RPSBLAST alignment for GI: 254780638 and conserved domain: KOG0713

>gnl|CDD|35932 KOG0713, KOG0713, KOG0713, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]. Length = 336
 Score =  170 bits (431), Expect = 6e-43
 Identities = 109/349 (31%), Positives = 151/349 (43%), Gaps = 40/349 (11%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           DFY++LG+ +NA+D+++K A+R LA+KYHPD+N +DP A EKF +I+ AYEVL DP+KR 
Sbjct: 17  DFYELLGVPKNASDQEIKKAYRKLALKYHPDKNPDDPNANEKFKEINAAYEVLSDPEKRK 76

Query: 65  LYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEA- 123
            YD  G E L+             G  GN  FS  F      + G+           EA 
Sbjct: 77  HYDTYGEEGLK-----DENKDGEGGGGGNDIFSAFFGDFGVTVGGNPL--------EEAL 123

Query: 124 --GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVY 181
             G+D+  +LE  LE  + G  V+      V                       G  ++ 
Sbjct: 124 PKGSDVSSDLEKQLEHFYMGNFVEEVREKGVYKPAPGTRKCNCRLEMFTQQEGPGRFQML 183

Query: 182 TTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSG 241
             A                       C +C     V EE  L V    G  DG       
Sbjct: 184 QEAV----------------------CDECPNVKLVLEEDPLEVEFERGDADGPEEIFEL 221

Query: 242 EGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHS 301
           EG   +  G PGDL+  I    H  F+R G DLY  V IS+    +G   ++  LD  + 
Sbjct: 222 EGEPHID-GVPGDLFFKIVSYTHPRFERKGDDLYTNVTISLEAALVGFEMEILHLDGHYV 280

Query: 302 RVTIPEGTQTGKQFRLKGKGMPVI-NSGRKGDLYVQVQVETPQKLNKRQ 349
            V+  + T  G + R KG+GMP++ N   KG+LYV   VE P+      
Sbjct: 281 EVSRKKITWPGARTRKKGEGMPLLKNRNEKGNLYVTFDVEFPKSSLSDS 329