RPSBLAST alignment for GI: 254780638 and conserved domain: PRK14282

>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional. Length = 369
 Score =  294 bits (755), Expect = 2e-80
 Identities = 140/370 (37%), Positives = 216/370 (58%), Gaps = 10/370 (2%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQN-RNDPEAKEKFAQISEAYEVLRD 59
            +K D+Y++LG+ RNAT  ++K A++ L  ++HPD++  N  EA++KF +I EAYEVL D
Sbjct: 1   REKKDYYEILGVSRNATQEEIKRAYKRLVKEWHPDRHPENRKEAEQKFKEIQEAYEVLSD 60

Query: 60  PQKRALYDQGGH--EALEYGAQSQGAGGFGAGMYGNSDFSELF-EGIFGGIMGSGRSYKR 116
           PQKRA+YD+ G+  E   Y  +++  GGF   ++   DF  +F   IF    G  R+ + 
Sbjct: 61  PQKRAMYDRFGYVGEQPPY-QETESGGGFFEDIF--KDFENIFNRDIFDIFFGERRTQEE 117

Query: 117 SSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNG 176
                  G D+RY +E++L +  +G  + + +     C  C G+G +PG+  + C  C+G
Sbjct: 118 QREYARRGEDIRYEIEVTLSDLINGAEIPVEYDRYETCPHCGGTGVEPGSGYVTCPKCHG 177

Query: 177 SGRVYTTAQSFFSI---ERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDD 233
           +GR+    +SFF +   ER C  C G+G+I    C +C G GR+      +V +P GV+D
Sbjct: 178 TGRIREERRSFFGVFVSERTCERCGGTGKIPGEYCHECGGSGRIRRRVRTTVKIPAGVED 237

Query: 234 GTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDV 293
           GT +R++G G AG YGG  GDLY+ + V+    FKR G+DL   V I  +   +G T +V
Sbjct: 238 GTVLRITGGGNAGYYGGPYGDLYVIVRVRPDPRFKRSGSDLIYDVTIDYLQAILGTTVEV 297

Query: 294 ATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELL 353
              +   + + IP GTQ    FRLKGKG+P +  GR+GDL V V VE P++L++ +R+LL
Sbjct: 298 PLPEGGTTMLKIPPGTQPETVFRLKGKGLPNMRYGRRGDLIVNVHVEIPKRLSREERKLL 357

Query: 354 EEFEQISSQD 363
           +E  +     
Sbjct: 358 KELAKKRGVT 367