQAQQGGGRRGAGPQM 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY++EI+LE+A  G   QIR P   +C  C G GA+PG++   C  C+G+G+V
Sbjct: 121 -YRGADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKGAEPGSSVETCPTCHGAGQV 179

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
              +Q FF++++ C  C GSG+ IP PCSKCHGQG+V  +K L V +P G+D+G RIR S
Sbjct: 180 -RVSQGFFTMQQTCPKCHGSGKFIPKPCSKCHGQGKVKSQKTLEVKIPAGIDEGMRIRSS 238

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G G  G+ GG PGDLY+ I +K H  F+RDG DL+C +PIS  T AMGG  +V TL    
Sbjct: 239 GNGEPGINGGPPGDLYVEIHIKAHAMFERDGDDLHCQMPISFATAAMGGDIEVPTLGGRV 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           +  T+PEGTQ GK FRL+GKG+  + SG  GDLYV + +ETP +L + Q+ELL +F++  
Sbjct: 299 T-FTVPEGTQAGKTFRLRGKGIKGVRSGYAGDLYVHMVIETPVRLTEHQKELLRQFDKSV 357

Query: 361 SQ---DNNPQSTGFFARMKDFFDS 381
            +    ++PQ   +  ++K+FF S
Sbjct: 358 HEGGSRHSPQEQSWLDKVKNFFSS 381


>gi|115372017|ref|ZP_01459329.1| chaperone protein DnaJ [Stigmatella aurantiaca DW4/3-1]
 gi|310824757|ref|YP_003957115.1| chaperone protein DnaJ [Stigmatella aurantiaca DW4/3-1]
 gi|115370982|gb|EAU69905.1| chaperone protein DnaJ [Stigmatella aurantiaca DW4/3-1]
 gi|309397829|gb|ADO75288.1| Chaperone protein DnaJ [Stigmatella aurantiaca DW4/3-1]
          Length = 373

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 244/378 (64%), Gaps = 12/378 (3%)

Query: 2   KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQ 61
           +K D+Y+VLG+ +    ++LK+AFR +A++YHPD+N  + EA+EKF + SEAYEVL DP+
Sbjct: 7   QKRDYYEVLGVQKGVNPQELKSAFRKVALQYHPDRNPGNNEAEEKFKEASEAYEVLSDPE 66

Query: 62  KRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTG 121
           +RA YD+ GH                     N + +++F  IFG I G  R  +   S G
Sbjct: 67  RRARYDRFGHSGGGAEGFGGFQ---------NVNINDIFGDIFGEIFGGARGGRGRGSMG 117

Query: 122 EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVY 181
              ADLRYNLEIS EEA  G   ++  P   KC TC+GSG+K G  P  C  C GSG V 
Sbjct: 118 RG-ADLRYNLEISFEEAAFGCRPKVPIPRPKKCETCTGSGSKSGAAPKPCGTCGGSGEVR 176

Query: 182 TTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSG 241
            T Q FF++ R C+ C G+G  IP PC KC G G+V  E++L V +P GVD+GTR+RLSG
Sbjct: 177 FT-QGFFAVSRTCADCNGTGAFIPDPCPKCKGAGKVPSEEVLEVAIPAGVDNGTRVRLSG 235

Query: 242 EGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS 301
            G  G  GG  GDLY+ + V++H  F+R+  +++C VPIS    A+G   DV TLD    
Sbjct: 236 MGEPGDRGGPAGDLYVTVIVREHPLFQREDYEVFCEVPISFTQAALGAKLDVPTLDG-KV 294

Query: 302 RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISS 361
           ++T+P GTQ+GK FRL+GKG+P ++S ++GD +V+V +ETP +L+ RQRELLE+F + S 
Sbjct: 295 KMTVPPGTQSGKVFRLRGKGIPHLHSQQRGDQHVRVILETPTELSSRQRELLEKFAEESG 354

Query: 362 QDNNPQSTGFFARMKDFF 379
           ++ +PQS  FFA++K+ F
Sbjct: 355 EETHPQSKSFFAKVKELF 372


>gi|119775642|ref|YP_928382.1| chaperone protein DnaJ [Shewanella amazonensis SB2B]
 gi|189083371|sp|A1S8K6|DNAJ_SHEAM RecName: Full=Chaperone protein dnaJ
 gi|119768142|gb|ABM00713.1| chaperone protein DnaJ [Shewanella amazonensis SB2B]
          Length = 376

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 251/387 (64%), Gaps = 14/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMKYHPD+N  D EA+  F ++ EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKYHPDRNPGDKEAEASFKEVKEAYEILTDT 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++    ++G GGFG G      F ++F  IFGG    G+      S 
Sbjct: 61  DKKAAYDQFGHAGVD---PNRGGGGFGGGGDFGDIFGDVFGDIFGGGRRGGQRQAARGS- 116

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                DLRYNLE+SLEEA  G T +++ PT V C +C GSGAK G++   C  C+G G+V
Sbjct: 117 -----DLRYNLELSLEEAVRGLTKELKVPTLVGCDSCDGSGAKKGSSATTCGTCHGMGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PCSKCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 -QMRQGFFAVQQTCPTCHGRGKIIKDPCSKCHGNGRVEKTKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ ++V++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVTVREHPIFVRDGNNLYCEVPISFAKAALGGEIEVPTLDGKV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  L++RQ+ELL EFE   
Sbjct: 291 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLSERQKELLREFEASL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L N
Sbjct: 350 TGESKKHSPKAEGFFDGVKKFFQDLNN 376


>gi|254418157|ref|ZP_05031881.1| chaperone protein DnaJ [Brevundimonas sp. BAL3]
 gi|196184334|gb|EDX79310.1| chaperone protein DnaJ [Brevundimonas sp. BAL3]
          Length = 400

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 180/388 (46%), Positives = 236/388 (60%), Gaps = 10/388 (2%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+Y+VLG++R      LK+A+R LAM +HPD+N    E+  +F +ISEAY VL D QKRA
Sbjct: 4   DYYEVLGVERTIDAPGLKSAYRKLAMIHHPDRNGGSEESMAQFKEISEAYTVLSDDQKRA 63

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTG-EA 123
            YD+ GH  +  G       G       N  FS++F   FG   G GR   R    G   
Sbjct: 64  AYDRFGHAGVNGGGGGGFGQGQQGFSDINDIFSQVFGDAFGDAFG-GRQAGRGQQGGPRR 122

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTT 183
           G+DLRY+LEISLE+A+ G  V+I  P  + C TC GSGA+PGT P+ C  CNG+GRV   
Sbjct: 123 GSDLRYDLEISLEQAYKGAEVEIDIPATMTCETCEGSGARPGTKPVTCTTCNGAGRVRQ- 181

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
           A  FF +ER C  C G+GQ+I  PC+ CHG G+V + + L++ +P GVDDG+RIRLSGEG
Sbjct: 182 ANGFFQVERTCPRCHGAGQMIADPCTTCHGHGQVRKTRTLNLKIPAGVDDGSRIRLSGEG 241

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATL--DATHS 301
            AG  GG  GDLY+F+SV  H  F+RD  DL  TVP+ +   A+GG  D   L  DA   
Sbjct: 242 DAGQRGGPRGDLYVFLSVTPHDLFERDNLDLLVTVPVPMTVAALGGEIDAPCLVSDACDG 301

Query: 302 R----VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
           +    V +P G QTGK  R+KGKGMP +N   +GDL V++ VETP  L  RQ+ELL+E  
Sbjct: 302 KCKAAVAVPAGAQTGKTVRIKGKGMPHLNGRARGDLVVELFVETPTDLTARQKELLQELA 361

Query: 358 QISSQDNNPQSTGFFARMKDFF-DSLKN 384
               +  NP+++ F  + K F+ D L N
Sbjct: 362 LSFGEGQNPRNSSFAGKAKRFWADILGN 389


>gi|83855404|ref|ZP_00948934.1| chaperone protein DnaJ [Sulfitobacter sp. NAS-14.1]
 gi|83843247|gb|EAP82414.1| chaperone protein DnaJ [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 170/363 (46%), Positives = 239/363 (65%), Gaps = 8/363 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ + A+  ++K  +R+ A + HPD+N ++P A+ +F + +EAYEVL+DP
Sbjct: 1   MAKRDYYETLGVAKGASADEIKKGYRTKAKELHPDRNADNPNAEAQFKEANEAYEVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-----NSDFSELFEGIFGGIMGSGRSYK 115
           +K+A YD+ GH A E G    G    G    G     +S FS++F+ +FG  MG      
Sbjct: 61  EKKAAYDRYGHAAFEGGMGGGGGHRGGGFGGGGQGDFSSAFSDVFDDLFGDFMGG--QRG 118

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRYNL I+LE+A+ G    I  PT+V C +C+GSG++ G  P  C  C+
Sbjct: 119 GGGRRAARGADLRYNLGITLEDAYRGMQKSINVPTSVACDSCNGSGSEGGAEPTTCPTCS 178

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G GRV    Q FF++ER C TC G GQI+ +PC  C G GRV +++ LSVN+P GV+ GT
Sbjct: 179 GMGRVRAQ-QGFFTVERTCPTCSGMGQIVKNPCKSCRGAGRVEKDRALSVNIPAGVETGT 237

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIRL+GEG AG+ GG  GDLYIFI V+ H+ F+RDG +L+C VP+S+ T A+GG+ +V T
Sbjct: 238 RIRLAGEGEAGMRGGPSGDLYIFIEVQDHKLFERDGPNLFCRVPVSMSTAALGGSIEVPT 297

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           +D    RV IP G+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL+E
Sbjct: 298 IDGGRGRVQIPAGSQSGRQMRLRGKGMPPLRGGGTGDMIIELAVETPVNLTSRQKELLQE 357

Query: 356 FEQ 358
           FE+
Sbjct: 358 FEK 360


>gi|312885002|ref|ZP_07744691.1| chaperone protein DnaJ [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367334|gb|EFP94897.1| chaperone protein DnaJ [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 380

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 249/386 (64%), Gaps = 12/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMKYHPD+N+ D  A E+F ++ EAYE+L DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKYHPDRNQGDDSAAEQFKEVKEAYEILLDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E     QG  G G    G +DF ++F  +FG I G GR        
Sbjct: 61  QKKAAYDQYGHAAFE-----QGGMGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGGQRV 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E++LEEA  G + +I  PT V C TC GSGAK GT+   C  C+G G+V
Sbjct: 116 QRG-ADLRYNMELTLEEAVRGVSKEIEVPTLVHCDTCDGSGAKKGTSAETCGTCHGHGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K LSV +P GVD G RIRLS
Sbjct: 175 -QMRQGFFAVQQTCPTCHGQGKIIKDPCNVCHGQGRKQKTKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 234 GEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + +P  TQTG+ FR++GKG+  +  G  GDL V++ VETP KL+ RQ+ELL+EFE+  
Sbjct: 293 VNLKVPTETQTGRMFRMRGKGVKGVRGGGVGDLIVKLVVETPVKLSARQKELLKEFEESC 352

