PSIBLAST alignment of GI: 254780638 and protein with PDB id: 1bqz

>gi|159162127|pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77
 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/77 (54%), Positives = 57/77 (74%)

Query: 2  KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQ 61
           K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D Q
Sbjct: 1  AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60

Query: 62 KRALYDQGGHEALEYGA 78
          KRA YDQ GH A E G 
Sbjct: 61 KRAAYDQYGHAAFEQGG 77