PSIBLAST alignment of GI: 254780638 and protein with PDB id: 2yua

>gi|159164851|pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99
 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 36/64 (56%)

Query: 6  FYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRAL 65
           Y +LG+   AT  Q+K A+      YHPD+N    EA E+F +IS+AY VL     R  
Sbjct: 19 LYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRK 78

Query: 66 YDQG 69
          YD+G
Sbjct: 79 YDRG 82