Query: 361 SQD----NNPQSTGFFARMKDFFDSL 382
             D    + P+S GFF  +K FFD L
Sbjct: 353 GGDAATKHKPKSEGFFNGVKKFFDDL 378


>gi|194290648|ref|YP_002006555.1| chaperone protein dnaj [Cupriavidus taiwanensis LMG 19424]
 gi|226735556|sp|B3R6G6|DNAJ_CUPTR RecName: Full=Chaperone protein dnaJ
 gi|193224483|emb|CAQ70494.1| heat shock protein (Hsp40), co-chaperone with DnaK [Cupriavidus
           taiwanensis LMG 19424]
          Length = 377

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/383 (45%), Positives = 245/383 (63%), Gaps = 11/383 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ +NA+D ++K A+R LAMK+HPD+N +  +A+EKF +  EAYE+L DP
Sbjct: 1   MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKFHPDRNPDSKDAEEKFKEAKEAYEMLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +K+A YDQ GH  ++        G       G   F+E F  IFG I G G   +R    
Sbjct: 61  EKKAAYDQYGHAGVDPNMAGGFGG-----AQGYGGFAEAFGDIFGDIFGQGGGGRRGGGP 115

Query: 121 -GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               GADLRY++EISLE+A  G   QIR P    C  C G+GA+PG++   C  C+G+G+
Sbjct: 116 QAYRGADLRYSMEISLEQAAHGHEAQIRVPHWDDCDHCHGNGAEPGSSVETCPTCHGAGQ 175

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V   +Q FF++++ C  C GSG+ IP PC+KCHGQG++  +K L V +P G+D+G RIR 
Sbjct: 176 V-RVSQGFFTMQQTCPKCHGSGKFIPKPCTKCHGQGKLKSQKTLEVKIPAGIDEGMRIRS 234

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SG G  G+ GG PGDLY+ + +K H  F+RDG DL+C +PIS  T A+GG  +V TL   
Sbjct: 235 SGNGEPGINGGPPGDLYVEVHIKPHAVFERDGDDLHCQMPISFATAALGGDLEVPTLSGK 294

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            +   +PE TQ+GK FRL+GKG+  + SG  GDLYV V VETP KL + Q+E+L +F++ 
Sbjct: 295 -ATFPVPEATQSGKTFRLRGKGIKGVRSGYPGDLYVHVNVETPVKLTEAQKEMLRQFDRS 353

Query: 360 SSQ---DNNPQSTGFFARMKDFF 379
             +    ++PQ T +  ++K FF
Sbjct: 354 VHEGGSRHSPQETSWLDKVKSFF 376


>gi|254447053|ref|ZP_05060520.1| chaperone protein DnaJ [gamma proteobacterium HTCC5015]
 gi|198263192|gb|EDY87470.1| chaperone protein DnaJ [gamma proteobacterium HTCC5015]
          Length = 379

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 249/388 (64%), Gaps = 13/388 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A D +LK A+R LAMKYHPD+N ++ EA+ KF +  EAYEVL DP
Sbjct: 1   MSKRDYYEVLGVSKGADDGELKKAYRKLAMKYHPDRNPDNEEAEIKFKEAKEAYEVLTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YDQ GH  ++  A     G       G  D  ++F  IFG I G  R        
Sbjct: 61  QKRQAYDQFGHAGVDGSAGGGFGG-----AGGFGDMGDVFGDIFGDIFGGSRRGGGGPRR 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADL+YNL++SLE+A  G   +IR PT V C  C+GSGAKPG++P  C  CNG G+V
Sbjct: 116 FRG-ADLQYNLDLSLEDAVRGTDTKIRVPTQVHCEVCNGSGAKPGSSPETCGTCNGIGQV 174

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C TCRG+GQ I  PC+ CHG+GR  E K LSV +P GVD G RIRLS
Sbjct: 175 -RMQQGFFSVQQTCPTCRGTGQTISDPCTSCHGRGRKEESKTLSVKIPAGVDTGDRIRLS 233

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDL++ + VK+H  F+RDGA+L C VP+S  T A+GG  +V TLD   
Sbjct: 234 GEGEAGENGGPAGDLFVQVHVKRHAIFERDGANLMCAVPVSFTTAALGGELEVPTLDG-R 292

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + IP GTQ+G+QFRL+GKG+  +  G  GD+  +V VETP  L K+QRE+L++FEQ S
Sbjct: 293 VNLKIPAGTQSGRQFRLRGKGVKPVRGGSVGDILCRVDVETPINLTKKQREILQDFEQ-S 351

Query: 361 SQD----NNPQSTGFFARMKDFFDSLKN 384
            +D    +NP+S  +   +K FFD LK+
Sbjct: 352 VEDGGSKHNPKSGSWMDGVKQFFDDLKS 379


>gi|146294060|ref|YP_001184484.1| chaperone protein DnaJ [Shewanella putrefaciens CN-32]
 gi|189083378|sp|A4Y9Q2|DNAJ_SHEPC RecName: Full=Chaperone protein dnaJ
 gi|145565750|gb|ABP76685.1| chaperone protein DnaJ [Shewanella putrefaciens CN-32]
          Length = 376

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 241/387 (62%), Gaps = 14/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+A++R++K A++ LAMK+HPD+N  D  A+  F +  EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEAKEAYEILTDT 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++                G  DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGYG-------GGQGDFGDIFGDVFGDIFGG--GRRGGQRQ 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 112 AARGSDLRYNLELSLEEAVKGLTKELRIPTLATCDLCDGSGAKKGTSASTCTTCHGQGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 172 QMR-QGFFTVQQPCPTCHGRGKIIKDPCTKCHGDGRVEKSKTLSVKIPAGVDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G  PGDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 231 GEGEAGEFGAPPGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN RQ+ELL EFE   
Sbjct: 291 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNDRQKELLREFEATL 349

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 350 TGESKKHSPKAEGFFDGVKKFFQDLNS 376


>gi|51473384|ref|YP_067141.1| chaperone protein DnaJ [Rickettsia typhi str. Wilmington]
 gi|62899948|sp|Q68XI3|DNAJ_RICTY RecName: Full=Chaperone protein dnaJ
 gi|51459696|gb|AAU03659.1| chaperone protein DnaJ [Rickettsia typhi str. Wilmington]
          Length = 370

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 244/377 (64%), Gaps = 13/377 (3%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+YQVLG+ + A+   +K A+  LA +YHPD   N  +A++KF +I+ AY+VL+D QKRA
Sbjct: 4   DYYQVLGVSKTASQADIKKAYLKLAKQYHPDTT-NAHDAEKKFKEINAAYDVLKDEQKRA 62

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH+A     Q+Q A G G     + D +++F   F   MGSGR  ++ +S+   G
Sbjct: 63  AYDRFGHDAF----QNQQARGGGNNSGFHHDINDIFGDFFSDFMGSGR--RKQTSSKIRG 116

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           +DL+Y+L I LEEAF G    I F + VKC  C G+G++ G     C+ C G G V    
Sbjct: 117 SDLKYDLTIKLEEAFHGIEKNISFSSEVKCDACHGTGSEKGETVTTCDSCGGVG-VTRIQ 175

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF++E+ C  C+G+GQII +PC KCHG GR  +++ LS+N+P GV++GTRIR SGEG 
Sbjct: 176 QGFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGVENGTRIRHSGEGE 235

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG+ GG  GDLY+ I++K H  +K DGA+L+C +PIS V  A+GG  +V  ++    ++T
Sbjct: 236 AGIRGGNNGDLYVDIAIKPHDIYKIDGANLHCKLPISFVHAALGGEIEVPVIEGGKVKLT 295

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF--EQISSQ 362
           IP GTQ G Q RL+ KGM  I S  +GD+   + VE P+ L+KRQRELLEEF  E I+ +
Sbjct: 296 IPAGTQNGDQLRLRSKGMSKIRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEK 355

Query: 363 DNNPQSTGFFARMKDFF 379
           +N+   + FF +MK  +
Sbjct: 356 END---SSFFNKMKSMW 369


>gi|114848901|gb|ABI83664.1| heat shock protein 40 [Coxiella endosymbiont of Amblyomma
           americanum]
          Length = 377

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 239/384 (62%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M+K D+Y+VLGI R ATD ++K AFR LAMKYHPD+N  D +A+ KF +  EAY VL D 
Sbjct: 1   MEKRDYYEVLGISRTATDGEIKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYGVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIM-GSGRSYKRSSS 119
           +KR  YDQ GH  +E            +G +G  D  ++F  IFG I  G GRS  R   
Sbjct: 61  RKRTAYDQFGHSGVESSFGGSSTT---SGGFGFGDLGDVFGDIFGDIFSGGGRSRLRE-- 115

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
             + GADL YNL +SLEE   G T  I+ PT V C  C+G+G+K G+NP+ C+ C GSG+
Sbjct: 116 --QQGADLNYNLLLSLEEVVHGITQTIKVPTWVSCVACNGNGSKKGSNPIVCHRCGGSGK 173

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           ++T   SF  +++ CS C G GQ+I  PC  C GQGR  + K LSV +PPG+D G RIRL
Sbjct: 174 LHT-QHSFLQVQQTCSVCHGIGQVIKDPCLSCQGQGRRQQTKTLSVKIPPGIDTGDRIRL 232

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG  G   GDLY+ I VK H  F R+G DL+  VPI  VT ++GG  ++ TLD  
Sbjct: 233 SGEGEAGFLGAPSGDLYVQIQVKPHPVFHREGNDLHSEVPIDFVTASLGGEVEIPTLDGA 292

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
             R+TIP  TQ+GKQFRL+GKG+ V+ SG  GDL   + VETP KLN  Q+E L+ F  +
Sbjct: 293 -VRLTIPPETQSGKQFRLRGKGVKVLRSGGIGDLICHITVETPIKLNTEQKESLKRFSTL 351

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
             +D    S     R + +FDS+K
Sbjct: 352 LEKDGKNHS----LRRRSWFDSVK 371


>gi|221068657|ref|ZP_03544762.1| chaperone protein DnaJ [Comamonas testosteroni KF-1]
 gi|220713680|gb|EED69048.1| chaperone protein DnaJ [Comamonas testosteroni KF-1]
          Length = 376

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 238/384 (61%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP--EAKEKFAQISEAYEVLR 58
           M K D+Y+VLG+ ++A+D  +K A+R LAMKYHPD+N+ D   EA+E F ++ EAYE+L 
Sbjct: 1   MSKRDYYEVLGVAKSASDDDIKKAYRKLAMKYHPDRNQGDKAKEAEETFKEVKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++      G  GFG       D       IFG +   G    R  
Sbjct: 61  DSQKRAAYDQYGHAGVDPNRGMGGGEGFGGFAEAFGD-------IFGDMFNGGGRGGRGG 113

