PSIBLAST alignment of GI: 254780638 and protein with PDB id: 1bq0

>gi|157830433|pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103
 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 41/75 (54%), Positives = 56/75 (74%)

Query: 2  KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQ 61
           K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D Q
Sbjct: 1  AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60

Query: 62 KRALYDQGGHEALEY 76
          KRA YDQ GH A E 
Sbjct: 61 KRAAYDQYGHAAFEQ 75