RPSBLAST alignment for GI: 254780638 and conserved domain: PRK14292

>gnl|CDD|184608 PRK14292, PRK14292, chaperone protein DnaJ; Provisional. Length = 371
 Score =  280 bits (717), Expect = 6e-76
 Identities = 138/382 (36%), Positives = 208/382 (54%), Gaps = 21/382 (5%)

Query: 4   ADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKR 63
            D+Y++LG+ R A+  ++K+A+R LA+KYHPD+N+ +  A EKFAQI+EAY VL D +KR
Sbjct: 2   MDYYELLGVSRTASADEIKSAYRKLALKYHPDRNK-EKGAAEKFAQINEAYAVLSDAEKR 60

Query: 64  ALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFS--ELFEGIFGGIMGSGRSYKRSSSTG 121
           A YD+ G         + GAG  G   +G   F   ++FE +FGG    G   +R  + G
Sbjct: 61  AHYDRFG--------TAPGAGMPGGDPFGGMGFDPMDIFEQLFGGAGFGGGRGRRGPARG 112

Query: 122 EAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNP-MDCNICNGSGRV 180
           +   DL     I+LE+A +G+ V++      +C  C GS  +PG  P   C  C G+G V
Sbjct: 113 D---DLETEARITLEQARAGEEVEVEVDRLTECEHCHGSRTEPGGKPPKTCPTCRGAGAV 169

Query: 181 YTTAQSFFSI---ERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRI 237
              A++ F +   ++ C TCRG GQII  PC+ C G+GR  + + + V +P G+D+G RI
Sbjct: 170 RAQARTIFGVVETQQPCPTCRGEGQIITDPCTVCRGRGRTLKAETVKVKLPRGIDEGYRI 229

Query: 238 RLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLD 297
           R++G G  G  G   GDLY+ I ++ H   +R+   L     I     A+GG   V TLD
Sbjct: 230 RVAGMGNEGPGGN--GDLYVHIEMEPHPELRREQEHLIYEARIGFAKAALGGQITVPTLD 287

Query: 298 ATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFE 357
                + +  GTQ G   RL+G+GMP +     GDL V+ ++  P++L+   RE LE + 
Sbjct: 288 GPQV-IEVKPGTQHGDLHRLRGQGMPRLQGAGTGDLIVEYEIAVPKQLSPEAREALEAYA 346

Query: 358 QISSQDNNPQSTGFFARMKDFF 379
           +    +      G F ++   F
Sbjct: 347 RAVGDEVPEPHEGLFDKVGKLF 368