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G DL Y++EI+LEEA  GK  QIR P+   C TCSGSGAKPGT+   C+ CNG G
Sbjct: 114 RQVYRGNDLSYSMEITLEEAAKGKDAQIRIPSWDSCDTCSGSGAKPGTSTKTCSTCNGMG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V    Q FFS+++ C  CRG+G+IIP PC+ C GQG+V  +K L V +P G+DDG RIR
Sbjct: 174 TV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTSCGGQGKVKRQKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G  GG  GDLYI I VK H  F+RDG DL+C VP+S +T A+GG  +V TL  
Sbjct: 233 SAGNGEPGTNGGPAGDLYIEIRVKDHDIFERDGDDLHCNVPVSFITAALGGEIEVPTLQG 292

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQ GKQFRL+GKG+  I S   GDLY  + VETP KL + QR+LL++ ++
Sbjct: 293 -KAAIDIPEGTQAGKQFRLRGKGIKGIRSSYPGDLYCHIVVETPVKLTEYQRKLLKDLDE 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
              +    ++P    +  R+K FF
Sbjct: 352 SLKKGGSKHSPSGESWTDRLKSFF 375


>gi|121998257|ref|YP_001003044.1| chaperone protein DnaJ [Halorhodospira halophila SL1]
 gi|189083328|sp|A1WX30|DNAJ_HALHL RecName: Full=Chaperone protein dnaJ
 gi|121589662|gb|ABM62242.1| chaperone protein DnaJ [Halorhodospira halophila SL1]
          Length = 385

 Score =  338 bits (868), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 184/387 (47%), Positives = 249/387 (64%), Gaps = 7/387 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+++NA+D ++K A+R +A K+HPD+N  D E+ E+F ++ EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNKNASDAEIKKAYRRMAQKFHPDRNPGDEESAERFKEVKEAYEVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  ++  A     G  G    G  DFS++F  +FG I GSG       S 
Sbjct: 61  QKRAAYDQFGHAGVDPSAGGGPRGYGGGAGPGGPDFSDIFSDVFGDIFGSGGGRGGGRSR 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              GADLRY LE+SLE+A  G   QI+ PT V+C  C GSG++ G+ P  C  C G G V
Sbjct: 121 AFRGADLRYTLELSLEDAVRGTEEQIQVPTHVECDACKGSGSRAGSKPQTCPTCKGHGDV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFSI++ C  C G G ++  PC KC G+GRV + K L+V +P GVD G RIRLS
Sbjct: 181 -RVQQGFFSIQQTCPRCGGEGTMVTDPCPKCRGRGRVEDRKTLNVRIPAGVDTGDRIRLS 239

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG  G  GG PGDLY+ ++V++H+FF+RDGADL+C VP+ IVT A+GG  +V TLD   
Sbjct: 240 GEGEPGERGGPPGDLYVQVAVREHEFFERDGADLHCQVPVDIVTAALGGEVEVPTLDG-R 298

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             + IP GTQ  + FRL+GKG+  +   R+GDL  ++ VETP  L KRQRELLEEF Q +
Sbjct: 299 VNLRIPPGTQPNQVFRLRGKGVKPVRGNRQGDLLCRIHVETPVNLTKRQRELLEEF-QAT 357

Query: 361 SQD----NNPQSTGFFARMKDFFDSLK 383
            QD    ++P ++ +  ++K F +  +
Sbjct: 358 LQDTGGKHHPHTSSWLDKVKRFIEEWR 384


>gi|71891902|ref|YP_277632.1| hypothetical protein BPEN_119 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|123641149|sp|Q493S6|DNAJ_BLOPB RecName: Full=Chaperone protein dnaJ
 gi|71796008|gb|AAZ40759.1| DnaJ [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 375

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 240/386 (62%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K+D+Y++LGI +NA +R++K +++ LAMK+HPD+N  +  A+ KF +I EAYEVL + 
Sbjct: 1   MAKSDYYEILGISKNADEREIKKSYKRLAMKFHPDRNPGNTTAETKFKEIKEAYEVLSNS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH A E G  S GA        G +DFS++F  +FG I G  R      S 
Sbjct: 61  EKRAAYDQYGHAAFESG--SMGA----TSNSGGADFSDIFGDVFGDIFGGNRR-----SR 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYN+E+SLE+A  G   +I  PT   C  C G+GA+     + C  C+G G+V
Sbjct: 110 AGRGSDLRYNIELSLEDAVRGIIKEICIPTLSTCEKCRGTGARSNAAIITCMTCHGQGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS++++C TC G G+II   C+KCHG GRV   K LSV +P GV+ G RIRLS
Sbjct: 170 -QIRQGFFSVQQSCPTCHGHGKIIKEACNKCHGNGRVERSKTLSVKIPSGVNTGDRIRLS 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG +G  G   GDLY+ I ++KH  F R+  +LYC VPIS    A+GG  +V TLD   
Sbjct: 229 GEGESGKNGAPSGDLYVQIQIRKHPIFDREEKNLYCEVPISFSMAALGGEIEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE----F 356
            ++ IP  TQTGK FR++GKG+  + SG  GDL  +V VETP KLN  Q+ LL++    F
Sbjct: 288 VKLKIPPETQTGKLFRMRGKGVKSVRSGGNGDLLCRVVVETPVKLNDIQKRLLQDLSDSF 347

Query: 357 EQISSQDNNPQSTGFFARMKDFFDSL 382
           E      N+P+S  FF  +K FFD L
Sbjct: 348 EGPHGNRNSPRSKSFFDGVKKFFDDL 373


>gi|83941928|ref|ZP_00954390.1| chaperone protein DnaJ [Sulfitobacter sp. EE-36]
 gi|83847748|gb|EAP85623.1| chaperone protein DnaJ [Sulfitobacter sp. EE-36]
          Length = 385

 Score =  338 bits (867), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 169/363 (46%), Positives = 239/363 (65%), Gaps = 8/363 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ + A+  ++K  +R+ A + HPD+N ++P A+ +F + +EAYEVL+DP
Sbjct: 1   MAKRDYYETLGVAKGASADEIKKGYRTKAKELHPDRNADNPNAEAQFKEANEAYEVLKDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYG-----NSDFSELFEGIFGGIMGSGRSYK 115
           +K+A YD+ GH A E G    G    G    G     +S FS++F+ +FG  MG      
Sbjct: 61  EKKAAYDRYGHAAFEGGMGGGGGHRGGGFGGGGQGDFSSAFSDVFDDLFGDFMGG--QRG 118

Query: 116 RSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
                   GADLRYNL I+LE+A+ G    I  PT+V C +C+GSG++ G  P  C  C+
Sbjct: 119 GGGRRAARGADLRYNLGITLEDAYRGMQKSINVPTSVACDSCNGSGSEGGAEPTTCPTCS 178

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G G+V    Q FF++ER C TC G GQI+ +PC  C G GRV +++ LSVN+P GV+ GT
Sbjct: 179 GMGKVRAQ-QGFFTVERTCPTCSGMGQIVKNPCKSCRGAGRVEKDRALSVNIPAGVETGT 237

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIRL+GEG AG+ GG  GDLYIFI V+ H+ F+RDG +L+C VP+S+ T A+GG+ +V T
Sbjct: 238 RIRLAGEGEAGMRGGPSGDLYIFIEVQDHKLFERDGPNLFCRVPVSMSTAALGGSIEVPT 297

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           +D    RV IP G+Q+G+Q RL+GKGMP +  G  GD+ +++ VETP  L  RQ+ELL+E
Sbjct: 298 IDGGRGRVQIPAGSQSGRQMRLRGKGMPPLRGGGTGDMIIELAVETPVNLTSRQKELLQE 357

Query: 356 FEQ 358
           FE+
Sbjct: 358 FEK 360


>gi|116619862|ref|YP_822018.1| chaperone protein DnaJ [Candidatus Solibacter usitatus Ellin6076]
 gi|116223024|gb|ABJ81733.1| chaperone protein DnaJ [Candidatus Solibacter usitatus Ellin6076]
          Length = 377

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 177/386 (45%), Positives = 245/386 (63%), Gaps = 17/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ + A D +LK A+R LA ++HPD+N +DP A+EKF + SEAY VL D 
Sbjct: 1   MSKRDYYEVLGVGKQAADSELKAAYRELAKRFHPDRNPDDPHAEEKFKECSEAYSVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YD+ GH      A  QGAGG  AG +    F++ F  I G   G G  + +    
Sbjct: 61  QKRAAYDRFGH------AGVQGAGGGPAG-FNPEQFAD-FGDILGDFFGFGDLFGQGGGA 112

Query: 121 -------GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNI 173
                   + G D+RY+LEI+ E+A  G    I+ P   +C  C G G++PG+ P  C  
Sbjct: 113 GGRRRTRAQRGEDVRYDLEITFEDAMFGMGADIQVPRMERCERCKGGGSEPGSGPTTCPT 172

Query: 174 CNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDD 233
           C+G G +    QSF SI R CSTC GSGQII +PC +CHG G    ++ L VN+P GVDD
Sbjct: 173 CHGRGEILYQ-QSFLSIRRTCSTCNGSGQIIRNPCGECHGHGYKQVQRKLKVNIPAGVDD 231

Query: 234 GTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDV 293
           G R+RL+GEG  GV GG PGDLY+F+ VK+H FF+R  ADL+CT+PI++   A+G   ++
Sbjct: 232 GNRLRLAGEGQPGVNGGPPGDLYVFLKVKEHPFFERHEADLHCTIPINMAQAALGCEIEI 291

Query: 294 ATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELL 353
            TL+   S++ IPEGTQ G QF+L+ KG+ V+NS  +GDLYV + V+TP ++++ QR++L
Sbjct: 292 PTLEQP-SKLKIPEGTQNGAQFKLRHKGVAVLNSSSRGDLYVHIAVKTPTRISREQRKML 350

Query: 354 EEFEQISSQDNNPQSTGFFARMKDFF 379
           E+       DN P   G F ++KD+F
Sbjct: 351 EQLRDTLPVDNRPAEKGLFEKVKDYF 376


>gi|94970269|ref|YP_592317.1| chaperone DnaJ [Candidatus Koribacter versatilis Ellin345]
 gi|94552319|gb|ABF42243.1| Chaperone DnaJ [Candidatus Koribacter versatilis Ellin345]
          Length = 378

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 247/377 (65%), Gaps = 11/377 (2%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+VL + R ATD+++K+++R LA+++HPD+N ++ +A+EKF + SEAY VL D +K
Sbjct: 12  KRDYYEVLQVTRTATDQEIKSSYRKLALQFHPDRNPDNKDAEEKFKECSEAYGVLSDSEK 71

