RPSBLAST alignment of GI: 254780638 and protein with PDBid: 1fpo

>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171
 Score = 84.1 bits (207), Expect = 5e-17
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 5  DFYQVLGIDRNAT--DRQLKTAFRSLAMKYHPDQNRNDPEAKEK-----FAQISEAYEVL 57
          D++ + G+        + L   F+ L  +YHPD+  +  +A++       A I++A++ L
Sbjct: 2  DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTL 61

Query: 58 RDPQKRALYDQGGH 71
          R P  RA Y    H
Sbjct: 62 RHPLMRAEYLLSLH 75