RPSBLAST alignment of GI: 254780638 and protein with PDBid: 1hdj

>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77
 Score =  100 bits (250), Expect = 6e-22
 Identities = 38/75 (50%), Positives = 57/75 (76%), Gaps = 2/75 (2%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
          M K D+YQ LG+ R A+D ++K A+R  A++YHPD+N  +P A+EKF +I+EAY+VL DP
Sbjct: 1  MGK-DYYQTLGLARGASDEEIKRAYRRQALRYHPDKN-KEPGAEEKFKEIAEAYDVLSDP 58

Query: 61 QKRALYDQGGHEALE 75
          +KR ++D+ G E L+
Sbjct: 59 RKREIFDRYGEEGLK 73