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGE 122
           RA YD+           + G+GGF   M    DFSE+F  +FG  MG      R  S  +
Sbjct: 72  RAAYDRF---GHAGLGGNGGSGGFDPNMV---DFSEIFTDMFG--MGDLFGRGRGRSRAQ 123

Query: 123 AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYT 182
            GADLR ++ +  E+A  G   + R      C TC GSGA PG  P+ C  C G G+   
Sbjct: 124 RGADLREDITLEFEQAVFGIETESRVRRHETCETCHGSGAAPGKAPVSCRKCGGRGQ-ER 182

Query: 183 TAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGE 242
             Q FFS+ R C TC G GQ+I  PC+ C GQG V  E+ ++V VP GV+DGTRIR +G+
Sbjct: 183 FQQGFFSVSRTCGTCGGLGQVITDPCAGCRGQGAVVRERTIAVKVPAGVEDGTRIRYNGQ 242

Query: 243 GGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSR 302
           G AG +GG  GDLYI + VK+H+FF+R+G DL+CTVP+S    A+G    + TL+  H +
Sbjct: 243 GEAGTHGGPAGDLYIVLHVKEHKFFEREGKDLFCTVPVSFAQAALGTDIMIPTLEGEH-K 301

Query: 303 VTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQ 362
           + IPEGTQTG Q +L+GKG+PV+N   KGD++V+++V+TP KLNKRQRELL+E E  +S 
Sbjct: 302 LHIPEGTQTGTQIKLRGKGVPVLNGHGKGDIFVEIKVQTPSKLNKRQRELLQELEAGASV 361

Query: 363 DNNPQSTGFFARMKDFF 379
           +N+P+ +   ++MKD F
Sbjct: 362 ENSPEKS-LMSKMKDMF 377


>gi|547393|gb|AAA65100.1| heat shock protein [Coxiella burnetii]
          Length = 367

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG++ NAT+ ++K AFR LAMKYHPD+N  D +A+ KF +  EAYEVL D 
Sbjct: 1   MAKRDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYEVLCDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KRA YDQ GH  +E     Q  GG GAG +G  D  ++F  IFG I G  R      + 
Sbjct: 61  RKRASYDQFGHAGVE-----QTFGGAGAGGFGFGDLGDIFGDIFGDIFGGARG---GQAR 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + GADL Y L +SLEEA  G +  I+ PT + C TC+GSGAK G++P  C  CNGSG++
Sbjct: 113 EQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSGAK-GSSPATCPRCNGSGQM 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
                 F  +++ CS CRG GQ+I  PC+ CHGQGR  + K LSV +PPG+D G RIRL+
Sbjct: 172 -RMQHGFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQTKTLSVKIPPGIDTGDRIRLA 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++G  PGDLY+ + VK H  F R+G DL+  VPI   T A+GG  ++ TLD + 
Sbjct: 231 GEGEAGLFGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPIDFTTAALGGEMEIPTLDGS- 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            R+TIP  TQ GKQFRL+GKG+  + SG  GDL   + VETP KL+  Q++ L++F ++ 
Sbjct: 290 VRLTIPPETQGGKQFRLRGKGVKALRSGAVGDLICHIVVETPVKLSPEQKDYLKQFAELL 349

Query: 361 SQD---NNPQSTGFF 372
            +D   ++P++  +F
Sbjct: 350 KKDEKNHSPRTRNWF 364


>gi|146283644|ref|YP_001173797.1| DnaJ protein [Pseudomonas stutzeri A1501]
 gi|145571849|gb|ABP80955.1| DnaJ protein [Pseudomonas stutzeri A1501]
          Length = 347

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 227/352 (64%), Gaps = 10/352 (2%)

Query: 30  MKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAG 89
           MK+HPD+N  D  A+E F + +EAYEVL DP KRA YDQ GH     G   Q   G G  
Sbjct: 1   MKHHPDRNPGDKAAEEAFKEANEAYEVLSDPSKRAAYDQYGHA----GVDPQMGAGAGGA 56

Query: 90  MYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFP 149
            YG ++FS++F  +F            S    + G+DLRY LE+ LEEA  G TV IR P
Sbjct: 57  GYGGANFSDIFGDVFSDFFSG--GRGGSRGGAQRGSDLRYTLELDLEEAVRGTTVTIRVP 114

Query: 150 TAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCS 209
           T V+C TC GSGAK GT+P+ C  C G G+V    Q FFS+++ C  C GSG++I  PC 
Sbjct: 115 TLVECKTCDGSGAKKGTSPVTCTTCGGIGQVRMQ-QGFFSVQQTCPRCHGSGKMISDPCG 173

Query: 210 KCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKR 269
            CHGQGRV E+K LSV VPPGVD G RIRLSGEG AG  GG  GDLY+ ++V++H  F+R
Sbjct: 174 SCHGQGRVEEQKTLSVKVPPGVDTGDRIRLSGEGEAGTQGGPAGDLYVVVNVREHAIFQR 233

Query: 270 DGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGR 329
           DG  LYC VPIS    A+GG  +V TLD    ++ IPEGTQTGKQFRL+GKG+  +  G 
Sbjct: 234 DGKHLYCEVPISFADAALGGELEVPTLDG-RVKLKIPEGTQTGKQFRLRGKGVAPVRGGA 292

Query: 330 KGDLYVQVQVETPQKLNKRQRELLEEFEQISSQD--NNPQSTGFFARMKDFF 379
            GDL  +V VETP  L+KRQRE+LEEF      D  ++P+++G+F  +K FF
Sbjct: 293 AGDLMCRVVVETPVNLSKRQREMLEEFRGTLQGDTSHSPKASGWFEGVKRFF 344


>gi|298369584|ref|ZP_06980901.1| chaperone protein DnaJ [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282141|gb|EFI23629.1| chaperone protein DnaJ [Neisseria sp. oral taxon 014 str. F0314]
          Length = 378

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 247/386 (63%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   DFY++LG+ R A+D ++K A+R LAMKYHPD+N  D EA++KF ++ +AY+ L D 
Sbjct: 1   MINKDFYEILGVARGASDDEIKKAYRKLAMKYHPDRNPGDKEAEDKFKEVQKAYDTLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNS---DFSELFEGIFGGIMGSGRSYKRS 117
           +KRA+YDQ GH A E G      G  G G +G +   DFS++F  +FGG  G GR     
Sbjct: 61  EKRAMYDQYGHAAFEQGMGGGAGGFGGFGGFGGAQGFDFSDIFSQMFGGGAGGGRQQNYQ 120

Query: 118 SSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
                 GADL+  +EI+LE+A  G   +I  PT  +CS C GSGAKPGT+   C+ C+GS
Sbjct: 121 ------GADLQVGVEITLEDAAKGIKKRINIPTYEECSVCHGSGAKPGTSASTCSTCHGS 174

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G V+   Q+ F +++ C TC G+G+ I  PC KC G+GR    K + VN+P G+DDG RI
Sbjct: 175 GTVHIR-QAIFQMQQTCPTCHGTGKEIKDPCVKCRGEGRTKTSKTVEVNIPAGIDDGQRI 233

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           RLSGEG  G +G   GDLY+ + VK+H+ F+R+G DL+C +PIS    A+GG  +V TLD
Sbjct: 234 RLSGEGEPGTHGAPAGDLYVNVRVKEHKIFERNGLDLHCELPISFAVAALGGEVEVPTLD 293

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               ++ IP+ TQTG++ R+KGKG+  + S   GDLY  V VETP  L  RQ+ELLEEFE
Sbjct: 294 GK-VKLNIPKETQTGRRMRVKGKGIKSLRSNSMGDLYCHVLVETPVNLTDRQKELLEEFE 352

Query: 358 QISS---QDNNPQSTGFFARMKDFFD 380
           +IS+   +   P+   F+ ++ D FD
Sbjct: 353 KISTGLDRSQTPRKKSFWDKVGDLFD 378


>gi|134095814|ref|YP_001100889.1| chaperone protein DnaJ [Herminiimonas arsenicoxydans]
 gi|189083329|sp|A4G8D1|DNAJ_HERAR RecName: Full=Chaperone protein dnaJ
 gi|133739717|emb|CAL62768.1| Chaperone protein DnaJ [Herminiimonas arsenicoxydans]
          Length = 374

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 241/385 (62%), Gaps = 16/385 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY++LG+ +NA+D ++K A+R LAMK+HPD+N +   A++KF +  EAYE+L DP
Sbjct: 1   MAKRDFYEILGLGKNASDEEIKKAYRKLAMKHHPDRNPDSKGAEDKFKEAKEAYEMLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKR  YD+ GH  ++      G             F++ F  IFG I G     +     
Sbjct: 61  QKRDAYDRYGHAGVDPNMGGGGG---------GGGFADAFGDIFGDIFGQAGGGRGGRGG 111

Query: 121 GEA--GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
            +   GADLRYNLEI+LE+A  G    IR P+   C TC GSGAKPGT+P++C  C G G
Sbjct: 112 PQVYRGADLRYNLEITLEQAAHGYDTTIRVPSWDSCETCDGSGAKPGTSPINCTTCGGHG 171

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FFS+ + C  C GSG+I P PC+ C G G++   K L V +P G+DDG RIR
Sbjct: 172 QV-RMQQGFFSVLQTCPKCHGSGKINPSPCTACSGAGKIKRNKTLEVKIPSGIDDGMRIR 230

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            SG G  G+ GG PGDLY+ I +K+H  F+R+G DL+C +PIS    A+GG  +V TL+ 
Sbjct: 231 SSGNGEPGMNGGPPGDLYVEIRIKQHAMFQREGDDLHCEIPISFAKAALGGEIEVPTLNG 290

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             S  TIPEGTQ+GK FRL+ KG+  + SG  GDL+  V VETP  L ++Q+ELL EFE 
Sbjct: 291 KAS-FTIPEGTQSGKTFRLRSKGIKGVRSGYAGDLFCHVVVETPVTLTEKQKELLREFEL 349

Query: 359 ISSQ---DNNPQSTGFFARMKDFFD 380
           ++ +    ++PQ+  +  ++K+FF+
Sbjct: 350 LTIEGGSKHSPQTKSWKDKVKEFFE 374


>gi|300112994|ref|YP_003759569.1| chaperone protein DnaJ [Nitrosococcus watsonii C-113]
 gi|299538931|gb|ADJ27248.1| chaperone protein DnaJ [Nitrosococcus watsonii C-113]
          Length = 380

