RPSBLAST alignment for GI: 254780638 and conserved domain: PRK14290

>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional. Length = 365
 Score =  274 bits (703), Expect = 2e-74
 Identities = 144/362 (39%), Positives = 207/362 (57%), Gaps = 16/362 (4%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQN-RNDPEAKEKFAQISEAYEVLRDPQKR 63
           D+Y++LG+DRNA+   +K AFR LA K+HPD +  N  EA+EKF +ISEAYEVL DPQKR
Sbjct: 4   DYYKILGVDRNASQEDIKKAFRELAKKWHPDLHPGNKAEAEEKFKEISEAYEVLSDPQKR 63

Query: 64  ALYDQGGHEALEYGAQSQGAGGFGAGMYGN-SDFSELFEGIFGGIMGSG--RSYKRSSST 120
             YDQ G   +++GA   G   F    + + SD +++F  IFGG  GS     +    ST
Sbjct: 64  RQYDQTG--TVDFGA---GGSNFNWDNFTHFSDINDIFNQIFGGNFGSDFFSGFGNQQST 118

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
                D+  NL+ISLE+A+ G   +I++     C  CSG+GAK G   + C  C+G+G+ 
Sbjct: 119 RNIDLDIYTNLDISLEDAYYGTEKRIKYRRNAMCPDCSGTGAKNGK-LITCPTCHGTGQQ 177

Query: 181 YTT-AQSFFSIERA--CSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
                Q FF +     C TC G G+I    C +C+G G V   + +SV +P G  D  R+
Sbjct: 178 RIVRGQGFFRMVTVTTCRTCGGRGRIPEEKCPRCNGTGTVVVNEDISVKIPKGATDNLRL 237

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R+ G+G +  YGG  GDLY+ + V      +R   DLY    I+    A+GG  ++    
Sbjct: 238 RVKGKGQS--YGGRTGDLYVVLRVNNDPNIQRINDDLYVDQKINFPQAALGGEIEIKLFR 295

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
             ++ + IPEGTQ G+  ++KG GMP +N    GDL V++ VE P++L  +Q+EL+ EF 
Sbjct: 296 EKYN-LKIPEGTQPGEVLKIKGAGMPHLNGHGSGDLLVRINVEVPKRLTSKQKELIREFF 354

Query: 358 QI 359
            I
Sbjct: 355 DI 356