RPSBLAST alignment of GI: 254780638 and protein with PDBid: 2ctp

>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78
 Score = 69.4 bits (169), Expect = 1e-12
 Identities = 34/71 (47%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
              D+Y++LG+ R A+D  LK A+R LA+K+HPD+N   P A E F  I  AY VL +P
Sbjct: 4  GSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHA-PGATEAFKAIGTAYAVLSNP 62

Query: 61 QKRALYDQGGH 71
          +KR  YDQ G 
Sbjct: 63 EKRKQYDQFGS 73