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 245/386 (63%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ RN +D ++K A+R LAMKYHPD+N +D  A+E F +I EAY+VL D 
Sbjct: 1   MAKRDYYETLGVARNTSDAEIKKAYRRLAMKYHPDRNPDDKAAEENFKEIQEAYDVLSDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSD-FSELFEGIFGGIMGSGRSYKRSSS 119
           +KR  YDQ GH  +  GA     G    G     D F ++F  IFG   G G     S  
Sbjct: 61  RKRTAYDQFGHAGVGAGAGPGPGGHGFEGGANFGDIFGDVFNDIFGAAAGRG-----SRR 115

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               GADLRYNL+++LEEA +G T +IR PT V C  C GSGAKPGT+P+ C  C G G+
Sbjct: 116 QAYRGADLRYNLDLTLEEAVAGTTAKIRIPTYVACKVCEGSGAKPGTSPITCPTCGGHGQ 175

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           V    Q FFS+++ C  C G+GQI+  PCS C G+GRV E K LSV +PPGVD G RIRL
Sbjct: 176 V-RMQQGFFSLQQTCPRCHGNGQIVDSPCSTCRGEGRVREHKTLSVKIPPGVDTGDRIRL 234

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           +GEG AG  GG PGDLY+ +  K H  F R+G  L+C VP+S V  A+GG  DV TL   
Sbjct: 235 TGEGEAGESGGPPGDLYVQVQTKAHSIFSREGDSLHCEVPVSFVAAALGGELDVPTLTG- 293

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
            +++ IP GTQ+G+ FRLKGKG+  +  G  GDL  +V VETP  LN+ Q+ELLE+FE  
Sbjct: 294 RAKLKIPAGTQSGQVFRLKGKGVSPVRGGSVGDLLCRVMVETPVNLNQEQKELLEKFEAS 353

Query: 360 SSQD--NNPQSTGFFARMKDFFDSLK 383
            +++  ++P+   +   +K FF+ +K
Sbjct: 354 MNRNKKHSPKHHSWLEGVKRFFEDMK 379


>gi|126175516|ref|YP_001051665.1| chaperone protein DnaJ [Shewanella baltica OS155]
 gi|153001919|ref|YP_001367600.1| chaperone protein DnaJ [Shewanella baltica OS185]
 gi|217972230|ref|YP_002356981.1| chaperone protein DnaJ [Shewanella baltica OS223]
 gi|304410342|ref|ZP_07391961.1| chaperone protein DnaJ [Shewanella baltica OS183]
 gi|307301947|ref|ZP_07581705.1| chaperone protein DnaJ [Shewanella baltica BA175]
 gi|189083372|sp|A3D7T3|DNAJ_SHEB5 RecName: Full=Chaperone protein dnaJ
 gi|189083373|sp|A6WRU8|DNAJ_SHEB8 RecName: Full=Chaperone protein dnaJ
 gi|254777975|sp|B8E4S2|DNAJ_SHEB2 RecName: Full=Chaperone protein dnaJ
 gi|125998721|gb|ABN62796.1| chaperone protein DnaJ [Shewanella baltica OS155]
 gi|151366537|gb|ABS09537.1| chaperone protein DnaJ [Shewanella baltica OS185]
 gi|217497365|gb|ACK45558.1| chaperone protein DnaJ [Shewanella baltica OS223]
 gi|304351751|gb|EFM16150.1| chaperone protein DnaJ [Shewanella baltica OS183]
 gi|306913985|gb|EFN44406.1| chaperone protein DnaJ [Shewanella baltica BA175]
          Length = 377

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 241/387 (62%), Gaps = 13/387 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+ ++R++K A++ LAMK+HPD+N  D  A+  F +I EAYE+L D 
Sbjct: 1   MSKRDYYEVLGVSRDTSEREIKKAYKRLAMKFHPDRNPGDKTAEANFKEIKEAYEILTDA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            K+A YDQ GH  ++      G         G  DF ++F  +FG I G     +     
Sbjct: 61  DKKAAYDQFGHAGVDPNRGGGGY------GGGQGDFGDIFGDVFGDIFGG--GRRGGQRQ 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRYNLE+SLEEA  G T ++R PT   C  C GSGAK GT+   C  C+G G+V
Sbjct: 113 AARGSDLRYNLELSLEEAVKGLTKELRIPTLATCDLCEGSGAKKGTSATTCGTCHGQGQV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+KCHG GRV + K LSV +P GVD G RIRL+
Sbjct: 173 -QMRQGFFAVQQPCPTCHGRGKIIKDPCTKCHGDGRVEKSKTLSVKIPAGVDTGDRIRLA 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG +G   GDLY+ +SV++H  F RDG +LYC VPIS    A+GG  +V TLD   
Sbjct: 232 GEGEAGEFGAPAGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKV 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
           S + IP  TQTG+ FRL+GKG+  + S   GDL  +V +ETP  LN RQ+ELL EFE   
Sbjct: 292 S-LKIPAETQTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNDRQKELLREFEATL 350

Query: 360 --SSQDNNPQSTGFFARMKDFFDSLKN 384
              S+ ++P++ GFF  +K FF  L +
Sbjct: 351 TGESKKHSPKAEGFFDGVKKFFQDLNS 377


>gi|254517096|ref|ZP_05129154.1| chaperone protein DnaJ [gamma proteobacterium NOR5-3]
 gi|219674601|gb|EED30969.1| chaperone protein DnaJ [gamma proteobacterium NOR5-3]
          Length = 374

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 243/386 (62%), Gaps = 16/386 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+  ++ +K A+R +AMKYHPD+N +DP+A EKF + SEAYEVL D 
Sbjct: 1   MSKRDYYEVLGVSRSDDEKVIKKAYRRVAMKYHPDRNPDDPKADEKFKEASEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  LE                   +FS++F  +FG I G      R    
Sbjct: 61  QKRAAYDQYGHAGLEGQMGGGFG---------GGNFSDIFGDVFGDIFGG--GGGRGRGG 109

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY L+ISLE+A  G TV+IR PT   CSTC GSGA+ G++P  C  C G+G+V
Sbjct: 110 AQRGSDLRYTLDISLEDAVRGTTVEIRVPTLAACSTCDGSGARKGSSPTTCGTCGGAGQV 169

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +++ C TCRG G  I  PC+ C GQGRV + K LSV VPPGVD G RIRL 
Sbjct: 170 -RMQQGFFQVQQTCPTCRGRGSTISDPCTSCRGQGRVEKTKKLSVKVPPGVDTGDRIRLG 228

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDL++ +SVK+H  F+RDG  LYC VPI+    A+GG  +V TLD   
Sbjct: 229 GEGEAGTEGGPAGDLFVQMSVKQHPIFERDGKHLYCEVPITFADAALGGELEVPTLDG-R 287

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQTGK FRL+GKG+  +  G  GDL  +  +ETP  LNKRQ+E+LEE ++  
Sbjct: 288 VKLKIPAETQTGKLFRLRGKGVQPVRGGGVGDLLCRAVIETPVNLNKRQKEILEELQRSM 347

Query: 361 SQ---DNNPQSTGFFARMKDFFDSLK 383
            +    ++P+   +F  +K FFD LK
Sbjct: 348 GEGGHAHSPRQKSWFDGVKHFFDELK 373


>gi|15604058|ref|NP_220573.1| chaperone protein DnaJ [Rickettsia prowazekii str. Madrid E]
 gi|6225274|sp|Q9ZDY0|DNAJ_RICPR RecName: Full=Chaperone protein dnaJ
 gi|3860749|emb|CAA14650.1| DNAJ PROTEIN (dnaJ) [Rickettsia prowazekii]
 gi|292571779|gb|ADE29694.1| DnaJ [Rickettsia prowazekii Rp22]
          Length = 370

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 169/377 (44%), Positives = 244/377 (64%), Gaps = 13/377 (3%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D+YQVLG+ + A+   +K A+  LA +YHPD   N  +A++KF +I+ AY+VL+D QKRA
Sbjct: 4   DYYQVLGVSKTASQADIKKAYLKLAKQYHPDTT-NANDAEKKFKEINAAYDVLKDEQKRA 62

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAG 124
            YD+ GH+A     QSQ A G G     + D +++F   F   MGSGR  ++ +S+   G
Sbjct: 63  AYDRFGHDAF----QSQQARGGGNNGSFHPDINDIFGDFFSDFMGSGR--RKQTSSKIRG 116

Query: 125 ADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTA 184
           +DL+Y+L I LEEAF G    I F + VKC TC G+G++ G     C+ C G G      
Sbjct: 117 SDLKYDLTIKLEEAFHGIEKNISFSSEVKCDTCHGTGSEKGETITTCDACGGVGAT-RIQ 175

Query: 185 QSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGG 244
           Q FF++E+ C  C+G+GQII +PC KCHG GR  +++ LS+N+P GV++GTRIR +GEG 
Sbjct: 176 QGFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGVENGTRIRHTGEGE 235

Query: 245 AGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVT 304
           AG+ GG  GDLY+ I++K H  +K DGA+L+C +PIS V  A+GG  +V  ++    ++T
Sbjct: 236 AGIRGGNNGDLYVDIAIKPHDIYKVDGANLHCKLPISFVHAALGGEIEVPVIEGGKVKLT 295

Query: 305 IPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF--EQISSQ 362
           IP GTQ G Q RL+ KGM  + S  +GD+   + VE P+ L+K+QRELLEEF  E I+ +
Sbjct: 296 IPAGTQNGDQLRLRSKGMSKVRSTIRGDMLTHIHVEVPKNLSKKQRELLEEFKKESINEK 355

Query: 363 DNNPQSTGFFARMKDFF 379
           +N+   + FF +MK  +
Sbjct: 356 END---SSFFNKMKSMW 369


>gi|264677146|ref|YP_003277052.1| chaperone protein DnaJ [Comamonas testosteroni CNB-2]
 gi|299530689|ref|ZP_07044104.1| chaperone protein DnaJ [Comamonas testosteroni S44]
 gi|262207658|gb|ACY31756.1| chaperone protein DnaJ [Comamonas testosteroni CNB-2]
 gi|298721205|gb|EFI62147.1| chaperone protein DnaJ [Comamonas testosteroni S44]
          Length = 376

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 238/384 (61%), Gaps = 14/384 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP--EAKEKFAQISEAYEVLR 58
           M K D+Y+VLG+ ++A+D  +K A+R LAMK+HPD+N+ +   EA+EKF ++ EAYE+L 
Sbjct: 1   MSKRDYYEVLGVAKSASDDDIKKAYRKLAMKFHPDRNQGEKAKEAEEKFKEVKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D QKRA YDQ GH  ++      G  GFG       D       IFG +   G    R  
Sbjct: 61  DSQKRAAYDQYGHAGVDPNRGMGGGEGFGGFAEAFGD-------IFGDMFNGGGRGGRGG 113

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                G DL Y++EI+LEEA  GK  QIR P+   C TCSGSGAKPGT+   C  CNG G
Sbjct: 114 RQVYRGNDLSYSMEITLEEAAKGKDAQIRIPSWDSCDTCSGSGAKPGTSTKTCTTCNGMG 173

