PSIBLAST alignment of GI: 254780638 and protein with PDB id: 1hdj

>gi|157831304|pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77
 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 56/76 (73%), Gaps = 1/76 (1%)

Query: 4  ADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKR 63
           D+YQ LG+ R A+D ++K A+R  A++YHPD+N+ +P A+EKF +I+EAY+VL DP+KR
Sbjct: 3  KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNK-EPGAEEKFKEIAEAYDVLSDPRKR 61

Query: 64 ALYDQGGHEALEYGAQ 79
           ++D+ G E L+    
Sbjct: 62 EIFDRYGEEGLKGSGC 77