RPSBLAST alignment for GI: 254780638 and conserved domain: pfam01556

>gnl|CDD|144958 pfam01556, DnaJ_C, DnaJ C terminal region. This family consists of the C terminal region form the DnaJ protein. Although the function of this region is unknown, it is always found associated with pfam00226 and pfam00684. DnaJ is a chaperone associated with the Hsp70 heat-shock system involved in protein folding and renaturation after stress. Length = 101
 Score = 39.4 bits (93), Expect = 0.002
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 221 KLLSVNVPPGVDDGTRIRLSGEG-GAGVYGGAPGDLYIFISVK 262
           + L + +P G   G  +R+ G+G       G  GDL +  +VK
Sbjct: 47  RKLKIKIPAGTQPGDVLRIKGKGMPIFKGSGGRGDLIVTFNVK 89