RPSBLAST alignment of GI: 254780638 and protein with PDBid: 2qwo

>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92
 Score = 79.5 bits (196), Expect = 1e-15
 Identities = 12/58 (20%), Positives = 26/58 (44%), Gaps = 3/58 (5%)

Query: 5  DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPE---AKEKFAQISEAYEVLRD 59
            ++ +G+    T  Q+K  +R   +  HP +    P    AK  F ++++A+    +
Sbjct: 34 TKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFEN 91