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V    Q FFS+++ C  CRG+G+IIP PC+ C GQG+V  +K L V +P G+DDG RIR
Sbjct: 174 TV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTSCGGQGKVKRQKTLEVKIPAGIDDGMRIR 232

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
            +G G  G  GG  GDLYI I VK H  F+RDG DL+C VP+S +T A+GG  +V TL  
Sbjct: 233 SAGNGEPGTNGGPAGDLYIEIRVKDHDIFERDGDDLHCNVPVSFITAALGGEIEVPTLQG 292

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
             + + IPEGTQ GKQFRL+GKG+  I S   GDLY  + VETP KL + QR+LL++ ++
Sbjct: 293 -KAAIDIPEGTQAGKQFRLRGKGIKGIRSSYPGDLYCHIVVETPVKLTEYQRKLLKDLDE 351

Query: 359 ISSQ---DNNPQSTGFFARMKDFF 379
              +    ++P    +  R+K FF
Sbjct: 352 SLKKGGSKHSPSGESWTDRLKSFF 375


>gi|148244502|ref|YP_001219196.1| chaperone protein DnaJ [Candidatus Vesicomyosocius okutanii HA]
 gi|189083391|sp|A5CX57|DNAJ_VESOH RecName: Full=Chaperone protein dnaJ
 gi|146326329|dbj|BAF61472.1| chaperone protein DnaJ [Candidatus Vesicomyosocius okutanii HA]
          Length = 365

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 175/381 (45%), Positives = 246/381 (64%), Gaps = 17/381 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE-AKEKFAQISEAYEVLRD 59
           M + DFY++LGI +N   +Q+K A++ LAMK+HPD+ +++ E A++KF +I +AY +L D
Sbjct: 1   MSQRDFYEILGIAKNTDVKQIKKAYKRLAMKHHPDRVKDNKELAEKKFKEIQKAYAILSD 60

Query: 60  PQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSS 119
            QKR  YDQ GH  +     +  AG      + +S F ++F  IFGG  GS +S  R   
Sbjct: 61  TQKRQAYDQFGHAGI-----NGNAGATSGTSFSSSGFGDIFGDIFGG--GSQQSNNR--- 110

Query: 120 TGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGR 179
               G+DLRY+LEI L+EA  G TV+IR P    C TCSG+GAKPGT+   C  C G+G+
Sbjct: 111 ----GSDLRYDLEIDLKEAAQGTTVKIRIPKNETCDTCSGTGAKPGTSVKTCLTCGGAGQ 166

Query: 180 VYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL 239
           +    Q FF+++R C+ C G+GQ I   C+ CHG+G V ++K LSV +P GVD G RIRL
Sbjct: 167 I-QIQQGFFAVQRPCNACSGTGQRIESTCNNCHGKGVVHKQKTLSVKIPAGVDTGNRIRL 225

Query: 240 SGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAT 299
           SGEG AG+ GG  GDLY+ I VKKH  F+R  +DLYC VPI   T  +GG  +V TLD  
Sbjct: 226 SGEGEAGIRGGLSGDLYVQIHVKKHAIFERQDSDLYCEVPIDFATAVLGGQVEVPTLD-N 284

Query: 300 HSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
              + +P GTQTGK FRL+ KG+  +  G  GD+  +V++ETP  L+K+Q++LL++F   
Sbjct: 285 KLNIKVPAGTQTGKLFRLRSKGITHLQHGGSGDVICKVKLETPINLSKKQQDLLQKFSNS 344

Query: 360 SSQDNNPQSTGFFARMKDFFD 380
             + ++P+S  FF +MK FF+
Sbjct: 345 CGKKHHPESNSFFGKMKSFFE 365


>gi|119503073|ref|ZP_01625158.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [marine gamma proteobacterium HTCC2080]
 gi|119461419|gb|EAW42509.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain
           [marine gamma proteobacterium HTCC2080]
          Length = 376

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 242/385 (62%), Gaps = 14/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+DR+  D  +K A+R +AMK+HPD+N +D +A  KF + +EAY+VL + 
Sbjct: 1   MSKRDYYEVLGVDRSTADPDIKKAYRRIAMKFHPDRNPDDKDADAKFKEATEAYDVLMNA 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YDQ GH  LE GA   G         G S+FS++F  +FG I G           
Sbjct: 61  DKRAAYDQFGHAGLEQGAGGGGF-------QGGSNFSDIFGDVFGDIFGG--GGGGGRQG 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY +E+SLEEA  G T +I+ PT   C+TC GSGAKPGT P+ C  C G+G+V
Sbjct: 112 PQRGSDLRYTMEVSLEEAVRGATREIKVPTLQHCNTCDGSGAKPGTKPVTCGSCGGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +++ C  CRG G+ I  PC  C GQG + + K LSV VPPGVD G RIRLS
Sbjct: 172 -RMQQGFFQVQQTCPKCRGQGKTISDPCRDCRGQGLLEKTKTLSVKVPPGVDTGDRIRLS 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDL++ I+V++H  F+RDG +LYC VPI+ V  A+GG  +V TLD   
Sbjct: 231 GEGEAGPSGGPSGDLFVQIAVRQHNLFERDGRNLYCEVPINFVDAALGGELEVPTLDG-K 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQTGK FRL+GKG+  +  G  GDL  +  VETP  L+ +Q++LL+EF    
Sbjct: 290 VKLKIPSETQTGKMFRLRGKGVLPVRGGPIGDLMCRAVVETPINLSAQQKQLLQEFRSTL 349

Query: 361 SQDNN---PQSTGFFARMKDFFDSL 382
            +  N   P+ + +F  ++ FFD +
Sbjct: 350 DEGGNRQSPRQSSWFEGVRSFFDGM 374


>gi|108763396|ref|YP_629016.1| chaperone protein DnaJ [Myxococcus xanthus DK 1622]
 gi|108467276|gb|ABF92461.1| chaperone protein DnaJ [Myxococcus xanthus DK 1622]
          Length = 375

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 170/378 (44%), Positives = 249/378 (65%), Gaps = 10/378 (2%)

Query: 2   KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQ 61
           +K D+Y+VLG+ ++ + ++LK+AFR +A++YHPD+N  + +A+EKF + SEAYEVL DP+
Sbjct: 7   QKRDYYEVLGVQKSVSAQELKSAFRKVALQYHPDRNPGNSDAEEKFKEASEAYEVLSDPE 66

Query: 62  KRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTG 121
           +RA YD+ GH             G   G +   + +++F  IFG I       +    T 
Sbjct: 67  RRAKYDRFGH-----AGNPFDGFGGAGGGFQGVNINDIFGEIFGDIF---GGGRGGRRTS 118

Query: 122 EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVY 181
             GADLRYNLEI+ EEA  G   ++  P   KC TCSGSG+K  T P  C+ C GSG + 
Sbjct: 119 SRGADLRYNLEITFEEAAFGCRPKVTIPRPKKCDTCSGSGSKSNTGPRPCSACGGSGELR 178

Query: 182 TTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSG 241
            T Q FF++ R C  C G+G ++P PC++C G G+V  E+++ V +P GVD+GTR+RLSG
Sbjct: 179 YT-QGFFAVSRPCGDCGGTGAVVPDPCTRCKGSGKVPSEEVIEVAIPGGVDNGTRVRLSG 237

Query: 242 EGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS 301
            G  G  GG PGDLY+ + VK+H  F+R+  +++C VPIS    A+G   DV TLD    
Sbjct: 238 MGEPGDRGGPPGDLYVTVIVKEHPLFQREEYEVFCEVPISFTQAALGAKIDVPTLDG-KV 296

Query: 302 RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISS 361
           ++T+P GTQ+GK FRLKGKG+P ++S ++GD +V+V VETP +L+ +QRELLE+F + S 
Sbjct: 297 KMTVPNGTQSGKVFRLKGKGIPHLHSQQRGDQHVRVVVETPTELSSKQRELLEKFAEASG 356

Query: 362 QDNNPQSTGFFARMKDFF 379
           ++++PQS  F A++K+ F
Sbjct: 357 EESHPQSKSFIAKVKELF 374


>gi|88608567|ref|YP_506418.1| chaperone protein DnaJ [Neorickettsia sennetsu str. Miyayama]
 gi|88600736|gb|ABD46204.1| chaperone protein DnaJ [Neorickettsia sennetsu str. Miyayama]
          Length = 379

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 163/382 (42%), Positives = 246/382 (64%), Gaps = 12/382 (3%)

Query: 2   KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQ 61
           KK D+Y++LG+ R+A+  +++ A++ LA++YHPD+N+ D EA EKF +I EAY VL +P+
Sbjct: 4   KKKDYYEILGVSRSASTEEIRKAYKKLALQYHPDRNKGDKEAAEKFKEIGEAYSVLSNPE 63

Query: 62  KRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTG 121
           K+A YDQ GH A   G      G      +   DFS++F  +FGG    GR+ +  +   
Sbjct: 64  KKASYDQYGHSAFNGGGFGGAGGFSAD--FSGMDFSDIFNDLFGG----GRTRRTKADFN 117

Query: 122 EA----GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGS 177
           E     G+DLRY++ I+L EAF GK V+I +    +C  C  +G +    P+ C+ CNG+
Sbjct: 118 EVIKEDGSDLRYDVSITLREAFEGKEVKISYTKLAECEQCGNTGCEGKIKPVQCSTCNGA 177

Query: 178 GRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
           G +  + Q FF++ER+CSTC GSG II +PC KC G GR+ +       +P G+ DG ++
Sbjct: 178 GSI-RSQQGFFTVERSCSTCNGSGMIIENPCKKCGGTGRIRKGVTTCAKIPRGISDGAKV 236

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
            L G+G AG  GG PGDLY+ + +K+ +FF R   DLYC VPI +   A+GG  +V +L+
Sbjct: 237 LLRGQGEAGSRGGKPGDLYMIVHIKQDEFFTRKNNDLYCEVPIRMSLAALGGEIEVPSLE 296

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
               ++ +PEG+QTG + +LKGKGM ++NS  +GD+YV++ +ETP KL K+QRE+LEEFE
Sbjct: 297 GKKFKIKLPEGSQTGDKLKLKGKGMYLLNSEYRGDMYVRLTIETPVKLTKKQREILEEFE 356

Query: 358 QISSQDNNPQSTGFFARMKDFF 379
           +  S   +P+S  FF++++  F
Sbjct: 357 K-ESLGCSPKSEKFFSKIRSMF 377


>gi|88606746|ref|YP_504652.1| chaperone protein DnaJ [Anaplasma phagocytophilum HZ]
 gi|123495930|sp|Q2GLU9|DNAJ_ANAPZ RecName: Full=Chaperone protein dnaJ
 gi|88597809|gb|ABD43279.1| chaperone protein DnaJ [Anaplasma phagocytophilum HZ]
          Length = 382

