RPSBLAST alignment for GI: 254780638 and conserved domain: KOG0720

>gnl|CDD|35939 KOG0720, KOG0720, KOG0720, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]. Length = 490
 Score = 60.4 bits (146), Expect = 8e-10
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRA 64
           D Y  LG+  + +D  LK  +R  AM  HPD+N   P A+E F ++  A+EV+ D  KR 
Sbjct: 236 DAYSALGLPSDCSDADLKKNYRKKAMLVHPDKNMI-PRAEEAFKKLQVAFEVIGDSVKRK 294

Query: 65  LYDQ 68
            YD 
Sbjct: 295 EYDL 298