RPSBLAST alignment for GI: 254780638 and conserved domain: TIGR03835

>gnl|CDD|163547 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ. This model describes TopJ (MG_200, CbpA), a DnaJ homolog and probable assembly protein of the Mycoplasma terminal organelle. The terminal organelle is involved in both cytadherence and gliding motility. Length = 871
 Score = 98.7 bits (245), Expect = 2e-21
 Identities = 51/123 (41%), Positives = 74/123 (60%), Gaps = 7/123 (5%)

Query: 3   KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
           K D+Y+VLGIDR+A ++++K AFR LA KYHPD+N   P+A   FA+I+EA +VL +P+K
Sbjct: 1   KRDYYEVLGIDRDADEQEIKKAFRKLAKKYHPDRN-KAPDAASIFAEINEANDVLSNPKK 59

Query: 63  RALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFE-GIFGGIMGSGRSYKRSSSTG 121
           RA YD+ GH+    G   +    F A ++ NS F E+ + G F  I       K+     
Sbjct: 60  RANYDKYGHD----GVDREDDFDFQADVF-NSFFEEINKSGEFDNITDDDTPSKKKKKKK 114

Query: 122 EAG 124
           + G
Sbjct: 115 KKG 117