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/383 (42%), Positives = 248/383 (64%), Gaps = 4/383 (1%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   D+Y +LG+ R A++ ++K ++R    +YHPD+N  + EA+EKF +ISEAY+VL D 
Sbjct: 1   MGSNDYYDLLGVSRGASEEEIKKSYRKKVFEYHPDRNPGNKEAEEKFKKISEAYDVLTDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
            KRA YD+ GH A   G         G     ++DFS++F   F    G G++ ++SS  
Sbjct: 61  DKRAAYDRYGHSAFANGMGGNQGFTGGFDGGFSTDFSDIFNDFF--GGGFGKTSRQSSRE 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G+DLRY++E++LE+AF G  V I + T V+CS CSGSG +     + C  CNG+GR+
Sbjct: 119 NMRGSDLRYDIEVTLEDAFKGVKVPISYVTHVQCSHCSGSGGEGTAKSVKCGTCNGAGRI 178

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
             T + F +IE  C TC G G+++ + C +C G GRV  E  + V VP G+++G ++R++
Sbjct: 179 -RTRKGFLTIEELCHTCSGEGEVVKNKCKRCAGSGRVRNEVGILVTVPRGIENGNKVRVN 237

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G AG  G   GDLY+++ VK H+FF R G DLYC VPI +   A+GG  ++ ++D T 
Sbjct: 238 GKGEAGYRGARSGDLYVYVVVKDHKFFTRRGMDLYCNVPIKMTLAALGGEIEMPSIDGTW 297

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSG-RKGDLYVQVQVETPQKLNKRQRELLEEFEQI 359
           +++ IPEGTQ+  + R++GKGMP I  G R+GD+YVQV VETP KL K+Q ELL++FE  
Sbjct: 298 TKLKIPEGTQSNDKLRMRGKGMPDIQGGERRGDMYVQVTVETPVKLTKKQEELLKQFEDE 357

Query: 360 SSQDNNPQSTGFFARMKDFFDSL 382
           S+ +++P+ +GFF ++K  +  +
Sbjct: 358 SNANSSPKFSGFFQKIKGIWKDI 380


>gi|160900664|ref|YP_001566246.1| chaperone protein DnaJ [Delftia acidovorans SPH-1]
 gi|226735559|sp|A9BNG6|DNAJ_DELAS RecName: Full=Chaperone protein dnaJ
 gi|160366248|gb|ABX37861.1| chaperone protein DnaJ [Delftia acidovorans SPH-1]
          Length = 380

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 238/387 (61%), Gaps = 16/387 (4%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP--EAKEKFAQISEAYEVLR 58
           M K DFY+VLG+ +NA+D  +K A+R LAMKYHPD+N+ D   EA+EKF +  EAYE+L 
Sbjct: 1   MSKRDFYEVLGVAKNASDDDIKKAYRKLAMKYHPDRNQGDAAREAEEKFKEAKEAYEMLS 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSS 118
           D  KRA YDQ GH  ++         G G G  G   F+E F  IFG +   G   +  +
Sbjct: 61  DSNKRAAYDQYGHAGVDPNR------GMGGGAEGFGGFAEAFGDIFGDMFNQGGGRRGGA 114

Query: 119 STGEA---GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICN 175
             G     G DL Y +EI+LEEA  GK  QIR P+   C TC GSGAKPGT+   C  CN
Sbjct: 115 GGGRQVYRGNDLSYAMEITLEEAAHGKDAQIRIPSWDGCDTCHGSGAKPGTSAKTCTTCN 174

Query: 176 GSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGT 235
           G G V    Q FFS+++ C  CRG+G+IIP PC+ C GQG+V  +K L V +P G+DDG 
Sbjct: 175 GMGSV-QMRQGFFSVQQTCPHCRGTGKIIPEPCTSCGGQGKVKRQKTLEVKIPAGIDDGM 233

Query: 236 RIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVAT 295
           RIR SG G  G  GG  GDLYI I +K H  F+RDG DL+C VP+S +T A+GG  +V T
Sbjct: 234 RIRSSGNGEPGTNGGPAGDLYIEIRIKDHDIFERDGDDLHCNVPVSFITAALGGEIEVPT 293

Query: 296 LDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEE 355
           L    + + IPEGTQ GKQFRL+GKG+  + S   GDLY  + VETP KL + QR+LL E
Sbjct: 294 LSGK-AAIDIPEGTQAGKQFRLRGKGIKGVRSSYPGDLYCHIVVETPVKLTEYQRKLLRE 352

Query: 356 FEQISSQ---DNNPQSTGFFARMKDFF 379
            E+   +    ++P    +  R+K FF
Sbjct: 353 LEESLKKGGAKHSPSGESWTDRLKSFF 379


>gi|254787223|ref|YP_003074652.1| chaperone protein DnaJ [Teredinibacter turnerae T7901]
 gi|259645282|sp|C5BQ32|DNAJ_TERTT RecName: Full=Chaperone protein dnaJ
 gi|237684061|gb|ACR11325.1| chaperone protein DnaJ [Teredinibacter turnerae T7901]
          Length = 376

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 247/384 (64%), Gaps = 10/384 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+ +++ LK A+R +AMK+HPD+N +D  A+EKF + SEAYEVL D 
Sbjct: 1   MAKRDYYEVLGVARDVSEQDLKKAYRKVAMKFHPDRNPDDASAEEKFKEASEAYEVLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH      A  +G GG G G  G   FS++F  +FG I G     +     
Sbjct: 61  QKRAAYDQFGH------AGVEGQGGMGGGAEGFGSFSDIFGDVFGDIFGGAGGGRGRGGP 114

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRY L++SLE+A  G +V+I+ PT V C+ C GSGAKPGT    CN C G G+V
Sbjct: 115 SRG-ADLRYTLDLSLEDAVRGTSVKIKVPTLVSCTNCGGSGAKPGTTATTCNTCGGHGQV 173

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C TCRG G+ I  PC+KCHG GRV E K LSV VP GVD G RIRL+
Sbjct: 174 -RMQQGFFSVQQTCPTCRGQGKTISDPCNKCHGHGRVEETKTLSVKVPAGVDTGDRIRLA 232

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG  GDLY+ + VK H+FF+R+G +LYC VPISI    +GG  +V TLD   
Sbjct: 233 GEGEAGADGGPSGDLYVQVHVKDHEFFQREGRNLYCEVPISIFDACLGGDLEVPTLDG-R 291

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF-EQI 359
            ++ +P  TQTGK FRL+GKG+  I  G  GDL  +V VETP  L+ +Q+ELLE+  +  
Sbjct: 292 VKLKVPAETQTGKLFRLRGKGVTPIRGGAAGDLLCRVIVETPVNLSNKQKELLEQLKDTF 351

Query: 360 SSQDNNPQSTGFFARMKDFFDSLK 383
               ++P+   +F  MK+FF  +K
Sbjct: 352 KGTQHSPKQQSWFEGMKNFFGDMK 375


>gi|329120609|ref|ZP_08249272.1| dTDP-glucose 4,6-dehydratase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327460833|gb|EGF07167.1| dTDP-glucose 4,6-dehydratase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 385

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 182/389 (46%), Positives = 244/389 (62%), Gaps = 13/389 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M   D+YQ LG+ R+A D ++K A+R LAMKYHPD+N  D  A+EKF  + +AY+ L D 
Sbjct: 1   MSNQDYYQTLGVSRSAGDDEIKKAYRKLAMKYHPDRNPGDKAAEEKFKDVQKAYDTLSDK 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNS--DFSELFEGIFGGIMGSGRSYKRSS 118
           +KRA+YDQ GH A E GA + G GG   G  G    DFS++F  +FGG  G  R      
Sbjct: 61  EKRAMYDQIGHAAFEQGAGAGGFGGGFGGFGGAQGFDFSDIFSQMFGGGGGGARQQDYQ- 119

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
                GADL+Y +EI+LEEA  G   +I  PT  +C  C GSGAKPGT    C  C+GSG
Sbjct: 120 -----GADLQYAVEITLEEAAQGTRRRITIPTHEECGVCHGSGAKPGTTASTCATCHGSG 174

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
            V+   Q+ F +++ C  C GSG+ I  PC KC G+GRV   K + VN+P G+DDG RIR
Sbjct: 175 TVHIR-QAIFQMQQTCPACHGSGKEIRDPCVKCRGEGRVKTAKTVEVNIPAGIDDGQRIR 233

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           LSGEG  G  G   GDLY+ + VK H+ F+R+G DL+C +P+S    A+GG  +V TL+ 
Sbjct: 234 LSGEGEPGRNGAPSGDLYVVVHVKAHKIFERNGLDLHCELPVSFTVAALGGEVEVPTLEG 293

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQ 358
              ++TIP+ TQTG++ R+KGKG+  + S   GDLY  V VETP  L  RQ+ELLEEFE+
Sbjct: 294 K-VKLTIPKETQTGRRMRVKGKGIKSLRSSATGDLYCHVLVETPVNLTDRQKELLEEFEK 352

Query: 359 ISS---QDNNPQSTGFFARMKDFFDSLKN 384
           IS+   +   P+   F+ +++D  + LKN
Sbjct: 353 ISTGLDRSQTPRKKSFWDKVEDKVNDLKN 381


>gi|288941114|ref|YP_003443354.1| chaperone protein DnaJ [Allochromatium vinosum DSM 180]
 gi|288896486|gb|ADC62322.1| chaperone protein DnaJ [Allochromatium vinosum DSM 180]
          Length = 385

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 241/387 (62%), Gaps = 9/387 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ RNA++  +K AFR LAMKYHPD+N  D EA+ KF +   AY+VL DP
Sbjct: 1   MAKRDYYEVLGVQRNASEADIKKAFRRLAMKYHPDRNPGDSEAEAKFKEAKLAYDVLTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNS--DFSELFEGIFGGIMGSGRSYKRSS 118
           +KR+ YDQ GH  ++      G  G G          FS++F  +FG I G     +   
Sbjct: 61  KKRSAYDQFGHAGVDGAGPGFGGFGGGGPGDFAGAGSFSDIFGDVFGDIFGG--GGRAGG 118

Query: 119 STGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
              + G DLRY+L ++LEEA +GK V+IR PT V C  C+GSGAKPGT P  C  C G G
Sbjct: 119 RRSQRGVDLRYDLSLTLEEAVAGKEVKIRLPTWVDCQFCNGSGAKPGTKPKTCPTCGGHG 178

Query: 179 RVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIR 238
           +V    Q FFSI++ C  CRG+G +I  PCS C G+GR+ EEK LSV VP GVD G RIR
Sbjct: 179 QV-RMQQGFFSIQQTCPECRGTGAVIEEPCSHCRGRGRIQEEKTLSVKVPAGVDTGDRIR 237

