RPSBLAST alignment of GI: 254780638 and protein with PDBid: 1xao

>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121
 Score = 96.2 bits (239), Expect = 1e-20
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 267 FKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQT--GKQFRLKGKGMPV 324
           FKRDG DL     I ++T   GG F +  +     +V I  G     G +  ++GKGMP+
Sbjct: 2   FKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPI 61

Query: 325 INSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQST 369
              G  G+L ++  ++ P+     +   L++ E+I      P   
Sbjct: 62  PKYGGYGNLIIKFTIKFPENHFTSEEN-LKKLEEILPPRIVPAIP 105