Query: 239 LSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDA 298
           L+GEG  G  GG PGDLY+ I V +H  F R+ A+LYC VPIS VT A+GG  +V TLD 
Sbjct: 238 LAGEGERGEQGGPPGDLYVQIQVMEHPIFTREDANLYCQVPISFVTAALGGELEVPTLDG 297

Query: 299 THSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE- 357
               + IP GTQTGK FR++ KG+  +  G  GDL  +V +ETP  L  RQ+ELL EFE 
Sbjct: 298 -KVMLKIPPGTQTGKMFRVRNKGVKPVRGGVVGDLICRVLIETPVDLTDRQKELLREFEA 356

Query: 358 --QISSQDNNPQSTGFFARMKDFFDSL 382
             Q     +NPQS  +   +K FF+ +
Sbjct: 357 SVQEGGSRHNPQSHSWLDGVKSFFEKM 383


>gi|88704204|ref|ZP_01101918.1| Chaperone protein dnaJ [Congregibacter litoralis KT71]
 gi|88701255|gb|EAQ98360.1| Chaperone protein dnaJ [Congregibacter litoralis KT71]
          Length = 376

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 245/386 (63%), Gaps = 14/386 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+VLG+ R+  ++ +K A+R +AMKYHPD+N +DP+A EKF + SEAYEVL D 
Sbjct: 1   MSKRDYYEVLGVSRSDDEKDIKKAYRRVAMKYHPDRNPDDPKADEKFKEASEAYEVLSDS 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRA YDQ GH  +E                G  +FS++F  +FG I G      R    
Sbjct: 61  QKRAAYDQYGHAGVEGQMGG-------GFGGGAGNFSDIFGDVFGDIFGG--GGGRGRGG 111

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRY L+ISLE+A  G TVQIR PT   CSTC GSGA+ G++P  C  C G+G+V
Sbjct: 112 AQRGSDLRYTLDISLEDAVRGTTVQIRVPTLAACSTCDGSGARKGSSPTTCGTCGGAGQV 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF +++ C TCRG G  I  PC+ C GQGRV + K LSV VPPGVD G RIRL 
Sbjct: 172 -RMQQGFFQVQQTCPTCRGRGSTISDPCTSCRGQGRVEKTKKLSVKVPPGVDTGDRIRLG 230

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG PGDL++ +SVK+H  F+RDG  LYC VPI+    A+GG  +V TLD   
Sbjct: 231 GEGEAGAEGGPPGDLFVQMSVKQHPIFERDGKHLYCEVPITFADAALGGELEVPTLDG-R 289

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
            ++ IP  TQTGK FRL+GKG+  +  G  GDL  +  +ETP  LNKRQ+ELLEE +   
Sbjct: 290 VKLKIPAETQTGKLFRLRGKGVQPVRGGGVGDLLCRAVIETPVNLNKRQKELLEELQTSM 349

Query: 361 SQ---DNNPQSTGFFARMKDFFDSLK 383
            +    ++P+   +F  +K+FFD LK
Sbjct: 350 GEGGHAHSPRQKSWFDGVKNFFDELK 375


>gi|157803365|ref|YP_001491914.1| hypothetical protein A1E_00905 [Rickettsia canadensis str. McKiel]
 gi|189083359|sp|A8EXP6|DNAJ_RICCK RecName: Full=Chaperone protein dnaJ
 gi|157784628|gb|ABV73129.1| DnaJ [Rickettsia canadensis str. McKiel]
          Length = 375

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 243/378 (64%), Gaps = 10/378 (2%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNR-NDPEAKEKFAQISEAYEVLRDPQKR 63
           D+YQ+LG+ + A+  +LK A+  LA +YHPD     D  A++KF +I+ AY+VL+D QKR
Sbjct: 4   DYYQILGVSKTASSAELKKAYHKLAKQYHPDNAAAGDTNAEKKFKEINAAYDVLKDEQKR 63

Query: 64  ALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEA 123
           A YD+ GH+A +     +GAGG  +  +   D +++F   F   MG  R   R +S+   
Sbjct: 64  AAYDRFGHDAFQNQQSRRGAGGGTSSFH--PDINDIFGDFFSDFMGGSRR-SRPTSSKVR 120

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTT 183
           G+DL+Y+L I+LEEAF G    I F + V+C TC G+G++ G     C+ C+G G V   
Sbjct: 121 GSDLKYDLTINLEEAFHGIEKNISFSSEVQCDTCHGNGSEKGETITTCDACSGVG-VTRI 179

Query: 184 AQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEG 243
            Q FF+IE+ C  C+G+GQ+I +PC KCHG GR  +++ L VN+P GV++GTRIR +GEG
Sbjct: 180 QQGFFTIEQTCHKCQGNGQMIKNPCKKCHGMGRYHKQRNLLVNIPAGVENGTRIRHTGEG 239

Query: 244 GAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRV 303
            AG+ GG  GDLY+ IS+K H  +K DGA+L+C +PIS V  A+GG  +V  ++     +
Sbjct: 240 EAGIRGGNSGDLYVDISIKPHDIYKVDGANLHCKLPISFVNAALGGEVEVPIIEGGKVNL 299

Query: 304 TIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEF--EQISS 361
           TIP GTQ G Q RL+ KGM  + S  +GD+   + VE P+ L+KRQRELLEEF  E +S 
Sbjct: 300 TIPAGTQNGDQLRLRSKGMSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESMSE 359

Query: 362 QDNNPQSTGFFARMKDFF 379
           ++N+   + FF +MK  +
Sbjct: 360 KEND---SSFFNKMKSLW 374


>gi|148981928|ref|ZP_01816568.1| DnaJ protein [Vibrionales bacterium SWAT-3]
 gi|145960690|gb|EDK26033.1| DnaJ protein [Vibrionales bacterium SWAT-3]
          Length = 381

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 247/386 (63%), Gaps = 11/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++  AYE+L DP
Sbjct: 1   MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKVAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E G    G G  G        F ++F  IF      G         
Sbjct: 61  QKKAAYDQYGHAAFEQGGMGGGGGFGGGQGDFGDIFGDVFGDIF-----GGGRRGGGQQR 115

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            + G+DLRYN+E++LEEA  G + +I  PT V+C TC GSGAK G++   C  C+G G+V
Sbjct: 116 AQRGSDLRYNMELTLEEAVRGVSKEIEVPTLVECDTCDGSGAKKGSSAQTCGTCHGHGQV 175

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC+ CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 176 -QMRQGFFAVQQTCPTCNGKGKIIKDPCNSCHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 234

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  G   GDLY+ + VK+H  F+RDG +LYC VP+S    A+GG  +V TLD   
Sbjct: 235 GEGEAGEQGAPAGDLYVQVHVKEHNIFERDGNNLYCEVPVSFSMAALGGEVEVPTLDG-R 293

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + +PE TQTG+ FR++GKG+  +  G  GDL V++ VETP KL+ RQ+ELL EFE+  
Sbjct: 294 VNLKVPEETQTGRMFRMRGKGVKGVRGGGVGDLIVKLVVETPVKLSSRQKELLREFEETC 353

Query: 360 ---SSQDNNPQSTGFFARMKDFFDSL 382
              ++  + P+S GFF+ +K+FFD L
Sbjct: 354 GGEAASKHKPKSEGFFSGVKNFFDDL 379


>gi|53803856|ref|YP_114292.1| dnaJ protein [Methylococcus capsulatus str. Bath]
 gi|62899940|sp|Q607A6|DNAJ_METCA RecName: Full=Chaperone protein dnaJ
 gi|53757617|gb|AAU91908.1| dnaJ protein [Methylococcus capsulatus str. Bath]
          Length = 377

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 246/385 (63%), Gaps = 13/385 (3%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K D+Y+ LG+ RNA+D  +K AFR LAMKYHPD+N+++PEA+E+F  + EAY+VL DP
Sbjct: 1   MAKEDYYETLGVPRNASDSDIKKAFRRLAMKYHPDRNKDNPEAEERFKSVKEAYDVLSDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           +KR+ YDQ GH  ++      G        +    FS++F  +FG I        R    
Sbjct: 61  KKRSAYDQFGHAGIDPSMGGGGGF-----GFTGDSFSDIFGDVFGDIF---GGGGRRRGR 112

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           G+ G+DLRYNLE++LEEA +G   +I+ PT V C+ C GSGAK G+ P+ C  C+G G V
Sbjct: 113 GQRGSDLRYNLELTLEEAVAGTEAKIKVPTWVTCTECGGSGAKKGSAPVTCPTCHGQGAV 172

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FFS+++ C TCRG+GQ I  PC  C+GQGRV E K LSV +PPGVD G RIRLS
Sbjct: 173 -RMQQGFFSVQQTCPTCRGTGQHISDPCRVCYGQGRVQETKTLSVKIPPGVDTGDRIRLS 231

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG  GG PGDLY+ I VK+H  F RDGADLYC VPI   T  +GG  +V TLD   
Sbjct: 232 GEGEAGEGGGPPGDLYVHIGVKQHPIFTRDGADLYCEVPIGFPTACLGGELEVPTLDGK- 290

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQI- 359
             + IP  TQTG+ FR++GKG+  +  G  GDL  +V+VETP  LNK Q +L+ + ++  
Sbjct: 291 VVLKIPAETQTGRLFRVRGKGVKPVRGGVAGDLLCRVRVETPVHLNKEQIDLIRQLDESL 350

Query: 360 --SSQDNNPQSTGFFARMKDFFDSL 382
                 ++PQ+ G+   +K FFD L
Sbjct: 351 RGGGSHHSPQAHGWLDGVKQFFDRL 375


>gi|269962373|ref|ZP_06176723.1| dnaJ protein [Vibrio harveyi 1DA3]
 gi|269832869|gb|EEZ86978.1| dnaJ protein [Vibrio harveyi 1DA3]
          Length = 382

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 249/386 (64%), Gaps = 10/386 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFY+VLG+ R+A++R +K A++ LAMK+HPD+N+ D  A +KF ++ EAYE+L DP
Sbjct: 1   MSKRDFYEVLGVGRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QK+A YDQ GH A E   Q  G  G G    G +DF ++F  +FG I G GR        
Sbjct: 61  QKKAAYDQYGHAAFE---QGGGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGQQRA 117

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
               ADLRYN+E+SLEEA  G + +I  PT V C TC GSGAK G++   C  C+G G+V
Sbjct: 118 QRG-ADLRYNMELSLEEAVRGVSKEIEVPTLVHCDTCDGSGAKKGSSAETCGTCHGHGQV 176

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
               Q FF++++ C TC G G+II  PC++CHGQGR  + K L+V +P GVD G RIRLS
Sbjct: 177 -QMRQGFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQKTKTLNVKIPAGVDTGDRIRLS 235

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG